diff --git a/go.mod b/go.mod index 02c94cfbe..ca7872fc7 100644 --- a/go.mod +++ b/go.mod @@ -64,7 +64,7 @@ require ( github.com/open-policy-agent/opa v1.15.2 github.com/opencloud-eu/icap-client v0.0.0-20250930132611-28a2afe62d89 github.com/opencloud-eu/libre-graph-api-go v1.0.8-0.20260310090739-853d972b282d - github.com/opencloud-eu/reva/v2 v2.44.0 + github.com/opencloud-eu/reva/v2 v2.44.1-0.20260513122109-583a11875721 github.com/opensearch-project/opensearch-go/v4 v4.6.0 github.com/orcaman/concurrent-map v1.0.0 github.com/pkg/errors v0.9.1 @@ -103,7 +103,7 @@ require ( go.opentelemetry.io/otel/sdk v1.43.0 go.opentelemetry.io/otel/trace v1.43.0 golang.org/x/crypto v0.50.0 - golang.org/x/exp v0.0.0-20250210185358-939b2ce775ac + golang.org/x/exp v0.0.0-20260410095643-746e56fc9e2f golang.org/x/image v0.38.0 golang.org/x/net v0.53.0 golang.org/x/oauth2 v0.36.0 @@ -179,7 +179,7 @@ require ( github.com/cpuguy83/go-md2man/v2 v2.0.7 // indirect github.com/crewjam/httperr v0.2.0 // indirect github.com/crewjam/saml v0.4.14 // indirect - github.com/cyphar/filepath-securejoin v0.5.1 // indirect + github.com/cyphar/filepath-securejoin v0.6.1 // indirect github.com/davecgh/go-spew v1.1.2-0.20180830191138-d8f796af33cc // indirect github.com/deckarep/golang-set v1.8.0 // indirect github.com/decred/dcrd/dcrec/secp256k1/v4 v4.4.0 // indirect @@ -204,8 +204,8 @@ require ( github.com/go-acme/lego/v4 v4.4.0 // indirect github.com/go-asn1-ber/asn1-ber v1.5.8-0.20250403174932-29230038a667 // indirect github.com/go-git/gcfg v1.5.1-0.20230307220236-3a3c6141e376 // indirect - github.com/go-git/go-billy/v5 v5.8.0 // indirect - github.com/go-git/go-git/v5 v5.18.0 // indirect + github.com/go-git/go-billy/v5 v5.9.0 // indirect + github.com/go-git/go-git/v5 v5.19.0 // indirect github.com/go-ini/ini v1.67.0 // indirect github.com/go-jose/go-jose/v4 v4.1.4 // indirect github.com/go-kit/log v0.2.1 // indirect @@ -258,7 +258,7 @@ require ( github.com/juliangruber/go-intersect v1.1.0 // indirect github.com/kevinburke/ssh_config v1.2.0 // indirect github.com/klauspost/compress v1.18.5 // indirect - github.com/klauspost/cpuid/v2 v2.2.11 // indirect + github.com/klauspost/cpuid/v2 v2.3.0 // indirect github.com/klauspost/crc32 v1.3.0 // indirect github.com/kovidgoyal/go-parallel v1.1.1 // indirect github.com/kovidgoyal/go-shm v1.0.0 // indirect @@ -321,7 +321,7 @@ require ( github.com/pelletier/go-toml/v2 v2.2.4 // indirect github.com/philhofer/fwd v1.2.0 // indirect github.com/pierrec/lz4/v4 v4.1.15 // indirect - github.com/pjbgf/sha1cd v0.3.2 // indirect + github.com/pjbgf/sha1cd v0.6.0 // indirect github.com/pmezard/go-difflib v1.0.1-0.20181226105442-5d4384ee4fb2 // indirect github.com/power-devops/perfstat v0.0.0-20240221224432-82ca36839d55 // indirect github.com/pquerna/cachecontrol v0.2.0 // indirect diff --git a/go.sum b/go.sum index 1f0860d8b..b477a9f09 100644 --- a/go.sum +++ b/go.sum @@ -267,8 +267,8 @@ github.com/crewjam/saml v0.4.14/go.mod h1:UVSZCf18jJkk6GpWNVqcyQJMD5HsRugBPf4I1n github.com/cs3org/go-cs3apis v0.0.0-20260424072047-8d9ef7076ae9 h1:8WtMb7TKKx1AJM3j+uR+H25y4v+b8o8GIQg/2ooCyRo= github.com/cs3org/go-cs3apis v0.0.0-20260424072047-8d9ef7076ae9/go.mod h1:DedpcqXl193qF/08Y04IO0PpxyyMu8+GrkD6kWK2MEQ= github.com/cyberdelia/templates v0.0.0-20141128023046-ca7fffd4298c/go.mod h1:GyV+0YP4qX0UQ7r2MoYZ+AvYDp12OF5yg4q8rGnyNh4= -github.com/cyphar/filepath-securejoin v0.5.1 h1:eYgfMq5yryL4fbWfkLpFFy2ukSELzaJOTaUTuh+oF48= -github.com/cyphar/filepath-securejoin v0.5.1/go.mod h1:Sdj7gXlvMcPZsbhwhQ33GguGLDGQL7h7bg04C/+u9jI= +github.com/cyphar/filepath-securejoin v0.6.1 h1:5CeZ1jPXEiYt3+Z6zqprSAgSWiggmpVyciv8syjIpVE= +github.com/cyphar/filepath-securejoin v0.6.1/go.mod h1:A8hd4EnAeyujCJRrICiOWqjS1AX0a9kM5XL+NwKoYSc= github.com/davecgh/go-spew v1.1.0/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38= github.com/davecgh/go-spew v1.1.1/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38= github.com/davecgh/go-spew v1.1.2-0.20180830191138-d8f796af33cc h1:U9qPSI2PIWSS1VwoXQT9A3Wy9MM3WgvqSxFWenqJduM= @@ -382,12 +382,12 @@ github.com/go-cmd/cmd v1.0.5/go.mod h1:y8q8qlK5wQibcw63djSl/ntiHUHXHGdCkPk0j4QeW github.com/go-errors/errors v1.0.1/go.mod h1:f4zRHt4oKfwPJE5k8C9vpYG+aDHdBFUsgrm6/TyX73Q= github.com/go-git/gcfg v1.5.1-0.20230307220236-3a3c6141e376 h1:+zs/tPmkDkHx3U66DAb0lQFJrpS6731Oaa12ikc+DiI= github.com/go-git/gcfg v1.5.1-0.20230307220236-3a3c6141e376/go.mod h1:an3vInlBmSxCcxctByoQdvwPiA7DTK7jaaFDBTtu0ic= -github.com/go-git/go-billy/v5 v5.8.0 h1:I8hjc3LbBlXTtVuFNJuwYuMiHvQJDq1AT6u4DwDzZG0= -github.com/go-git/go-billy/v5 v5.8.0/go.mod h1:RpvI/rw4Vr5QA+Z60c6d6LXH0rYJo0uD5SqfmrrheCY= +github.com/go-git/go-billy/v5 v5.9.0 h1:jItGXszUDRtR/AlferWPTMN4j38BQ88XnXKbilmmBPA= +github.com/go-git/go-billy/v5 v5.9.0/go.mod