Initial QSfera import
This commit is contained in:
@@ -0,0 +1,24 @@
|
||||
# Compiled Object files, Static and Dynamic libs (Shared Objects)
|
||||
*.o
|
||||
*.a
|
||||
*.so
|
||||
|
||||
# Folders
|
||||
_obj
|
||||
_test
|
||||
|
||||
# Architecture specific extensions/prefixes
|
||||
*.[568vq]
|
||||
[568vq].out
|
||||
|
||||
*.cgo1.go
|
||||
*.cgo2.c
|
||||
_cgo_defun.c
|
||||
_cgo_gotypes.go
|
||||
_cgo_export.*
|
||||
|
||||
_testmain.go
|
||||
|
||||
*.exe
|
||||
*.test
|
||||
*.prof
|
||||
+57
@@ -0,0 +1,57 @@
|
||||
version: 2
|
||||
|
||||
builds:
|
||||
-
|
||||
id: "cpuid"
|
||||
binary: cpuid
|
||||
main: ./cmd/cpuid/main.go
|
||||
env:
|
||||
- CGO_ENABLED=0
|
||||
flags:
|
||||
- -ldflags=-s -w
|
||||
goos:
|
||||
- aix
|
||||
- linux
|
||||
- freebsd
|
||||
- netbsd
|
||||
- windows
|
||||
- darwin
|
||||
goarch:
|
||||
- 386
|
||||
- amd64
|
||||
- arm64
|
||||
goarm:
|
||||
- 7
|
||||
|
||||
archives:
|
||||
-
|
||||
id: cpuid
|
||||
name_template: "cpuid-{{ .Os }}_{{ .Arch }}{{ if .Arm }}v{{ .Arm }}{{ end }}"
|
||||
format_overrides:
|
||||
- goos: windows
|
||||
format: zip
|
||||
files:
|
||||
- LICENSE
|
||||
checksum:
|
||||
name_template: 'checksums.txt'
|
||||
changelog:
|
||||
sort: asc
|
||||
filters:
|
||||
exclude:
|
||||
- '^doc:'
|
||||
- '^docs:'
|
||||
- '^test:'
|
||||
- '^tests:'
|
||||
- '^Update\sREADME.md'
|
||||
|
||||
nfpms:
|
||||
-
|
||||
file_name_template: "cpuid_package_{{ .Os }}_{{ .Arch }}{{ if .Arm }}v{{ .Arm }}{{ end }}"
|
||||
vendor: Klaus Post
|
||||
homepage: https://github.com/klauspost/cpuid
|
||||
maintainer: Klaus Post <klauspost@gmail.com>
|
||||
description: CPUID Tool
|
||||
license: BSD 3-Clause
|
||||
formats:
|
||||
- deb
|
||||
- rpm
|
||||
+35
@@ -0,0 +1,35 @@
|
||||
Developer Certificate of Origin
|
||||
Version 1.1
|
||||
|
||||
Copyright (C) 2015- Klaus Post & Contributors.
|
||||
Email: klauspost@gmail.com
|
||||
|
||||
Everyone is permitted to copy and distribute verbatim copies of this
|
||||
license document, but changing it is not allowed.
|
||||
|
||||
|
||||
Developer's Certificate of Origin 1.1
|
||||
|
||||
By making a contribution to this project, I certify that:
|
||||
|
||||
(a) The contribution was created in whole or in part by me and I
|
||||
have the right to submit it under the open source license
|
||||
indicated in the file; or
|
||||
|
||||
(b) The contribution is based upon previous work that, to the best
|
||||
of my knowledge, is covered under an appropriate open source
|
||||
license and I have the right under that license to submit that
|
||||
work with modifications, whether created in whole or in part
|
||||
by me, under the same open source license (unless I am
|
||||
permitted to submit under a different license), as indicated
|
||||
in the file; or
|
||||
|
||||
(c) The contribution was provided directly to me by some other
|
||||
person who certified (a), (b) or (c) and I have not modified
|
||||
it.
|
||||
|
||||
(d) I understand and agree that this project and the contribution
|
||||
are public and that a record of the contribution (including all
|
||||
personal information I submit with it, including my sign-off) is
|
||||
maintained indefinitely and may be redistributed consistent with
|
||||
this project or the open source license(s) involved.
|
||||
+22
@@ -0,0 +1,22 @@
|
||||
The MIT License (MIT)
|
||||
|
||||
Copyright (c) 2015 Klaus Post
|
||||
|
||||
Permission is hereby granted, free of charge, to any person obtaining a copy
|
||||
of this software and associated documentation files (the "Software"), to deal
|
||||
in the Software without restriction, including without limitation the rights
|
||||
to use, copy, modify, merge, publish, distribute, sublicense, and/or sell
|
||||
copies of the Software, and to permit persons to whom the Software is
|
||||
furnished to do so, subject to the following conditions:
|
||||
|
||||
The above copyright notice and this permission notice shall be included in all
|
||||
copies or substantial portions of the Software.
|
||||
|
||||
THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR
|
||||
IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY,
|
||||
FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE
|
||||
AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER
|
||||
LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM,
|
||||
OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE
|
||||
SOFTWARE.
|
||||
|
||||
+512
@@ -0,0 +1,512 @@
|
||||
# cpuid
|
||||
Package cpuid provides information about the CPU running the current program.
|
||||
|
||||
CPU features are detected on startup, and kept for fast access through the life of the application.
|
||||
Currently x86 / x64 (AMD64/i386) and ARM (ARM64) is supported, and no external C (cgo) code is used, which should make the library very easy to use.
|
||||
|
||||
You can access the CPU information by accessing the shared CPU variable of the cpuid library.
|
||||
|
||||
Package home: https://github.com/klauspost/cpuid
|
||||
|
||||
[](https://pkg.go.dev/github.com/klauspost/cpuid/v2)
|
||||
[](https://github.com/klauspost/cpuid/actions/workflows/go.yml)
|
||||
|
||||
## installing
|
||||
|
||||
`go get -u github.com/klauspost/cpuid/v2` using modules.
|
||||
Drop `v2` for others.
|
||||
|
||||
Installing binary:
|
||||
|
||||
`go install github.com/klauspost/cpuid/v2/cmd/cpuid@latest`
|
||||
|
||||
Or download binaries from release page: https://github.com/klauspost/cpuid/releases
|
||||
|
||||
### Homebrew
|
||||
|
||||
For macOS/Linux users, you can install via [brew](https://brew.sh/)
|
||||
|
||||
```sh
|
||||
$ brew install cpuid
|
||||
```
|
||||
|
||||
## example
|
||||
|
||||
```Go
|
||||
package main
|
||||
|
||||
import (
|
||||
"fmt"
|
||||
"strings"
|
||||
|
||||
. "github.com/klauspost/cpuid/v2"
|
||||
)
|
||||
|
||||
func main() {
|
||||
// Print basic CPU information:
|
||||
fmt.Println("Name:", CPU.BrandName)
|
||||
fmt.Println("PhysicalCores:", CPU.PhysicalCores)
|
||||
fmt.Println("ThreadsPerCore:", CPU.ThreadsPerCore)
|
||||
fmt.Println("LogicalCores:", CPU.LogicalCores)
|
||||
fmt.Println("Family", CPU.Family, "Model:", CPU.Model, "Vendor ID:", CPU.VendorID)
|
||||
fmt.Println("Features:", strings.Join(CPU.FeatureSet(), ","))
|
||||
fmt.Println("Cacheline bytes:", CPU.CacheLine)
|
||||
fmt.Println("L1 Data Cache:", CPU.Cache.L1D, "bytes")
|
||||
fmt.Println("L1 Instruction Cache:", CPU.Cache.L1I, "bytes")
|
||||
fmt.Println("L2 Cache:", CPU.Cache.L2, "bytes")
|
||||
fmt.Println("L3 Cache:", CPU.Cache.L3, "bytes")
|
||||
fmt.Println("Frequency", CPU.Hz, "hz")
|
||||
|
||||
// Test if we have these specific features:
|
||||
if CPU.Supports(SSE, SSE2) {
|
||||
fmt.Println("We have Streaming SIMD 2 Extensions")
|
||||
}
|
||||
}
|
||||
```
|
||||
|
||||
Sample output:
|
||||
```
|
||||
>go run main.go
|
||||
Name: AMD Ryzen 9 3950X 16-Core Processor
|
||||
PhysicalCores: 16
|
||||
ThreadsPerCore: 2
|
||||
LogicalCores: 32
|
||||
Family 23 Model: 113 Vendor ID: AMD
|
||||
Features: ADX,AESNI,AVX,AVX2,BMI1,BMI2,CLMUL,CMOV,CX16,F16C,FMA3,HTT,HYPERVISOR,LZCNT,MMX,MMXEXT,NX,POPCNT,RDRAND,RDSEED,RDTSCP,SHA,SSE,SSE2,SSE3,SSE4,SSE42,SSE4A,SSSE3
|
||||
Cacheline bytes: 64
|
||||
L1 Data Cache: 32768 bytes
|
||||
L1 Instruction Cache: 32768 bytes
|
||||
L2 Cache: 524288 bytes
|
||||
L3 Cache: 16777216 bytes
|
||||
Frequency 0 hz
|
||||
We have Streaming SIMD 2 Extensions
|
||||
```
|
||||
|
||||
# usage
|
||||
|
||||
The `cpuid.CPU` provides access to CPU features. Use `cpuid.CPU.Supports()` to check for CPU features.
|
||||
A faster `cpuid.CPU.Has()` is provided which will usually be inlined by the gc compiler.
|
||||
|
||||
To test a larger number of features, they can be combined using `f := CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SYSCALL, SSE, SSE2)`, etc.
|
||||
This can be using with `cpuid.CPU.HasAll(f)` to quickly test if all features are supported.
|
||||
|
||||
Note that for some cpu/os combinations some features will not be detected.
|
||||
`amd64` has rather good support and should work reliably on all platforms.
|
||||
|
||||
Note that hypervisors may not pass through all CPU features through to the guest OS,
|
||||
so even if your host supports a feature it may not be visible on guests.
|
||||
|
||||
## arm64 feature detection
|
||||
|
||||
Not all operating systems provide ARM features directly
|
||||
and there is no safe way to do so for the rest.
|
||||
|
||||
Currently `arm64/linux` and `arm64/freebsd` should be quite reliable.
|
||||
`arm64/darwin` adds features expected from the M1 processor, but a lot remains undetected.
|
||||
|
||||
A `DetectARM()` can be used if you are able to control your deployment,
|
||||
it will detect CPU features, but may crash if the OS doesn't intercept the calls.
|
||||
A `-cpu.arm` flag for detecting unsafe ARM features can be added. See below.
|
||||
|
||||
Note that currently only features are detected on ARM,
|
||||
no additional information is currently available.
|
||||
|
||||
## flags
|
||||
|
||||
It is possible to add flags that affects cpu detection.
|
||||
|
||||
For this the `Flags()` command is provided.
|
||||
|
||||
This must be called *before* `flag.Parse()` AND after the flags have been parsed `Detect()` must be called.
|
||||
|
||||
This means that any detection used in `init()` functions will not contain these flags.
|
||||
|
||||
Example:
|
||||
|
||||
```Go
|
||||
package main
|
||||
|
||||
import (
|
||||
"flag"
|
||||
"fmt"
|
||||
"strings"
|
||||
|
||||
"github.com/klauspost/cpuid/v2"
|
||||
)
|
||||
|
||||
func main() {
|
||||
cpuid.Flags()
|
||||
flag.Parse()
|
||||
cpuid.Detect()
|
||||
|
||||
// Test if we have these specific features:
|
||||
if cpuid.CPU.Supports(cpuid.SSE, cpuid.SSE2) {
|
||||
fmt.Println("We have Streaming SIMD 2 Extensions")
|
||||
}
|
||||
}
|
||||
```
|
||||
|
||||
## commandline
|
||||
|
||||
Download as binary from: https://github.com/klauspost/cpuid/releases
|
||||
|
||||
Install from source:
|
||||
|
||||
`go install github.com/klauspost/cpuid/v2/cmd/cpuid@latest`
|
||||
|
||||
### Example
|
||||
|
||||
```
|
||||
λ cpuid
|
||||
Name: AMD Ryzen 9 3950X 16-Core Processor
|
||||
Vendor String: AuthenticAMD
|
||||
Vendor ID: AMD
|
||||
PhysicalCores: 16
|
||||
Threads Per Core: 2
|
||||
Logical Cores: 32
|
||||
CPU Family 23 Model: 113
|
||||
Features: ADX,AESNI,AVX,AVX2,BMI1,BMI2,CLMUL,CLZERO,CMOV,CMPXCHG8,CPBOOST,CX16,F16C,FMA3,FXSR,FXSROPT,HTT,HYPERVISOR,LAHF,LZCNT,MCAOVERFLOW,MMX,MMXEXT,MOVBE,NX,OSXSAVE,POPCNT,RDRAND,RDSEED,RDTSCP,SCE,SHA,SSE,SSE2,SSE3,SSE4,SSE42,SSE4A,SSSE3,SUCCOR,X87,XSAVE
|
||||
Microarchitecture level: 3
|
||||
Cacheline bytes: 64
|
||||
L1 Instruction Cache: 32768 bytes
|
||||
L1 Data Cache: 32768 bytes
|
||||
L2 Cache: 524288 bytes
|
||||
L3 Cache: 16777216 bytes
|
||||
|
||||
```
|
||||
### JSON Output:
|
||||
|
||||
```
|
||||
λ cpuid --json
|
||||
{
|
||||
"BrandName": "AMD Ryzen 9 3950X 16-Core Processor",
|
||||
"VendorID": 2,
|
||||
"VendorString": "AuthenticAMD",
|
||||
"PhysicalCores": 16,
|
||||
"ThreadsPerCore": 2,
|
||||
"LogicalCores": 32,
|
||||
"Family": 23,
|
||||
"Model": 113,
|
||||
"CacheLine": 64,
|
||||
"Hz": 0,
|
||||
"BoostFreq": 0,
|
||||
"Cache": {
|
||||
"L1I": 32768,
|
||||
"L1D": 32768,
|
||||
"L2": 524288,
|
||||
"L3": 16777216
|
||||
},
|
||||
"SGX": {
|
||||
"Available": false,
|
||||
"LaunchControl": false,
|
||||
"SGX1Supported": false,
|
||||
"SGX2Supported": false,
|
||||
"MaxEnclaveSizeNot64": 0,
|
||||
"MaxEnclaveSize64": 0,
|
||||
"EPCSections": null
|
||||
},
|
||||
"Features": [
|
||||
"ADX",
|
||||
"AESNI",
|
||||
"AVX",
|
||||
"AVX2",
|
||||
"BMI1",
|
||||
"BMI2",
|
||||
"CLMUL",
|
||||
"CLZERO",
|
||||
"CMOV",
|
||||
"CMPXCHG8",
|
||||
"CPBOOST",
|
||||
"CX16",
|
||||
"F16C",
|
||||
"FMA3",
|
||||
"FXSR",
|
||||
"FXSROPT",
|
||||
"HTT",
|
||||
"HYPERVISOR",
|
||||
"LAHF",
|
||||
"LZCNT",
|
||||
"MCAOVERFLOW",
|
||||
"MMX",
|
||||
"MMXEXT",
|
||||
"MOVBE",
|
||||
"NX",
|
||||
"OSXSAVE",
|
||||
"POPCNT",
|
||||
"RDRAND",
|
||||
"RDSEED",
|
||||
"RDTSCP",
|
||||
"SCE",
|
||||
"SHA",
|
||||
"SSE",
|
||||
"SSE2",
|
||||
"SSE3",
|
||||
"SSE4",
|
||||
"SSE42",
|
||||
"SSE4A",
|
||||
"SSSE3",
|
||||
"SUCCOR",
|
||||
"X87",
|
||||
"XSAVE"
|
||||
],
|
||||
"X64Level": 3
|
||||
}
|
||||
```
|
||||
|
||||
### Check CPU microarch level
|
||||
|
||||
```
|
||||
λ cpuid --check-level=3
|
||||
2022/03/18 17:04:40 AMD Ryzen 9 3950X 16-Core Processor
|
||||
2022/03/18 17:04:40 Microarchitecture level 3 is supported. Max level is 3.
|
||||
Exit Code 0
|
||||
|
||||
λ cpuid --check-level=4
|
||||
2022/03/18 17:06:18 AMD Ryzen 9 3950X 16-Core Processor
|
||||
2022/03/18 17:06:18 Microarchitecture level 4 not supported. Max level is 3.
|
||||
Exit Code 1
|
||||
```
|
||||
|
||||
|
||||
## Available flags
|
||||
|
||||
### x86 & amd64
|
||||
|
||||
| Feature Flag | Description |
|
||||
|--------------------|------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------|
|
||||
| ADX | Intel ADX (Multi-Precision Add-Carry Instruction Extensions) |
|
||||
| AESNI | Advanced Encryption Standard New Instructions |
|
||||
| AMD3DNOW | AMD 3DNOW |
|
||||
| AMD3DNOWEXT | AMD 3DNowExt |
|
||||
| AMXBF16 | Tile computational operations on BFLOAT16 numbers |
|
||||
| AMXINT8 | Tile computational operations on 8-bit integers |
|
||||
| AMXFP16 | Tile computational operations on FP16 numbers |
|
||||
| AMXFP8 | Tile computational operations on FP8 numbers |
|
||||
| AMXCOMPLEX | Tile computational operations on complex numbers |
|
||||
| AMXTILE | Tile architecture |
|
||||
| AMXTF32 | Matrix Multiplication of TF32 Tiles into Packed Single Precision Tile |
|
||||
| AMXTRANSPOSE | Tile multiply where the first operand is transposed |
|
||||
| APX_F | Intel APX |
|
||||
| AVX | AVX functions |
|
||||
| AVX10 | If set the Intel AVX10 Converged Vector ISA is supported |
|
||||
| AVX10_128 | If set indicates that AVX10 128-bit vector support is present |
|
||||
| AVX10_256 | If set indicates that AVX10 256-bit vector support is present |
|
||||
| AVX10_512 | If set indicates that AVX10 512-bit vector support is present |
|
||||
| AVX2 | AVX2 functions |
|
||||
| AVX512BF16 | AVX-512 BFLOAT16 Instructions |
|
||||
| AVX512BITALG | AVX-512 Bit Algorithms |
|
||||
| AVX512BW | AVX-512 Byte and Word Instructions |
|
||||
| AVX512CD | AVX-512 Conflict Detection Instructions |
|
||||
| AVX512DQ | AVX-512 Doubleword and Quadword Instructions |
|
||||
| AVX512ER | AVX-512 Exponential and Reciprocal Instructions |
|
||||
| AVX512F | AVX-512 Foundation |
|
||||
| AVX512FP16 | AVX-512 FP16 Instructions |
|
||||
| AVX512IFMA | AVX-512 Integer Fused Multiply-Add Instructions |
|
||||
| AVX512PF | AVX-512 Prefetch Instructions |
|
||||
| AVX512VBMI | AVX-512 Vector Bit Manipulation Instructions |
|
||||
| AVX512VBMI2 | AVX-512 Vector Bit Manipulation Instructions, Version 2 |
|
||||
| AVX512VL | AVX-512 Vector Length Extensions |
|
||||
| AVX512VNNI | AVX-512 Vector Neural Network Instructions |
|
||||
| AVX512VP2INTERSECT | AVX-512 Intersect for D/Q |
|
||||
| AVX512VPOPCNTDQ | AVX-512 Vector Population Count Doubleword and Quadword |
|
||||
| AVXIFMA | AVX-IFMA instructions |
|
||||
| AVXNECONVERT | AVX-NE-CONVERT instructions |
|
||||
| AVXSLOW | Indicates the CPU performs 2 128 bit operations instead of one |
|
||||
| AVXVNNI | AVX (VEX encoded) VNNI neural network instructions |
|
||||
| AVXVNNIINT8 | AVX-VNNI-INT8 instructions |
|
||||
| AVXVNNIINT16 | AVX-VNNI-INT16 instructions |
|
||||
| BHI_CTRL | Branch History Injection and Intra-mode Branch Target Injection / CVE-2022-0001, CVE-2022-0002 / INTEL-SA-00598 |
|
||||
| BMI1 | Bit Manipulation Instruction Set 1 |
|
||||
| BMI2 | Bit Manipulation Instruction Set 2 |
|
||||
| CETIBT | Intel CET Indirect Branch Tracking |
|
||||
| CETSS | Intel CET Shadow Stack |
|
||||
| CLDEMOTE | Cache Line Demote |
|
||||
| CLMUL | Carry-less Multiplication |
|
||||
| CLZERO | CLZERO instruction supported |
|
||||
| CMOV | i686 CMOV |
|
||||
| CMPCCXADD | CMPCCXADD instructions |
|
||||
| CMPSB_SCADBS_SHORT | Fast short CMPSB and SCASB |
|
||||
| CMPXCHG8 | CMPXCHG8 instruction |
|
||||
| CPBOOST | Core Performance Boost |
|
||||
| CPPC | AMD: Collaborative Processor Performance Control |
|
||||
| CX16 | CMPXCHG16B Instruction |
|
||||
| EFER_LMSLE_UNS | AMD: =Core::X86::Msr::EFER[LMSLE] is not supported, and MBZ |
|
||||
| ENQCMD | Enqueue Command |
|
||||
| ERMS | Enhanced REP MOVSB/STOSB |
|
||||
| F16C | Half-precision floating-point conversion |
|
||||
| FLUSH_L1D | Flush L1D cache |
|
||||
| FMA3 | Intel FMA 3. Does not imply AVX. |
|
||||
| FMA4 | Bulldozer FMA4 functions |
|
||||
| FP128 | AMD: When set, the internal FP/SIMD execution datapath is 128-bits wide |
|
||||
| FP256 | AMD: When set, the internal FP/SIMD execution datapath is 256-bits wide |
|
||||
| FSRM | Fast Short Rep Mov |
|
||||
| FXSR | FXSAVE, FXRESTOR instructions, CR4 bit 9 |
|
||||
| FXSROPT | FXSAVE/FXRSTOR optimizations |
|
||||
| GFNI | Galois Field New Instructions. May require other features (AVX, AVX512VL,AVX512F) based on usage. |
|
||||
| HLE | Hardware Lock Elision |
|
||||
| HRESET | If set CPU supports history reset and the IA32_HRESET_ENABLE MSR |
|
||||
| HTT | Hyperthreading (enabled) |
|
||||
| HWA | Hardware assert supported. Indicates support for MSRC001_10 |
|
||||
| HYBRID_CPU | This part has CPUs of more than one type. |
|
||||
| HYPERVISOR | This bit has been reserved by Intel & AMD for use by hypervisors |
|
||||
| IA32_ARCH_CAP | IA32_ARCH_CAPABILITIES MSR (Intel) |
|
||||
| IA32_CORE_CAP | IA32_CORE_CAPABILITIES MSR |
|
||||
| IBPB | Indirect Branch Restricted Speculation (IBRS) and Indirect Branch Predictor Barrier (IBPB) |
|
||||
| IBRS | AMD: Indirect Branch Restricted Speculation |
|
||||
| IBRS_PREFERRED | AMD: IBRS is preferred over software solution |
|
||||
| IBRS_PROVIDES_SMP | AMD: IBRS provides Same Mode Protection |
|
||||
| IBS | Instruction Based Sampling (AMD) |
|
||||
| IBSBRNTRGT | Instruction Based Sampling Feature (AMD) |
|
||||
| IBSFETCHSAM | Instruction Based Sampling Feature (AMD) |
|
||||
| IBSFFV | Instruction Based Sampling Feature (AMD) |
|
||||
| IBSOPCNT | Instruction Based Sampling Feature (AMD) |
|
||||
| IBSOPCNTEXT | Instruction Based Sampling Feature (AMD) |
|
||||
| IBSOPSAM | Instruction Based Sampling Feature (AMD) |
|
||||
| IBSRDWROPCNT | Instruction Based Sampling Feature (AMD) |
|
||||
| IBSRIPINVALIDCHK | Instruction Based Sampling Feature (AMD) |
|
||||
| IBS_FETCH_CTLX | AMD: IBS fetch control extended MSR supported |
|
||||
| IBS_OPDATA4 | AMD: IBS op data 4 MSR supported |
|
||||
| IBS_OPFUSE | AMD: Indicates support for IbsOpFuse |
|
||||
| IBS_PREVENTHOST | Disallowing IBS use by the host supported |
|
||||
| IBS_ZEN4 | Fetch and Op IBS support IBS extensions added with Zen4 |
|
||||
| IDPRED_CTRL | IPRED_DIS |
|
||||
| INT_WBINVD | WBINVD/WBNOINVD are interruptible. |
|
||||
| INVLPGB | NVLPGB and TLBSYNC instruction supported |
|
||||
| KEYLOCKER | Key locker |
|
||||
| KEYLOCKERW | Key locker wide |
|
||||
| LAHF | LAHF/SAHF in long mode |
|
||||
| LAM | If set, CPU supports Linear Address Masking |
|
||||
| LBRVIRT | LBR virtualization |
|
||||
| LZCNT | LZCNT instruction |
|
||||
| MCAOVERFLOW | MCA overflow recovery support. |
|
||||
| MCDT_NO | Processor do not exhibit MXCSR Configuration Dependent Timing behavior and do not need to mitigate it. |
|
||||
| MCOMMIT | MCOMMIT instruction supported |
|
||||
| MD_CLEAR | VERW clears CPU buffers |
|
||||
| MMX | standard MMX |
|
||||
| MMXEXT | SSE integer functions or AMD MMX ext |
|
||||
| MOVBE | MOVBE instruction (big-endian) |
|
||||
| MOVDIR64B | Move 64 Bytes as Direct Store |
|
||||
| MOVDIRI | Move Doubleword as Direct Store |
|
||||
| MOVSB_ZL | Fast Zero-Length MOVSB |
|
||||
| MPX | Intel MPX (Memory Protection Extensions) |
|
||||
| MOVU | MOVU SSE instructions are more efficient and should be preferred to SSE MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD |
|
||||
| MSRIRC | Instruction Retired Counter MSR available |
|
||||
| MSRLIST | Read/Write List of Model Specific Registers |
|
||||
| MSR_PAGEFLUSH | Page Flush MSR available |
|
||||
| NRIPS | Indicates support for NRIP save on VMEXIT |
|
||||
| NX | NX (No-Execute) bit |
|
||||
| OSXSAVE | XSAVE enabled by OS |
|
||||
| PCONFIG | PCONFIG for Intel Multi-Key Total Memory Encryption |
|
||||
| POPCNT | POPCNT instruction |
|
||||
| PPIN | AMD: Protected Processor Inventory Number support. Indicates that Protected Processor Inventory Number (PPIN) capability can be enabled |
|
||||
| PREFETCHI | PREFETCHIT0/1 instructions |
|
||||
| PSFD | Predictive Store Forward Disable |
|
||||
| RDPRU | RDPRU instruction supported |
|
||||
| RDRAND | RDRAND instruction is available |
|
||||
| RDSEED | RDSEED instruction is available |
|
||||
| RDTSCP | RDTSCP Instruction |
|
||||
| RRSBA_CTRL | Restricted RSB Alternate |
|
||||
| RTM | Restricted Transactional Memory |
|
||||
| RTM_ALWAYS_ABORT | Indicates that the loaded microcode is forcing RTM abort. |
|
||||
| SERIALIZE | Serialize Instruction Execution |
|
||||
| SEV | AMD Secure Encrypted Virtualization supported |
|
||||
| SEV_64BIT | AMD SEV guest execution only allowed from a 64-bit host |
|
||||
| SEV_ALTERNATIVE | AMD SEV Alternate Injection supported |
|
||||
| SEV_DEBUGSWAP | Full debug state swap supported for SEV-ES guests |
|
||||
| SEV_ES | AMD SEV Encrypted State supported |
|
||||
| SEV_RESTRICTED | AMD SEV Restricted Injection supported |
|
||||
| SEV_SNP | AMD SEV Secure Nested Paging supported |
|
||||
| SGX | Software Guard Extensions |
|
||||
| SGXLC | Software Guard Extensions Launch Control |
|
||||
| SGXPQC | Software Guard Extensions 256-bit Encryption |
|
||||
| SHA | Intel SHA Extensions |
|
||||
| SME | AMD Secure Memory Encryption supported |
|
||||
| SME_COHERENT | AMD Hardware cache coherency across encryption domains enforced |
|
||||
| SM3_X86 | SM3 instructions |
|
||||
| SM4_X86 | SM4 instructions |
|
||||
| SPEC_CTRL_SSBD | Speculative Store Bypass Disable |
|
||||
| SRBDS_CTRL | SRBDS mitigation MSR available |
|
||||
| SSE | SSE functions |
|
||||
| SSE2 | P4 SSE functions |
|
||||
| SSE3 | Prescott SSE3 functions |
|
||||
| SSE4 | Penryn SSE4.1 functions |
|
||||
| SSE42 | Nehalem SSE4.2 functions |
|
||||
| SSE4A | AMD Barcelona microarchitecture SSE4a instructions |
|
||||
| SSSE3 | Conroe SSSE3 functions |
|
||||
| STIBP | Single Thread Indirect Branch Predictors |
|
||||
| STIBP_ALWAYSON | AMD: Single Thread Indirect Branch Prediction Mode has Enhanced Performance and may be left Always On |
|
||||
| STOSB_SHORT | Fast short STOSB |
|
||||
| SUCCOR | Software uncorrectable error containment and recovery capability. |
|
||||
| SVM | AMD Secure Virtual Machine |
|
||||
| SVMDA | Indicates support for the SVM decode assists. |
|
||||
| SVMFBASID | SVM, Indicates that TLB flush events, including CR3 writes and CR4.PGE toggles, flush only the current ASID's TLB entries. Also indicates support for the extended VMCBTLB_Control |
|
||||
| SVML | AMD SVM lock. Indicates support for SVM-Lock. |
|
||||
| SVMNP | AMD SVM nested paging |
|
||||
| SVMPF | SVM pause intercept filter. Indicates support for the pause intercept filter |
|
||||
| SVMPFT | SVM PAUSE filter threshold. Indicates support for the PAUSE filter cycle count threshold |
|
||||
| SYSCALL | System-Call Extension (SCE): SYSCALL and SYSRET instructions. |
|
||||
| SYSEE | SYSENTER and SYSEXIT instructions |
|
||||
| TBM | AMD Trailing Bit Manipulation |
|
||||
| TDX_GUEST | Intel Trust Domain Extensions Guest |
|
||||
| TLB_FLUSH_NESTED | AMD: Flushing includes all the nested translations for guest translations |
|
||||
| TME | Intel Total Memory Encryption. The following MSRs are supported: IA32_TME_CAPABILITY, IA32_TME_ACTIVATE, IA32_TME_EXCLUDE_MASK, and IA32_TME_EXCLUDE_BASE. |
|
||||
| TOPEXT | TopologyExtensions: topology extensions support. Indicates support for CPUID Fn8000_001D_EAX_x[N:0]-CPUID Fn8000_001E_EDX. |
|
||||
| TSA_L1_NO | AMD only: Not vulnerable to TSA-L1 |
|
||||
| TSA_SQ_NO | AMD only: Not vulnerable to TSA-SQ |
|
||||
| TSA_VERW_CLEAR | AMD: If set, the memory form of the VERW instruction may be used to help mitigate TSA |
|
||||
| TSCRATEMSR | MSR based TSC rate control. Indicates support for MSR TSC ratio MSRC000_0104 |
|
||||
| TSXLDTRK | Intel TSX Suspend Load Address Tracking |
|
||||
| VAES | Vector AES. AVX(512) versions requires additional checks. |
|
||||
| VMCBCLEAN | VMCB clean bits. Indicates support for VMCB clean bits. |
|
||||
| VMPL | AMD VM Permission Levels supported |
|
||||
| VMSA_REGPROT | AMD VMSA Register Protection supported |
|
||||
| VMX | Virtual Machine Extensions |
|
||||
| VPCLMULQDQ | Carry-Less Multiplication Quadword. Requires AVX for 3 register versions. |
|
||||
| VTE | AMD Virtual Transparent Encryption supported |
|
||||
| WAITPKG | TPAUSE, UMONITOR, UMWAIT |
|
||||
| WBNOINVD | Write Back and Do Not Invalidate Cache |
|
||||
| WRMSRNS | Non-Serializing Write to Model Specific Register |
|
||||
| X87 | FPU |
|
||||
| XGETBV1 | Supports XGETBV with ECX = 1 |
|
||||
| XOP | Bulldozer XOP functions |
|
||||
| XSAVE | XSAVE, XRESTOR, XSETBV, XGETBV |
|
||||
| XSAVEC | Supports XSAVEC and the compacted form of XRSTOR. |
|
||||
| XSAVEOPT | XSAVEOPT available |
|
||||
| XSAVES | Supports XSAVES/XRSTORS and IA32_XSS |
|
||||
|
||||
# ARM features:
|
||||
|
||||
| Feature Flag | Description |
|
||||
|--------------|------------------------------------------------------------------|
|
||||
| AESARM | AES instructions |
|
||||
| ARMCPUID | Some CPU ID registers readable at user-level |
|
||||
| ASIMD | Advanced SIMD |
|
||||
| ASIMDDP | SIMD Dot Product |
|
||||
| ASIMDHP | Advanced SIMD half-precision floating point |
|
||||
| ASIMDRDM | Rounding Double Multiply Accumulate/Subtract (SQRDMLAH/SQRDMLSH) |
|
||||
| ATOMICS | Large System Extensions (LSE) |
|
||||
| CRC32 | CRC32/CRC32C instructions |
|
||||
| DCPOP | Data cache clean to Point of Persistence (DC CVAP) |
|
||||
| EVTSTRM | Generic timer |
|
||||
| FCMA | Floatin point complex number addition and multiplication |
|
||||
| FHM | FMLAL and FMLSL instructions |
|
||||
| FP | Single-precision and double-precision floating point |
|
||||
| FPHP | Half-precision floating point |
|
||||
| GPA | Generic Pointer Authentication |
|
||||
| JSCVT | Javascript-style double->int convert (FJCVTZS) |
|
||||
| LRCPC | Weaker release consistency (LDAPR, etc) |
|
||||
| PMULL | Polynomial Multiply instructions (PMULL/PMULL2) |
|
||||
| RNDR | Random Number instructions |
|
||||
| TLB | Outer Shareable and TLB range maintenance instructions |
|
||||
| TS | Flag manipulation instructions |
|
||||
| SHA1 | SHA-1 instructions (SHA1C, etc) |
|
||||
| SHA2 | SHA-2 instructions (SHA256H, etc) |
|
||||
| SHA3 | SHA-3 instructions (EOR3, RAXI, XAR, BCAX) |
|
||||
| SHA512 | SHA512 instructions |
|
||||
| SM3 | SM3 instructions |
|
||||
| SM4 | SM4 instructions |
|
||||
| SVE | Scalable Vector Extension |
|
||||
|
||||
# license
|
||||
|
||||
This code is published under an MIT license. See LICENSE file for more information.
|
||||
+1679
File diff suppressed because it is too large
Load Diff
+47
@@ -0,0 +1,47 @@
|
||||
// Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file.
|
||||
|
||||
//+build 386,!gccgo,!noasm,!appengine
|
||||
|
||||
// func asmCpuid(op uint32) (eax, ebx, ecx, edx uint32)
|
||||
TEXT ·asmCpuid(SB), 7, $0
|
||||
XORL CX, CX
|
||||
MOVL op+0(FP), AX
|
||||
CPUID
|
||||
MOVL AX, eax+4(FP)
|
||||
MOVL BX, ebx+8(FP)
|
||||
MOVL CX, ecx+12(FP)
|
||||
MOVL DX, edx+16(FP)
|
||||
RET
|
||||
|
||||
// func asmCpuidex(op, op2 uint32) (eax, ebx, ecx, edx uint32)
|
||||
TEXT ·asmCpuidex(SB), 7, $0
|
||||
MOVL op+0(FP), AX
|
||||
MOVL op2+4(FP), CX
|
||||
CPUID
|
||||
MOVL AX, eax+8(FP)
|
||||
MOVL BX, ebx+12(FP)
|
||||
MOVL CX, ecx+16(FP)
|
||||
MOVL DX, edx+20(FP)
|
||||
RET
|
||||
|
||||
// func xgetbv(index uint32) (eax, edx uint32)
|
||||
TEXT ·asmXgetbv(SB), 7, $0
|
||||
MOVL index+0(FP), CX
|
||||
BYTE $0x0f; BYTE $0x01; BYTE $0xd0 // XGETBV
|
||||
MOVL AX, eax+4(FP)
|
||||
MOVL DX, edx+8(FP)
|
||||
RET
|
||||
|
||||
// func asmRdtscpAsm() (eax, ebx, ecx, edx uint32)
|
||||
TEXT ·asmRdtscpAsm(SB), 7, $0
|
||||
BYTE $0x0F; BYTE $0x01; BYTE $0xF9 // RDTSCP
|
||||
MOVL AX, eax+0(FP)
|
||||
MOVL BX, ebx+4(FP)
|
||||
MOVL CX, ecx+8(FP)
|
||||
MOVL DX, edx+12(FP)
|
||||
RET
|
||||
|
||||
// func asmDarwinHasAVX512() bool
|
||||
TEXT ·asmDarwinHasAVX512(SB), 7, $0
|
||||
MOVL $0, eax+0(FP)
|
||||
RET
|
||||
+72
@@ -0,0 +1,72 @@
|
||||
// Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file.
|
||||
|
||||
//+build amd64,!gccgo,!noasm,!appengine
|
||||
|
||||
// func asmCpuid(op uint32) (eax, ebx, ecx, edx uint32)
|
||||
TEXT ·asmCpuid(SB), 7, $0
|
||||
XORQ CX, CX
|
||||
MOVL op+0(FP), AX
|
||||
CPUID
|
||||
MOVL AX, eax+8(FP)
|
||||
MOVL BX, ebx+12(FP)
|
||||
MOVL CX, ecx+16(FP)
|
||||
MOVL DX, edx+20(FP)
|
||||
RET
|
||||
|
||||
// func asmCpuidex(op, op2 uint32) (eax, ebx, ecx, edx uint32)
|
||||
TEXT ·asmCpuidex(SB), 7, $0
|
||||
MOVL op+0(FP), AX
|
||||
MOVL op2+4(FP), CX
|
||||
CPUID
|
||||
MOVL AX, eax+8(FP)
|
||||
MOVL BX, ebx+12(FP)
|
||||
MOVL CX, ecx+16(FP)
|
||||
MOVL DX, edx+20(FP)
|
||||
RET
|
||||
|
||||
// func asmXgetbv(index uint32) (eax, edx uint32)
|
||||
TEXT ·asmXgetbv(SB), 7, $0
|
||||
MOVL index+0(FP), CX
|
||||
BYTE $0x0f; BYTE $0x01; BYTE $0xd0 // XGETBV
|
||||
MOVL AX, eax+8(FP)
|
||||
MOVL DX, edx+12(FP)
|
||||
RET
|
||||
|
||||
// func asmRdtscpAsm() (eax, ebx, ecx, edx uint32)
|
||||
TEXT ·asmRdtscpAsm(SB), 7, $0
|
||||
BYTE $0x0F; BYTE $0x01; BYTE $0xF9 // RDTSCP
|
||||
MOVL AX, eax+0(FP)
|
||||
MOVL BX, ebx+4(FP)
|
||||
MOVL CX, ecx+8(FP)
|
||||
MOVL DX, edx+12(FP)
|
||||
RET
|
||||
|
||||
// From https://go-review.googlesource.com/c/sys/+/285572/
|
||||
// func asmDarwinHasAVX512() bool
|
||||
TEXT ·asmDarwinHasAVX512(SB), 7, $0-1
|
||||
MOVB $0, ret+0(FP) // default to false
|
||||
|
||||
#ifdef GOOS_darwin // return if not darwin
|
||||
#ifdef GOARCH_amd64 // return if not amd64
|
||||
// These values from:
|
||||
// https://github.com/apple/darwin-xnu/blob/xnu-4570.1.46/osfmk/i386/cpu_capabilities.h
|
||||
#define commpage64_base_address 0x00007fffffe00000
|
||||
#define commpage64_cpu_capabilities64 (commpage64_base_address+0x010)
|
||||
#define commpage64_version (commpage64_base_address+0x01E)
|
||||
#define hasAVX512F 0x0000004000000000
|
||||
MOVQ $commpage64_version, BX
|
||||
MOVW (BX), AX
|
||||
CMPW AX, $13 // versions < 13 do not support AVX512
|
||||
JL no_avx512
|
||||
MOVQ $commpage64_cpu_capabilities64, BX
|
||||
MOVQ (BX), AX
|
||||
MOVQ $hasAVX512F, CX
|
||||
ANDQ CX, AX
|
||||
JZ no_avx512
|
||||
MOVB $1, ret+0(FP)
|
||||
|
||||
no_avx512:
|
||||
#endif
|
||||
#endif
|
||||
RET
|
||||
|
||||
+36
@@ -0,0 +1,36 @@
|
||||
// Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file.
|
||||
|
||||
//+build arm64,!gccgo,!noasm,!appengine
|
||||
|
||||
// See https://www.kernel.org/doc/Documentation/arm64/cpu-feature-registers.txt
|
||||
|
||||
// func getMidr
|
||||
TEXT ·getMidr(SB), 7, $0
|
||||
WORD $0xd5380000 // mrs x0, midr_el1 /* Main ID Register */
|
||||
MOVD R0, midr+0(FP)
|
||||
RET
|
||||
|
||||
// func getProcFeatures
|
||||
TEXT ·getProcFeatures(SB), 7, $0
|
||||
WORD $0xd5380400 // mrs x0, id_aa64pfr0_el1 /* Processor Feature Register 0 */
|
||||
MOVD R0, procFeatures+0(FP)
|
||||
RET
|
||||
|
||||
// func getInstAttributes
|
||||
TEXT ·getInstAttributes(SB), 7, $0
|
||||
WORD $0xd5380600 // mrs x0, id_aa64isar0_el1 /* Instruction Set Attribute Register 0 */
|
||||
WORD $0xd5380621 // mrs x1, id_aa64isar1_el1 /* Instruction Set Attribute Register 1 */
|
||||
MOVD R0, instAttrReg0+0(FP)
|
||||
MOVD R1, instAttrReg1+8(FP)
|
||||
RET
|
||||
|
||||
TEXT ·getVectorLength(SB), 7, $0
|
||||
WORD $0xd2800002 // mov x2, #0
|
||||
WORD $0x04225022 // addvl x2, x2, #1
|
||||
WORD $0xd37df042 // lsl x2, x2, #3
|
||||
WORD $0xd2800003 // mov x3, #0
|
||||
WORD $0x04635023 // addpl x3, x3, #1
|
||||
WORD $0xd37df063 // lsl x3, x3, #3
|
||||
MOVD R2, vl+0(FP)
|
||||
MOVD R3, pl+8(FP)
|
||||
RET
|
||||
+250
@@ -0,0 +1,250 @@
|
||||
// Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file.
|
||||
|
||||
//go:build arm64 && !gccgo && !noasm && !appengine
|
||||
// +build arm64,!gccgo,!noasm,!appengine
|
||||
|
||||
package cpuid
|
||||
|
||||
import "runtime"
|
||||
|
||||
func getMidr() (midr uint64)
|
||||
func getProcFeatures() (procFeatures uint64)
|
||||
func getInstAttributes() (instAttrReg0, instAttrReg1 uint64)
|
||||
func getVectorLength() (vl, pl uint64)
|
||||
|
||||
func initCPU() {
|
||||
cpuid = func(uint32) (a, b, c, d uint32) { return 0, 0, 0, 0 }
|
||||
cpuidex = func(x, y uint32) (a, b, c, d uint32) { return 0, 0, 0, 0 }
|
||||
xgetbv = func(uint32) (a, b uint32) { return 0, 0 }
|
||||
rdtscpAsm = func() (a, b, c, d uint32) { return 0, 0, 0, 0 }
|
||||
}
|
||||
|
||||
func addInfo(c *CPUInfo, safe bool) {
|
||||
// Seems to be safe to assume on ARM64
|
||||
c.CacheLine = 64
|
||||
detectOS(c)
|
||||
|
||||
// ARM64 disabled since it may crash if interrupt is not intercepted by OS.
|
||||
if safe && !c.Has(ARMCPUID) && runtime.GOOS != "freebsd" {
|
||||
return
|
||||
}
|
||||
midr := getMidr()
|
||||
|
||||
// MIDR_EL1 - Main ID Register
|
||||
// https://developer.arm.com/docs/ddi0595/h/aarch64-system-registers/midr_el1
|
||||
// x--------------------------------------------------x
|
||||
// | Name | bits | visible |
|
||||
// |--------------------------------------------------|
|
||||
// | Implementer | [31-24] | y |
|
||||
// |--------------------------------------------------|
|
||||
// | Variant | [23-20] | y |
|
||||
// |--------------------------------------------------|
|
||||
// | Architecture | [19-16] | y |
|
||||
// |--------------------------------------------------|
|
||||
// | PartNum | [15-4] | y |
|
||||
// |--------------------------------------------------|
|
||||
// | Revision | [3-0] | y |
|
||||
// x--------------------------------------------------x
|
||||
|
||||
switch (midr >> 24) & 0xff {
|
||||
case 0xC0:
|
||||
c.VendorString = "Ampere Computing"
|
||||
c.VendorID = Ampere
|
||||
case 0x41:
|
||||
c.VendorString = "Arm Limited"
|
||||
c.VendorID = ARM
|
||||
case 0x42:
|
||||
c.VendorString = "Broadcom Corporation"
|
||||
c.VendorID = Broadcom
|
||||
case 0x43:
|
||||
c.VendorString = "Cavium Inc"
|
||||
c.VendorID = Cavium
|
||||
case 0x44:
|
||||
c.VendorString = "Digital Equipment Corporation"
|
||||
c.VendorID = DEC
|
||||
case 0x46:
|
||||
c.VendorString = "Fujitsu Ltd"
|
||||
c.VendorID = Fujitsu
|
||||
case 0x49:
|
||||
c.VendorString = "Infineon Technologies AG"
|
||||
c.VendorID = Infineon
|
||||
case 0x4D:
|
||||
c.VendorString = "Motorola or Freescale Semiconductor Inc"
|
||||
c.VendorID = Motorola
|
||||
case 0x4E:
|
||||
c.VendorString = "NVIDIA Corporation"
|
||||
c.VendorID = NVIDIA
|
||||
case 0x50:
|
||||
c.VendorString = "Applied Micro Circuits Corporation"
|
||||
c.VendorID = AMCC
|
||||
case 0x51:
|
||||
c.VendorString = "Qualcomm Inc"
|
||||
c.VendorID = Qualcomm
|
||||
case 0x56:
|
||||
c.VendorString = "Marvell International Ltd"
|
||||
c.VendorID = Marvell
|
||||
case 0x69:
|
||||
c.VendorString = "Intel Corporation"
|
||||
c.VendorID = Intel
|
||||
}
|
||||
|
||||
// Lower 4 bits: Architecture
|
||||
// Architecture Meaning
|
||||
// 0b0001 Armv4.
|
||||
// 0b0010 Armv4T.
|
||||
// 0b0011 Armv5 (obsolete).
|
||||
// 0b0100 Armv5T.
|
||||
// 0b0101 Armv5TE.
|
||||
// 0b0110 Armv5TEJ.
|
||||
// 0b0111 Armv6.
|
||||
// 0b1111 Architectural features are individually identified in the ID_* registers, see 'ID registers'.
|
||||
// Upper 4 bit: Variant
|
||||
// An IMPLEMENTATION DEFINED variant number.
|
||||
// Typically, this field is used to distinguish between different product variants, or major revisions of a product.
|
||||
c.Family = int(midr>>16) & 0xff
|
||||
|
||||
// PartNum, bits [15:4]
|
||||
// An IMPLEMENTATION DEFINED primary part number for the device.
|
||||
// On processors implemented by Arm, if the top four bits of the primary
|
||||
// part number are 0x0 or 0x7, the variant and architecture are encoded differently.
|
||||
// Revision, bits [3:0]
|
||||
// An IMPLEMENTATION DEFINED revision number for the device.
|
||||
c.Model = int(midr) & 0xffff
|
||||
|
||||
procFeatures := getProcFeatures()
|
||||
|
||||
// ID_AA64PFR0_EL1 - Processor Feature Register 0
|
||||
// x--------------------------------------------------x
|
||||
// | Name | bits | visible |
|
||||
// |--------------------------------------------------|
|
||||
// | DIT | [51-48] | y |
|
||||
// |--------------------------------------------------|
|
||||
// | SVE | [35-32] | y |
|
||||
// |--------------------------------------------------|
|
||||
// | GIC | [27-24] | n |
|
||||
// |--------------------------------------------------|
|
||||
// | AdvSIMD | [23-20] | y |
|
||||
// |--------------------------------------------------|
|
||||
// | FP | [19-16] | y |
|
||||
// |--------------------------------------------------|
|
||||
// | EL3 | [15-12] | n |
|
||||
// |--------------------------------------------------|
|
||||
// | EL2 | [11-8] | n |
|
||||
// |--------------------------------------------------|
|
||||
// | EL1 | [7-4] | n |
|
||||
// |--------------------------------------------------|
|
||||
// | EL0 | [3-0] | n |
|
||||
// x--------------------------------------------------x
|
||||
|
||||
var f flagSet
|
||||
// if procFeatures&(0xf<<48) != 0 {
|
||||
// fmt.Println("DIT")
|
||||
// }
|
||||
f.setIf(procFeatures&(0xf<<32) != 0, SVE)
|
||||
if procFeatures&(0xf<<20) != 15<<20 {
|
||||
f.set(ASIMD)
|
||||
// https://developer.arm.com/docs/ddi0595/b/aarch64-system-registers/id_aa64pfr0_el1
|
||||
// 0b0001 --> As for 0b0000, and also includes support for half-precision floating-point arithmetic.
|
||||
f.setIf(procFeatures&(0xf<<20) == 1<<20, FPHP, ASIMDHP)
|
||||
}
|
||||
f.setIf(procFeatures&(0xf<<16) != 0, FP)
|
||||
|
||||
instAttrReg0, instAttrReg1 := getInstAttributes()
|
||||
|
||||
// https://developer.arm.com/docs/ddi0595/b/aarch64-system-registers/id_aa64isar0_el1
|
||||
//
|
||||
// ID_AA64ISAR0_EL1 - Instruction Set Attribute Register 0
|
||||
// x--------------------------------------------------x
|
||||
// | Name | bits | visible |
|
||||
// |--------------------------------------------------|
|
||||
// | RNDR | [63-60] | y |
|
||||
// |--------------------------------------------------|
|
||||
// | TLB | [59-56] | y |
|
||||
// |--------------------------------------------------|
|
||||
// | TS | [55-52] | y |
|
||||
// |--------------------------------------------------|
|
||||
// | FHM | [51-48] | y |
|
||||
// |--------------------------------------------------|
|
||||
// | DP | [47-44] | y |
|
||||
// |--------------------------------------------------|
|
||||
// | SM4 | [43-40] | y |
|
||||
// |--------------------------------------------------|
|
||||
// | SM3 | [39-36] | y |
|
||||
// |--------------------------------------------------|
|
||||
// | SHA3 | [35-32] | y |
|
||||
// |--------------------------------------------------|
|
||||
// | RDM | [31-28] | y |
|
||||
// |--------------------------------------------------|
|
||||
// | ATOMICS | [23-20] | y |
|
||||
// |--------------------------------------------------|
|
||||
// | CRC32 | [19-16] | y |
|
||||
// |--------------------------------------------------|
|
||||
// | SHA2 | [15-12] | y |
|
||||
// |--------------------------------------------------|
|
||||
// | SHA1 | [11-8] | y |
|
||||
// |--------------------------------------------------|
|
||||
// | AES | [7-4] | y |
|
||||
// x--------------------------------------------------x
|
||||
|
||||
f.setIf(instAttrReg0&(0xf<<60) != 0, RNDR)
|
||||
f.setIf(instAttrReg0&(0xf<<56) != 0, TLB)
|
||||
f.setIf(instAttrReg0&(0xf<<52) != 0, TS)
|
||||
f.setIf(instAttrReg0&(0xf<<48) != 0, FHM)
|
||||
f.setIf(instAttrReg0&(0xf<<44) != 0, ASIMDDP)
|
||||
f.setIf(instAttrReg0&(0xf<<40) != 0, SM4)
|
||||
f.setIf(instAttrReg0&(0xf<<36) != 0, SM3)
|
||||
f.setIf(instAttrReg0&(0xf<<32) != 0, SHA3)
|
||||
f.setIf(instAttrReg0&(0xf<<28) != 0, ASIMDRDM)
|
||||
f.setIf(instAttrReg0&(0xf<<20) != 0, ATOMICS)
|
||||
f.setIf(instAttrReg0&(0xf<<16) != 0, CRC32)
|
||||
f.setIf(instAttrReg0&(0xf<<12) != 0, SHA2)
|
||||
// https://developer.arm.com/docs/ddi0595/b/aarch64-system-registers/id_aa64isar0_el1
|
||||
// 0b0010 --> As 0b0001, plus SHA512H, SHA512H2, SHA512SU0, and SHA512SU1 instructions implemented.
|
||||
f.setIf(instAttrReg0&(0xf<<12) == 2<<12, SHA512)
|
||||
f.setIf(instAttrReg0&(0xf<<8) != 0, SHA1)
|
||||
f.setIf(instAttrReg0&(0xf<<4) != 0, AESARM)
|
||||
// https://developer.arm.com/docs/ddi0595/b/aarch64-system-registers/id_aa64isar0_el1
|
||||
// 0b0010 --> As for 0b0001, plus PMULL/PMULL2 instructions operating on 64-bit data quantities.
|
||||
f.setIf(instAttrReg0&(0xf<<4) == 2<<4, PMULL)
|
||||
|
||||
// https://developer.arm.com/docs/ddi0595/b/aarch64-system-registers/id_aa64isar1_el1
|
||||
//
|
||||
// ID_AA64ISAR1_EL1 - Instruction set attribute register 1
|
||||
// x--------------------------------------------------x
|
||||
// | Name | bits | visible |
|
||||
// |--------------------------------------------------|
|
||||
// | GPI | [31-28] | y |
|
||||
// |--------------------------------------------------|
|
||||
// | GPA | [27-24] | y |
|
||||
// |--------------------------------------------------|
|
||||
// | LRCPC | [23-20] | y |
|
||||
// |--------------------------------------------------|
|
||||
// | FCMA | [19-16] | y |
|
||||
// |--------------------------------------------------|
|
||||
// | JSCVT | [15-12] | y |
|
||||
// |--------------------------------------------------|
|
||||
// | API | [11-8] | y |
|
||||
// |--------------------------------------------------|
|
||||
// | APA | [7-4] | y |
|
||||
// |--------------------------------------------------|
|
||||
// | DPB | [3-0] | y |
|
||||
// x--------------------------------------------------x
|
||||
|
||||
// if instAttrReg1&(0xf<<28) != 0 {
|
||||
// fmt.Println("GPI")
|
||||
// }
|
||||
f.setIf(instAttrReg1&(0xf<<28) != 24, GPA)
|
||||
f.setIf(instAttrReg1&(0xf<<20) != 0, LRCPC)
|
||||
f.setIf(instAttrReg1&(0xf<<16) != 0, FCMA)
|
||||
f.setIf(instAttrReg1&(0xf<<12) != 0, JSCVT)
|
||||
// if instAttrReg1&(0xf<<8) != 0 {
|
||||
// fmt.Println("API")
|
||||
// }
|
||||
// if instAttrReg1&(0xf<<4) != 0 {
|
||||
// fmt.Println("APA")
|
||||
// }
|
||||
f.setIf(instAttrReg1&(0xf<<0) != 0, DCPOP)
|
||||
|
||||
// Store
|
||||
c.featureSet.or(f)
|
||||
}
|
||||
+17
@@ -0,0 +1,17 @@
|
||||
// Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file.
|
||||
|
||||
//go:build (!amd64 && !386 && !arm64) || gccgo || noasm || appengine
|
||||
// +build !amd64,!386,!arm64 gccgo noasm appengine
|
||||
|
||||
package cpuid
|
||||
|
||||
func initCPU() {
|
||||
cpuid = func(uint32) (a, b, c, d uint32) { return 0, 0, 0, 0 }
|
||||
cpuidex = func(x, y uint32) (a, b, c, d uint32) { return 0, 0, 0, 0 }
|
||||
xgetbv = func(uint32) (a, b uint32) { return 0, 0 }
|
||||
rdtscpAsm = func() (a, b, c, d uint32) { return 0, 0, 0, 0 }
|
||||
|
||||
}
|
||||
|
||||
func addInfo(info *CPUInfo, safe bool) {}
|
||||
func getVectorLength() (vl, pl uint64) { return 0, 0 }
|
||||
+45
@@ -0,0 +1,45 @@
|
||||
// Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file.
|
||||
|
||||
//go:build (386 && !gccgo && !noasm && !appengine) || (amd64 && !gccgo && !noasm && !appengine)
|
||||
// +build 386,!gccgo,!noasm,!appengine amd64,!gccgo,!noasm,!appengine
|
||||
|
||||
package cpuid
|
||||
|
||||
func asmCpuid(op uint32) (eax, ebx, ecx, edx uint32)
|
||||
func asmCpuidex(op, op2 uint32) (eax, ebx, ecx, edx uint32)
|
||||
func asmXgetbv(index uint32) (eax, edx uint32)
|
||||
func asmRdtscpAsm() (eax, ebx, ecx, edx uint32)
|
||||
func asmDarwinHasAVX512() bool
|
||||
|
||||
func initCPU() {
|
||||
cpuid = asmCpuid
|
||||
cpuidex = asmCpuidex
|
||||
xgetbv = asmXgetbv
|
||||
rdtscpAsm = asmRdtscpAsm
|
||||
darwinHasAVX512 = asmDarwinHasAVX512
|
||||
}
|
||||
|
||||
func addInfo(c *CPUInfo, safe bool) {
|
||||
c.maxFunc = maxFunctionID()
|
||||
c.maxExFunc = maxExtendedFunction()
|
||||
c.BrandName = brandName()
|
||||
c.CacheLine = cacheLine()
|
||||
c.Family, c.Model, c.Stepping = familyModel()
|
||||
c.featureSet = support()
|
||||
c.SGX = hasSGX(c.featureSet.inSet(SGX), c.featureSet.inSet(SGXLC))
|
||||
c.AMDMemEncryption = hasAMDMemEncryption(c.featureSet.inSet(SME) || c.featureSet.inSet(SEV))
|
||||
c.ThreadsPerCore = threadsPerCore()
|
||||
c.LogicalCores = logicalCores()
|
||||
c.PhysicalCores = physicalCores()
|
||||
c.VendorID, c.VendorString = vendorID()
|
||||
c.HypervisorVendorID, c.HypervisorVendorString = hypervisorVendorID()
|
||||
c.AVX10Level = c.supportAVX10()
|
||||
c.cacheSize()
|
||||
c.frequencies()
|
||||
if c.maxFunc >= 0x0A {
|
||||
eax, ebx, _, edx := cpuid(0x0A)
|
||||
c.PMU = parseLeaf0AH(c, eax, ebx, edx)
|
||||
}
|
||||
}
|
||||
|
||||
func getVectorLength() (vl, pl uint64) { return 0, 0 }
|
||||
+308
@@ -0,0 +1,308 @@
|
||||
// Code generated by "stringer -type=FeatureID,Vendor"; DO NOT EDIT.
|
||||
|
||||
package cpuid
|
||||
|
||||
import "strconv"
|
||||
|
||||
func _() {
|
||||
// An "invalid array index" compiler error signifies that the constant values have changed.
|
||||
// Re-run the stringer command to generate them again.
|
||||
var x [1]struct{}
|
||||
_ = x[ADX-1]
|
||||
_ = x[AESNI-2]
|
||||
_ = x[AMD3DNOW-3]
|
||||
_ = x[AMD3DNOWEXT-4]
|
||||
_ = x[AMXBF16-5]
|
||||
_ = x[AMXFP16-6]
|
||||
_ = x[AMXINT8-7]
|
||||
_ = x[AMXFP8-8]
|
||||
_ = x[AMXTILE-9]
|
||||
_ = x[AMXTF32-10]
|
||||
_ = x[AMXCOMPLEX-11]
|
||||
_ = x[AMXTRANSPOSE-12]
|
||||
_ = x[APX_F-13]
|
||||
_ = x[AVX-14]
|
||||
_ = x[AVX10-15]
|
||||
_ = x[AVX10_128-16]
|
||||
_ = x[AVX10_256-17]
|
||||
_ = x[AVX10_512-18]
|
||||
_ = x[AVX2-19]
|
||||
_ = x[AVX512BF16-20]
|
||||
_ = x[AVX512BITALG-21]
|
||||
_ = x[AVX512BW-22]
|
||||
_ = x[AVX512CD-23]
|
||||
_ = x[AVX512DQ-24]
|
||||
_ = x[AVX512ER-25]
|
||||
_ = x[AVX512F-26]
|
||||
_ = x[AVX512FP16-27]
|
||||
_ = x[AVX512IFMA-28]
|
||||
_ = x[AVX512PF-29]
|
||||
_ = x[AVX512VBMI-30]
|
||||
_ = x[AVX512VBMI2-31]
|
||||
_ = x[AVX512VL-32]
|
||||
_ = x[AVX512VNNI-33]
|
||||
_ = x[AVX512VP2INTERSECT-34]
|
||||
_ = x[AVX512VPOPCNTDQ-35]
|
||||
_ = x[AVXIFMA-36]
|
||||
_ = x[AVXNECONVERT-37]
|
||||
_ = x[AVXSLOW-38]
|
||||
_ = x[AVXVNNI-39]
|
||||
_ = x[AVXVNNIINT8-40]
|
||||
_ = x[AVXVNNIINT16-41]
|
||||
_ = x[BHI_CTRL-42]
|
||||
_ = x[BMI1-43]
|
||||
_ = x[BMI2-44]
|
||||
_ = x[CETIBT-45]
|
||||
_ = x[CETSS-46]
|
||||
_ = x[CLDEMOTE-47]
|
||||
_ = x[CLMUL-48]
|
||||
_ = x[CLZERO-49]
|
||||
_ = x[CMOV-50]
|
||||
_ = x[CMPCCXADD-51]
|
||||
_ = x[CMPSB_SCADBS_SHORT-52]
|
||||
_ = x[CMPXCHG8-53]
|
||||
_ = x[CPBOOST-54]
|
||||
_ = x[CPPC-55]
|
||||
_ = x[CX16-56]
|
||||
_ = x[EFER_LMSLE_UNS-57]
|
||||
_ = x[ENQCMD-58]
|
||||
_ = x[ERMS-59]
|
||||
_ = x[F16C-60]
|
||||
_ = x[FLUSH_L1D-61]
|
||||
_ = x[FMA3-62]
|
||||
_ = x[FMA4-63]
|
||||
_ = x[FP128-64]
|
||||
_ = x[FP256-65]
|
||||
_ = x[FSRM-66]
|
||||
_ = x[FXSR-67]
|
||||
_ = x[FXSROPT-68]
|
||||
_ = x[GFNI-69]
|
||||
_ = x[HLE-70]
|
||||
_ = x[HRESET-71]
|
||||
_ = x[HTT-72]
|
||||
_ = x[HWA-73]
|
||||
_ = x[HYBRID_CPU-74]
|
||||
_ = x[HYPERVISOR-75]
|
||||
_ = x[IA32_ARCH_CAP-76]
|
||||
_ = x[IA32_CORE_CAP-77]
|
||||
_ = x[IBPB-78]
|
||||
_ = x[IBPB_BRTYPE-79]
|
||||
_ = x[IBRS-80]
|
||||
_ = x[IBRS_PREFERRED-81]
|
||||
_ = x[IBRS_PROVIDES_SMP-82]
|
||||
_ = x[IBS-83]
|
||||
_ = x[IBSBRNTRGT-84]
|
||||
_ = x[IBSFETCHSAM-85]
|
||||
_ = x[IBSFFV-86]
|
||||
_ = x[IBSOPCNT-87]
|
||||
_ = x[IBSOPCNTEXT-88]
|
||||
_ = x[IBSOPSAM-89]
|
||||
_ = x[IBSRDWROPCNT-90]
|
||||
_ = x[IBSRIPINVALIDCHK-91]
|
||||
_ = x[IBS_FETCH_CTLX-92]
|
||||
_ = x[IBS_OPDATA4-93]
|
||||
_ = x[IBS_OPFUSE-94]
|
||||
_ = x[IBS_PREVENTHOST-95]
|
||||
_ = x[IBS_ZEN4-96]
|
||||
_ = x[IDPRED_CTRL-97]
|
||||
_ = x[INT_WBINVD-98]
|
||||
_ = x[INVLPGB-99]
|
||||
_ = x[KEYLOCKER-100]
|
||||
_ = x[KEYLOCKERW-101]
|
||||
_ = x[LAHF-102]
|
||||
_ = x[LAM-103]
|
||||
_ = x[LBRVIRT-104]
|
||||
_ = x[LZCNT-105]
|
||||
_ = x[MCAOVERFLOW-106]
|
||||
_ = x[MCDT_NO-107]
|
||||
_ = x[MCOMMIT-108]
|
||||
_ = x[MD_CLEAR-109]
|
||||
_ = x[MMX-110]
|
||||
_ = x[MMXEXT-111]
|
||||
_ = x[MOVBE-112]
|
||||
_ = x[MOVDIR64B-113]
|
||||
_ = x[MOVDIRI-114]
|
||||
_ = x[MOVSB_ZL-115]
|
||||
_ = x[MOVU-116]
|
||||
_ = x[MPX-117]
|
||||
_ = x[MSRIRC-118]
|
||||
_ = x[MSRLIST-119]
|
||||
_ = x[MSR_PAGEFLUSH-120]
|
||||
_ = x[NRIPS-121]
|
||||
_ = x[NX-122]
|
||||
_ = x[OSXSAVE-123]
|
||||
_ = x[PCONFIG-124]
|
||||
_ = x[POPCNT-125]
|
||||
_ = x[PPIN-126]
|
||||
_ = x[PREFETCHI-127]
|
||||
_ = x[PSFD-128]
|
||||
_ = x[RDPRU-129]
|
||||
_ = x[RDRAND-130]
|
||||
_ = x[RDSEED-131]
|
||||
_ = x[RDTSCP-132]
|
||||
_ = x[RRSBA_CTRL-133]
|
||||
_ = x[RTM-134]
|
||||
_ = x[RTM_ALWAYS_ABORT-135]
|
||||
_ = x[SBPB-136]
|
||||
_ = x[SERIALIZE-137]
|
||||
_ = x[SEV-138]
|
||||
_ = x[SEV_64BIT-139]
|
||||
_ = x[SEV_ALTERNATIVE-140]
|
||||
_ = x[SEV_DEBUGSWAP-141]
|
||||
_ = x[SEV_ES-142]
|
||||
_ = x[SEV_RESTRICTED-143]
|
||||
_ = x[SEV_SNP-144]
|
||||
_ = x[SGX-145]
|
||||
_ = x[SGXLC-146]
|
||||
_ = x[SGXPQC-147]
|
||||
_ = x[SHA-148]
|
||||
_ = x[SME-149]
|
||||
_ = x[SME_COHERENT-150]
|
||||
_ = x[SM3_X86-151]
|
||||
_ = x[SM4_X86-152]
|
||||
_ = x[SPEC_CTRL_SSBD-153]
|
||||
_ = x[SRBDS_CTRL-154]
|
||||
_ = x[SRSO_MSR_FIX-155]
|
||||
_ = x[SRSO_NO-156]
|
||||
_ = x[SRSO_USER_KERNEL_NO-157]
|
||||
_ = x[SSE-158]
|
||||
_ = x[SSE2-159]
|
||||
_ = x[SSE3-160]
|
||||
_ = x[SSE4-161]
|
||||
_ = x[SSE42-162]
|
||||
_ = x[SSE4A-163]
|
||||
_ = x[SSSE3-164]
|
||||
_ = x[STIBP-165]
|
||||
_ = x[STIBP_ALWAYSON-166]
|
||||
_ = x[STOSB_SHORT-167]
|
||||
_ = x[SUCCOR-168]
|
||||
_ = x[SVM-169]
|
||||
_ = x[SVMDA-170]
|
||||
_ = x[SVMFBASID-171]
|
||||
_ = x[SVML-172]
|
||||
_ = x[SVMNP-173]
|
||||
_ = x[SVMPF-174]
|
||||
_ = x[SVMPFT-175]
|
||||
_ = x[SYSCALL-176]
|
||||
_ = x[SYSEE-177]
|
||||
_ = x[TBM-178]
|
||||
_ = x[TDX_GUEST-179]
|
||||
_ = x[TLB_FLUSH_NESTED-180]
|
||||
_ = x[TME-181]
|
||||
_ = x[TOPEXT-182]
|
||||
_ = x[TSA_L1_NO-183]
|
||||
_ = x[TSA_SQ_NO-184]
|
||||
_ = x[TSA_VERW_CLEAR-185]
|
||||
_ = x[TSCRATEMSR-186]
|
||||
_ = x[TSXLDTRK-187]
|
||||
_ = x[VAES-188]
|
||||
_ = x[VMCBCLEAN-189]
|
||||
_ = x[VMPL-190]
|
||||
_ = x[VMSA_REGPROT-191]
|
||||
_ = x[VMX-192]
|
||||
_ = x[VPCLMULQDQ-193]
|
||||
_ = x[VTE-194]
|
||||
_ = x[WAITPKG-195]
|
||||
_ = x[WBNOINVD-196]
|
||||
_ = x[WRMSRNS-197]
|
||||
_ = x[X87-198]
|
||||
_ = x[XGETBV1-199]
|
||||
_ = x[XOP-200]
|
||||
_ = x[XSAVE-201]
|
||||
_ = x[XSAVEC-202]
|
||||
_ = x[XSAVEOPT-203]
|
||||
_ = x[XSAVES-204]
|
||||
_ = x[AESARM-205]
|
||||
_ = x[ARMCPUID-206]
|
||||
_ = x[ASIMD-207]
|
||||
_ = x[ASIMDDP-208]
|
||||
_ = x[ASIMDHP-209]
|
||||
_ = x[ASIMDRDM-210]
|
||||
_ = x[ATOMICS-211]
|
||||
_ = x[CRC32-212]
|
||||
_ = x[DCPOP-213]
|
||||
_ = x[EVTSTRM-214]
|
||||
_ = x[FCMA-215]
|
||||
_ = x[FHM-216]
|
||||
_ = x[FP-217]
|
||||
_ = x[FPHP-218]
|
||||
_ = x[GPA-219]
|
||||
_ = x[JSCVT-220]
|
||||
_ = x[LRCPC-221]
|
||||
_ = x[PMULL-222]
|
||||
_ = x[RNDR-223]
|
||||
_ = x[TLB-224]
|
||||
_ = x[TS-225]
|
||||
_ = x[SHA1-226]
|
||||
_ = x[SHA2-227]
|
||||
_ = x[SHA3-228]
|
||||
_ = x[SHA512-229]
|
||||
_ = x[SM3-230]
|
||||
_ = x[SM4-231]
|
||||
_ = x[SVE-232]
|
||||
_ = x[PMU_FIXEDCOUNTER_CYCLES-233]
|
||||
_ = x[PMU_FIXEDCOUNTER_REFCYCLES-234]
|
||||
_ = x[PMU_FIXEDCOUNTER_INSTRUCTIONS-235]
|
||||
_ = x[PMU_FIXEDCOUNTER_TOPDOWN_SLOTS-236]
|
||||
_ = x[lastID-237]
|
||||
_ = x[firstID-0]
|
||||
}
|
||||
|
||||
const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXFP8AMXTILEAMXTF32AMXCOMPLEXAMXTRANSPOSEAPX_FAVXAVX10AVX10_128AVX10_256AVX10_512AVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8AVXVNNIINT16BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBPB_BRTYPEIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBKEYLOCKERKEYLOCKERWLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSBPBSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSGXPQCSHASMESME_COHERENTSM3_X86SM4_X86SPEC_CTRL_SSBDSRBDS_CTRLSRSO_MSR_FIXSRSO_NOSRSO_USER_KERNEL_NOSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSA_L1_NOTSA_SQ_NOTSA_VERW_CLEARTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFHMFPFPHPGPAJSCVTLRCPCPMULLRNDRTLBTSSHA1SHA2SHA3SHA512SM3SM4SVEPMU_FIXEDCOUNTER_CYCLESPMU_FIXEDCOUNTER_REFCYCLESPMU_FIXEDCOUNTER_INSTRUCTIONSPMU_FIXEDCOUNTER_TOPDOWN_SLOTSlastID"
|
||||
|
||||
var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 61, 68, 75, 85, 97, 102, 105, 110, 119, 128, 137, 141, 151, 163, 171, 179, 187, 195, 202, 212, 222, 230, 240, 251, 259, 269, 287, 302, 309, 321, 328, 335, 346, 358, 366, 370, 374, 380, 385, 393, 398, 404, 408, 417, 435, 443, 450, 454, 458, 472, 478, 482, 486, 495, 499, 503, 508, 513, 517, 521, 528, 532, 535, 541, 544, 547, 557, 567, 580, 593, 597, 608, 612, 626, 643, 646, 656, 667, 673, 681, 692, 700, 712, 728, 742, 753, 763, 778, 786, 797, 807, 814, 823, 833, 837, 840, 847, 852, 863, 870, 877, 885, 888, 894, 899, 908, 915, 923, 927, 930, 936, 943, 956, 961, 963, 970, 977, 983, 987, 996, 1000, 1005, 1011, 1017, 1023, 1033, 1036, 1052, 1056, 1065, 1068, 1077, 1092, 1105, 1111, 1125, 1132, 1135, 1140, 1146, 1149, 1152, 1164, 1171, 1178, 1192, 1202, 1214, 1221, 1240, 1243, 1247, 1251, 1255, 1260, 1265, 1270, 1275, 1289, 1300, 1306, 1309, 1314, 1323, 1327, 1332, 1337, 1343, 1350, 1355, 1358, 1367, 1383, 1386, 1392, 1401, 1410, 1424, 1434, 1442, 1446, 1455, 1459, 1471, 1474, 1484, 1487, 1494, 1502, 1509, 1512, 1519, 1522, 1527, 1533, 1541, 1547, 1553, 1561, 1566, 1573, 1580, 1588, 1595, 1600, 1605, 1612, 1616, 1619, 1621, 1625, 1628, 1633, 1638, 1643, 1647, 1650, 1652, 1656, 1660, 1664, 1670, 1673, 1676, 1679, 1702, 1728, 1757, 1787, 1793}
|
||||
|
||||
func (i FeatureID) String() string {
|
||||
if i < 0 || i >= FeatureID(len(_FeatureID_index)-1) {
|
||||
return "FeatureID(" + strconv.FormatInt(int64(i), 10) + ")"
|
||||
}
|
||||
return _FeatureID_name[_FeatureID_index[i]:_FeatureID_index[i+1]]
|
||||
}
|
||||
func _() {
|
||||
// An "invalid array index" compiler error signifies that the constant values have changed.
|
||||
// Re-run the stringer command to generate them again.
|
||||
var x [1]struct{}
|
||||
_ = x[VendorUnknown-0]
|
||||
_ = x[Intel-1]
|
||||
_ = x[AMD-2]
|
||||
_ = x[VIA-3]
|
||||
_ = x[Transmeta-4]
|
||||
_ = x[NSC-5]
|
||||
_ = x[KVM-6]
|
||||
_ = x[MSVM-7]
|
||||
_ = x[VMware-8]
|
||||
_ = x[XenHVM-9]
|
||||
_ = x[Bhyve-10]
|
||||
_ = x[Hygon-11]
|
||||
_ = x[SiS-12]
|
||||
_ = x[RDC-13]
|
||||
_ = x[Ampere-14]
|
||||
_ = x[ARM-15]
|
||||
_ = x[Broadcom-16]
|
||||
_ = x[Cavium-17]
|
||||
_ = x[DEC-18]
|
||||
_ = x[Fujitsu-19]
|
||||
_ = x[Infineon-20]
|
||||
_ = x[Motorola-21]
|
||||
_ = x[NVIDIA-22]
|
||||
_ = x[AMCC-23]
|
||||
_ = x[Qualcomm-24]
|
||||
_ = x[Marvell-25]
|
||||
_ = x[QEMU-26]
|
||||
_ = x[QNX-27]
|
||||
_ = x[ACRN-28]
|
||||
_ = x[SRE-29]
|
||||
_ = x[Apple-30]
|
||||
_ = x[lastVendor-31]
|
||||
}
|
||||
|
||||
const _Vendor_name = "VendorUnknownIntelAMDVIATransmetaNSCKVMMSVMVMwareXenHVMBhyveHygonSiSRDCAmpereARMBroadcomCaviumDECFujitsuInfineonMotorolaNVIDIAAMCCQualcommMarvellQEMUQNXACRNSREApplelastVendor"
|
||||
|
||||
var _Vendor_index = [...]uint8{0, 13, 18, 21, 24, 33, 36, 39, 43, 49, 55, 60, 65, 68, 71, 77, 80, 88, 94, 97, 104, 112, 120, 126, 130, 138, 145, 149, 152, 156, 159, 164, 174}
|
||||
|
||||
func (i Vendor) String() string {
|
||||
if i < 0 || i >= Vendor(len(_Vendor_index)-1) {
|
||||
return "Vendor(" + strconv.FormatInt(int64(i), 10) + ")"
|
||||
}
|
||||
return _Vendor_name[_Vendor_index[i]:_Vendor_index[i+1]]
|
||||
}
|
||||
+129
@@ -0,0 +1,129 @@
|
||||
// Copyright (c) 2020 Klaus Post, released under MIT License. See LICENSE file.
|
||||
|
||||
package cpuid
|
||||
|
||||
import (
|
||||
"runtime"
|
||||
"strings"
|
||||
|
||||
"golang.org/x/sys/unix"
|
||||
)
|
||||
|
||||
func detectOS(c *CPUInfo) bool {
|
||||
if runtime.GOOS != "ios" {
|
||||
tryToFillCPUInfoFomSysctl(c)
|
||||
}
|
||||
// There are no hw.optional sysctl values for the below features on Mac OS 11.0
|
||||
// to detect their supported state dynamically. Assume the CPU features that
|
||||
// Apple Silicon M1 supports to be available as a minimal set of features
|
||||
// to all Go programs running on darwin/arm64.
|
||||
// TODO: Add more if we know them.
|
||||
c.featureSet.setIf(runtime.GOOS != "ios", AESARM, PMULL, SHA1, SHA2)
|
||||
|
||||
return true
|
||||
}
|
||||
|
||||
func sysctlGetBool(name string) bool {
|
||||
value, err := unix.SysctlUint32(name)
|
||||
if err != nil {
|
||||
return false
|
||||
}
|
||||
return value != 0
|
||||
}
|
||||
|
||||
func sysctlGetString(name string) string {
|
||||
value, err := unix.Sysctl(name)
|
||||
if err != nil {
|
||||
return ""
|
||||
}
|
||||
return value
|
||||
}
|
||||
|
||||
func sysctlGetInt(unknown int, names ...string) int {
|
||||
for _, name := range names {
|
||||
value, err := unix.SysctlUint32(name)
|
||||
if err != nil {
|
||||
continue
|
||||
}
|
||||
if value != 0 {
|
||||
return int(value)
|
||||
}
|
||||
}
|
||||
return unknown
|
||||
}
|
||||
|
||||
func sysctlGetInt64(unknown int, names ...string) int {
|
||||
for _, name := range names {
|
||||
value64, err := unix.SysctlUint64(name)
|
||||
if err != nil {
|
||||
continue
|
||||
}
|
||||
if int(value64) != unknown {
|
||||
return int(value64)
|
||||
}
|
||||
}
|
||||
return unknown
|
||||
}
|
||||
|
||||
func setFeature(c *CPUInfo, feature FeatureID, aliases ...string) {
|
||||
for _, alias := range aliases {
|
||||
set := sysctlGetBool(alias)
|
||||
c.featureSet.setIf(set, feature)
|
||||
if set {
|
||||
break
|
||||
}
|
||||
}
|
||||
}
|
||||
|
||||
func tryToFillCPUInfoFomSysctl(c *CPUInfo) {
|
||||
c.BrandName = sysctlGetString("machdep.cpu.brand_string")
|
||||
|
||||
if len(c.BrandName) != 0 {
|
||||
c.VendorString = strings.Fields(c.BrandName)[0]
|
||||
}
|
||||
|
||||
c.PhysicalCores = sysctlGetInt(runtime.NumCPU(), "hw.physicalcpu")
|
||||
c.ThreadsPerCore = sysctlGetInt(1, "machdep.cpu.thread_count", "kern.num_threads") /
|
||||
sysctlGetInt(1, "hw.physicalcpu")
|
||||
c.LogicalCores = sysctlGetInt(runtime.NumCPU(), "machdep.cpu.core_count")
|
||||
c.Family = sysctlGetInt(0, "machdep.cpu.family", "hw.cpufamily")
|
||||
c.Model = sysctlGetInt(0, "machdep.cpu.model")
|
||||
c.CacheLine = sysctlGetInt64(0, "hw.cachelinesize")
|
||||
c.Cache.L1I = sysctlGetInt64(-1, "hw.l1icachesize")
|
||||
c.Cache.L1D = sysctlGetInt64(-1, "hw.l1dcachesize")
|
||||
c.Cache.L2 = sysctlGetInt64(-1, "hw.l2cachesize")
|
||||
c.Cache.L3 = sysctlGetInt64(-1, "hw.l3cachesize")
|
||||
|
||||
// ARM features:
|
||||
//
|
||||
// Note: On some Apple Silicon system, some feats have aliases. See:
|
||||
// https://developer.apple.com/documentation/kernel/1387446-sysctlbyname/determining_instruction_set_characteristics
|
||||
// When so, we look at all aliases and consider a feature available when at least one identifier matches.
|
||||
setFeature(c, AESARM, "hw.optional.arm.FEAT_AES") // AES instructions
|
||||
setFeature(c, ASIMD, "hw.optional.arm.AdvSIMD", "hw.optional.neon") // Advanced SIMD
|
||||
setFeature(c, ASIMDDP, "hw.optional.arm.FEAT_DotProd") // SIMD Dot Product
|
||||
setFeature(c, ASIMDHP, "hw.optional.arm.AdvSIMD_HPFPCvt", "hw.optional.neon_hpfp") // Advanced SIMD half-precision floating point
|
||||
setFeature(c, ASIMDRDM, "hw.optional.arm.FEAT_RDM") // Rounding Double Multiply Accumulate/Subtract
|
||||
setFeature(c, ATOMICS, "hw.optional.arm.FEAT_LSE", "hw.optional.armv8_1_atomics") // Large System Extensions (LSE)
|
||||
setFeature(c, CRC32, "hw.optional.arm.FEAT_CRC32", "hw.optional.armv8_crc32") // CRC32/CRC32C instructions
|
||||
setFeature(c, DCPOP, "hw.optional.arm.FEAT_DPB") // Data cache clean to Point of Persistence (DC CVAP)
|
||||
setFeature(c, EVTSTRM, "hw.optional.arm.FEAT_ECV") // Generic timer
|
||||
setFeature(c, FCMA, "hw.optional.arm.FEAT_FCMA", "hw.optional.armv8_3_compnum") // Floating point complex number addition and multiplication
|
||||
setFeature(c, FHM, "hw.optional.armv8_2_fhm", "hw.optional.arm.FEAT_FHM") // FMLAL and FMLSL instructions
|
||||
setFeature(c, FP, "hw.optional.floatingpoint") // Single-precision and double-precision floating point
|
||||
setFeature(c, FPHP, "hw.optional.arm.FEAT_FP16", "hw.optional.neon_fp16") // Half-precision floating point
|
||||
setFeature(c, GPA, "hw.optional.arm.FEAT_PAuth") // Generic Pointer Authentication
|
||||
setFeature(c, JSCVT, "hw.optional.arm.FEAT_JSCVT") // Javascript-style double->int convert (FJCVTZS)
|
||||
setFeature(c, LRCPC, "hw.optional.arm.FEAT_LRCPC") // Weaker release consistency (LDAPR, etc)
|
||||
setFeature(c, PMULL, "hw.optional.arm.FEAT_PMULL") // Polynomial Multiply instructions (PMULL/PMULL2)
|
||||
setFeature(c, RNDR, "hw.optional.arm.FEAT_RNG") // Random Number instructions
|
||||
setFeature(c, TLB, "hw.optional.arm.FEAT_TLBIOS", "hw.optional.arm.FEAT_TLBIRANGE") // Outer Shareable and TLB range maintenance instructions
|
||||
setFeature(c, TS, "hw.optional.arm.FEAT_FlagM", "hw.optional.arm.FEAT_FlagM2") // Flag manipulation instructions
|
||||
setFeature(c, SHA1, "hw.optional.arm.FEAT_SHA1") // SHA-1 instructions (SHA1C, etc)
|
||||
setFeature(c, SHA2, "hw.optional.arm.FEAT_SHA256") // SHA-2 instructions (SHA256H, etc)
|
||||
setFeature(c, SHA3, "hw.optional.arm.FEAT_SHA3") // SHA-3 instructions (EOR3, RAXI, XAR, BCAX)
|
||||
setFeature(c, SHA512, "hw.optional.arm.FEAT_SHA512") // SHA512 instructions
|
||||
setFeature(c, SM3, "hw.optional.arm.FEAT_SM3") // SM3 instructions
|
||||
setFeature(c, SM4, "hw.optional.arm.FEAT_SM4") // SM4 instructions
|
||||
setFeature(c, SVE, "hw.optional.arm.FEAT_SVE") // Scalable Vector Extension
|
||||
}
|
||||
+208
@@ -0,0 +1,208 @@
|
||||
// Copyright (c) 2020 Klaus Post, released under MIT License. See LICENSE file.
|
||||
|
||||
// Copyright 2018 The Go Authors. All rights reserved.
|
||||
// Use of this source code is governed by a BSD-style
|
||||
// license that can be found in the LICENSE file located
|
||||
// here https://github.com/golang/sys/blob/master/LICENSE
|
||||
|
||||
package cpuid
|
||||
|
||||
import (
|
||||
"encoding/binary"
|
||||
"io/ioutil"
|
||||
"runtime"
|
||||
)
|
||||
|
||||
// HWCAP bits.
|
||||
const (
|
||||
hwcap_FP = 1 << 0
|
||||
hwcap_ASIMD = 1 << 1
|
||||
hwcap_EVTSTRM = 1 << 2
|
||||
hwcap_AES = 1 << 3
|
||||
hwcap_PMULL = 1 << 4
|
||||
hwcap_SHA1 = 1 << 5
|
||||
hwcap_SHA2 = 1 << 6
|
||||
hwcap_CRC32 = 1 << 7
|
||||
hwcap_ATOMICS = 1 << 8
|
||||
hwcap_FPHP = 1 << 9
|
||||
hwcap_ASIMDHP = 1 << 10
|
||||
hwcap_CPUID = 1 << 11
|
||||
hwcap_ASIMDRDM = 1 << 12
|
||||
hwcap_JSCVT = 1 << 13
|
||||
hwcap_FCMA = 1 << 14
|
||||
hwcap_LRCPC = 1 << 15
|
||||
hwcap_DCPOP = 1 << 16
|
||||
hwcap_SHA3 = 1 << 17
|
||||
hwcap_SM3 = 1 << 18
|
||||
hwcap_SM4 = 1 << 19
|
||||
hwcap_ASIMDDP = 1 << 20
|
||||
hwcap_SHA512 = 1 << 21
|
||||
hwcap_SVE = 1 << 22
|
||||
hwcap_ASIMDFHM = 1 << 23
|
||||
hwcap_DIT = 1 << 24
|
||||
hwcap_USCAT = 1 << 25
|
||||
hwcap_ILRCPC = 1 << 26
|
||||
hwcap_FLAGM = 1 << 27
|
||||
hwcap_SSBS = 1 << 28
|
||||
hwcap_SB = 1 << 29
|
||||
hwcap_PACA = 1 << 30
|
||||
hwcap_PACG = 1 << 31
|
||||
hwcap_GCS = 1 << 32
|
||||
|
||||
hwcap2_DCPODP = 1 << 0
|
||||
hwcap2_SVE2 = 1 << 1
|
||||
hwcap2_SVEAES = 1 << 2
|
||||
hwcap2_SVEPMULL = 1 << 3
|
||||
hwcap2_SVEBITPERM = 1 << 4
|
||||
hwcap2_SVESHA3 = 1 << 5
|
||||
hwcap2_SVESM4 = 1 << 6
|
||||
hwcap2_FLAGM2 = 1 << 7
|
||||
hwcap2_FRINT = 1 << 8
|
||||
hwcap2_SVEI8MM = 1 << 9
|
||||
hwcap2_SVEF32MM = 1 << 10
|
||||
hwcap2_SVEF64MM = 1 << 11
|
||||
hwcap2_SVEBF16 = 1 << 12
|
||||
hwcap2_I8MM = 1 << 13
|
||||
hwcap2_BF16 = 1 << 14
|
||||
hwcap2_DGH = 1 << 15
|
||||
hwcap2_RNG = 1 << 16
|
||||
hwcap2_BTI = 1 << 17
|
||||
hwcap2_MTE = 1 << 18
|
||||
hwcap2_ECV = 1 << 19
|
||||
hwcap2_AFP = 1 << 20
|
||||
hwcap2_RPRES = 1 << 21
|
||||
hwcap2_MTE3 = 1 << 22
|
||||
hwcap2_SME = 1 << 23
|
||||
hwcap2_SME_I16I64 = 1 << 24
|
||||
hwcap2_SME_F64F64 = 1 << 25
|
||||
hwcap2_SME_I8I32 = 1 << 26
|
||||
hwcap2_SME_F16F32 = 1 << 27
|
||||
hwcap2_SME_B16F32 = 1 << 28
|
||||
hwcap2_SME_F32F32 = 1 << 29
|
||||
hwcap2_SME_FA64 = 1 << 30
|
||||
hwcap2_WFXT = 1 << 31
|
||||
hwcap2_EBF16 = 1 << 32
|
||||
hwcap2_SVE_EBF16 = 1 << 33
|
||||
hwcap2_CSSC = 1 << 34
|
||||
hwcap2_RPRFM = 1 << 35
|
||||
hwcap2_SVE2P1 = 1 << 36
|
||||
hwcap2_SME2 = 1 << 37
|
||||
hwcap2_SME2P1 = 1 << 38
|
||||
hwcap2_SME_I16I32 = 1 << 39
|
||||
hwcap2_SME_BI32I32 = 1 << 40
|
||||
hwcap2_SME_B16B16 = 1 << 41
|
||||
hwcap2_SME_F16F16 = 1 << 42
|
||||
hwcap2_MOPS = 1 << 43
|
||||
hwcap2_HBC = 1 << 44
|
||||
hwcap2_SVE_B16B16 = 1 << 45
|
||||
hwcap2_LRCPC3 = 1 << 46
|
||||
hwcap2_LSE128 = 1 << 47
|
||||
hwcap2_FPMR = 1 << 48
|
||||
hwcap2_LUT = 1 << 49
|
||||
hwcap2_FAMINMAX = 1 << 50
|
||||
hwcap2_F8CVT = 1 << 51
|
||||
hwcap2_F8FMA = 1 << 52
|
||||
hwcap2_F8DP4 = 1 << 53
|
||||
hwcap2_F8DP2 = 1 << 54
|
||||
hwcap2_F8E4M3 = 1 << 55
|
||||
hwcap2_F8E5M2 = 1 << 56
|
||||
hwcap2_SME_LUTV2 = 1 << 57
|
||||
hwcap2_SME_F8F16 = 1 << 58
|
||||
hwcap2_SME_F8F32 = 1 << 59
|
||||
hwcap2_SME_SF8FMA = 1 << 60
|
||||
hwcap2_SME_SF8DP4 = 1 << 61
|
||||
hwcap2_SME_SF8DP2 = 1 << 62
|
||||
hwcap2_POE = 1 << 63
|
||||
)
|
||||
|
||||
func detectOS(c *CPUInfo) bool {
|
||||
// For now assuming no hyperthreading is reasonable.
|
||||
c.LogicalCores = runtime.NumCPU()
|
||||
c.PhysicalCores = c.LogicalCores
|
||||
c.ThreadsPerCore = 1
|
||||
if hwcap == 0 {
|
||||
// We did not get values from the runtime.
|
||||
// Try reading /proc/self/auxv
|
||||
|
||||
// From https://github.com/golang/sys
|
||||
const (
|
||||
_AT_HWCAP = 16
|
||||
_AT_HWCAP2 = 26
|
||||
|
||||
uintSize = int(32 << (^uint(0) >> 63))
|
||||
)
|
||||
|
||||
buf, err := ioutil.ReadFile("/proc/self/auxv")
|
||||
if err != nil {
|
||||
// e.g. on android /proc/self/auxv is not accessible, so silently
|
||||
// ignore the error and leave Initialized = false. On some
|
||||
// architectures (e.g. arm64) doinit() implements a fallback
|
||||
// readout and will set Initialized = true again.
|
||||
return false
|
||||
}
|
||||
bo := binary.LittleEndian
|
||||
for len(buf) >= 2*(uintSize/8) {
|
||||
var tag, val uint
|
||||
switch uintSize {
|
||||
case 32:
|
||||
tag = uint(bo.Uint32(buf[0:]))
|
||||
val = uint(bo.Uint32(buf[4:]))
|
||||
buf = buf[8:]
|
||||
case 64:
|
||||
tag = uint(bo.Uint64(buf[0:]))
|
||||
val = uint(bo.Uint64(buf[8:]))
|
||||
buf = buf[16:]
|
||||
}
|
||||
switch tag {
|
||||
case _AT_HWCAP:
|
||||
hwcap = val
|
||||
case _AT_HWCAP2:
|
||||
// Not used
|
||||
}
|
||||
}
|
||||
if hwcap == 0 {
|
||||
return false
|
||||
}
|
||||
}
|
||||
|
||||
// HWCap was populated by the runtime from the auxiliary vector.
|
||||
// Use HWCap information since reading aarch64 system registers
|
||||
// is not supported in user space on older linux kernels.
|
||||
c.featureSet.setIf(isSet(hwcap, hwcap_AES), AESARM)
|
||||
c.featureSet.setIf(isSet(hwcap, hwcap_ASIMD), ASIMD)
|
||||
c.featureSet.setIf(isSet(hwcap, hwcap_ASIMDDP), ASIMDDP)
|
||||
c.featureSet.setIf(isSet(hwcap, hwcap_ASIMDHP), ASIMDHP)
|
||||
c.featureSet.setIf(isSet(hwcap, hwcap_ASIMDRDM), ASIMDRDM)
|
||||
c.featureSet.setIf(isSet(hwcap, hwcap_CPUID), ARMCPUID)
|
||||
c.featureSet.setIf(isSet(hwcap, hwcap_CRC32), CRC32)
|
||||
c.featureSet.setIf(isSet(hwcap, hwcap_DCPOP), DCPOP)
|
||||
c.featureSet.setIf(isSet(hwcap, hwcap_EVTSTRM), EVTSTRM)
|
||||
c.featureSet.setIf(isSet(hwcap, hwcap_FCMA), FCMA)
|
||||
c.featureSet.setIf(isSet(hwcap, hwcap_ASIMDFHM), FHM)
|
||||
c.featureSet.setIf(isSet(hwcap, hwcap_FP), FP)
|
||||
c.featureSet.setIf(isSet(hwcap, hwcap_FPHP), FPHP)
|
||||
c.featureSet.setIf(isSet(hwcap, hwcap_JSCVT), JSCVT)
|
||||
c.featureSet.setIf(isSet(hwcap, hwcap_LRCPC), LRCPC)
|
||||
c.featureSet.setIf(isSet(hwcap, hwcap_PMULL), PMULL)
|
||||
c.featureSet.setIf(isSet(hwcap, hwcap2_RNG), RNDR)
|
||||
// c.featureSet.setIf(isSet(hwcap, hwcap_), TLB)
|
||||
// c.featureSet.setIf(isSet(hwcap, hwcap_), TS)
|
||||
c.featureSet.setIf(isSet(hwcap, hwcap_SHA1), SHA1)
|
||||
c.featureSet.setIf(isSet(hwcap, hwcap_SHA2), SHA2)
|
||||
c.featureSet.setIf(isSet(hwcap, hwcap_SHA3), SHA3)
|
||||
c.featureSet.setIf(isSet(hwcap, hwcap_SHA512), SHA512)
|
||||
c.featureSet.setIf(isSet(hwcap, hwcap_SM3), SM3)
|
||||
c.featureSet.setIf(isSet(hwcap, hwcap_SM4), SM4)
|
||||
c.featureSet.setIf(isSet(hwcap, hwcap_SVE), SVE)
|
||||
|
||||
// The Samsung S9+ kernel reports support for atomics, but not all cores
|
||||
// actually support them, resulting in SIGILL. See issue #28431.
|
||||
// TODO(elias.naur): Only disable the optimization on bad chipsets on android.
|
||||
c.featureSet.setIf(isSet(hwcap, hwcap_ATOMICS) && runtime.GOOS != "android", ATOMICS)
|
||||
|
||||
return true
|
||||
}
|
||||
|
||||
func isSet(hwc uint, value uint) bool {
|
||||
return hwc&value != 0
|
||||
}
|
||||
+16
@@ -0,0 +1,16 @@
|
||||
// Copyright (c) 2020 Klaus Post, released under MIT License. See LICENSE file.
|
||||
|
||||
//go:build arm64 && !linux && !darwin
|
||||
// +build arm64,!linux,!darwin
|
||||
|
||||
package cpuid
|
||||
|
||||
import "runtime"
|
||||
|
||||
func detectOS(c *CPUInfo) bool {
|
||||
c.PhysicalCores = runtime.NumCPU()
|
||||
// For now assuming 1 thread per core...
|
||||
c.ThreadsPerCore = 1
|
||||
c.LogicalCores = c.PhysicalCores
|
||||
return false
|
||||
}
|
||||
+8
@@ -0,0 +1,8 @@
|
||||
// Copyright (c) 2021 Klaus Post, released under MIT License. See LICENSE file.
|
||||
|
||||
//go:build nounsafe
|
||||
// +build nounsafe
|
||||
|
||||
package cpuid
|
||||
|
||||
var hwcap uint
|
||||
+11
@@ -0,0 +1,11 @@
|
||||
// Copyright (c) 2021 Klaus Post, released under MIT License. See LICENSE file.
|
||||
|
||||
//go:build !nounsafe
|
||||
// +build !nounsafe
|
||||
|
||||
package cpuid
|
||||
|
||||
import _ "unsafe" // needed for go:linkname
|
||||
|
||||
//go:linkname hwcap internal/cpu.HWCap
|
||||
var hwcap uint
|
||||
+15
@@ -0,0 +1,15 @@
|
||||
#!/bin/sh
|
||||
|
||||
set -e
|
||||
|
||||
go tool dist list | while IFS=/ read os arch; do
|
||||
echo "Checking $os/$arch..."
|
||||
echo " normal"
|
||||
GOARCH=$arch GOOS=$os go build -o /dev/null .
|
||||
echo " noasm"
|
||||
GOARCH=$arch GOOS=$os go build -tags noasm -o /dev/null .
|
||||
echo " appengine"
|
||||
GOARCH=$arch GOOS=$os go build -tags appengine -o /dev/null .
|
||||
echo " noasm,appengine"
|
||||
GOARCH=$arch GOOS=$os go build -tags 'appengine noasm' -o /dev/null .
|
||||
done
|
||||
Reference in New Issue
Block a user