h1:jCnQMLj9eUgGU7+ludSTYoZL/GGmii14RxKFj7ROgHw= github.com/go-git/go-git-fixtures/v4 v4.3.2-0.20231010084843-55a94097c399 h1:eMje31YglSBqCdIqdhKBW8lokaMrL3uTkpGYlE2OOT4= github.com/go-git/go-git-fixtures/v4 v4.3.2-0.20231010084843-55a94097c399/go.mod h1:1OCfN199q1Jm3HZlxleg+Dw/mwps2Wbk9frAWm+4FII= -github.com/go-git/go-git/v5 v5.18.0 h1:O831KI+0PR51hM2kep6T8k+w0/LIAD490gvqMCvL5hM= -github.com/go-git/go-git/v5 v5.18.0/go.mod h1:pW/VmeqkanRFqR6AljLcs7EA7FbZaN5MQqO7oZADXpo= +github.com/go-git/go-git/v5 v5.19.0 h1:+WkVUQZSy/F1Gb13udrMKjIM2PrzsNfDKFSfo5tkMtc= +github.com/go-git/go-git/v5 v5.19.0/go.mod h1:Pb1v0c7/g8aGQJwx9Us09W85yGoyvSwuhEGMH7zjDKQ= github.com/go-gl/glfw v0.0.0-20190409004039-e6da0acd62b1/go.mod h1:vR7hzQXu2zJy9AVAgeJqvqgH9Q5CA+iKCZ2gyEVpxRU= github.com/go-gl/glfw/v3.3/glfw v0.0.0-20191125211704-12ad95a8df72/go.mod h1:tQ2UAYgL5IevRw8kRxooKSPJfGvJ9fJQFa0TUsXzTg8= github.com/go-gl/glfw/v3.3/glfw v0.0.0-20200222043503-6f7a984d4dc4/go.mod h1:tQ2UAYgL5IevRw8kRxooKSPJfGvJ9fJQFa0TUsXzTg8= @@ -722,8 +722,8 @@ github.com/kisielk/gotool v1.0.0/go.mod h1:XhKaO+MFFWcvkIS/tQcRk01m1F5IRFswLeQ+o github.com/klauspost/compress v1.18.5 h1:/h1gH5Ce+VWNLSWqPzOVn6XBO+vJbCNGvjoaGBFW2IE= github.com/klauspost/compress v1.18.5/go.mod h1:cwPg85FWrGar70rWktvGQj8/hthj3wpl0PGDogxkrSQ= github.com/klauspost/cpuid/v2 v2.0.1/go.mod h1:FInQzS24/EEf25PyTYn52gqo7WaD8xa0213Md/qVLRg= -github.com/klauspost/cpuid/v2 v2.2.11 h1:0OwqZRYI2rFrjS4kvkDnqJkKHdHaRnCm68/DY4OxRzU= -github.com/klauspost/cpuid/v2 v2.2.11/go.mod h1:hqwkgyIinND0mEev00jJYCxPNVRVXFQeu1XKlok6oO0= +github.com/klauspost/cpuid/v2 v2.3.0 h1:S4CRMLnYUhGeDFDqkGriYKdfoFlDnMtqTiI/sFzhA9Y= +github.com/klauspost/cpuid/v2 v2.3.0/go.mod h1:hqwkgyIinND0mEev00jJYCxPNVRVXFQeu1XKlok6oO0= github.com/klauspost/crc32 v1.3.0 h1:sSmTt3gUt81RP655XGZPElI0PelVTZ6YwCRnPSupoFM= github.com/klauspost/crc32 v1.3.0/go.mod h1:D7kQaZhnkX/Y0tstFGf8VUzv2UofNGqCjnC3zdHB0Hw= github.com/kobergj/gowebdav v0.0.0-20250102091030-aa65266db202 h1:A1xJ2NKgiYFiaHiLl9B5yw/gUBACSs9crDykTS3GuQI= @@ -952,8 +952,8 @@ github.com/opencloud-eu/inotifywaitgo v0.0.0-20251111171128-a390bae3c5e9 h1:dIft github.com/opencloud-eu/inotifywaitgo v0.0.0-20251111171128-a390bae3c5e9/go.mod h1:JWyDC6H+5oZRdUJUgKuaye+8Ph5hEs6HVzVoPKzWSGI= github.com/opencloud-eu/libre-graph-api-go v1.0.8-0.20260310090739-853d972b282d h1:JcqGDiyrcaQwVyV861TUyQgO7uEmsjkhfm7aQd84dOw= github.com/opencloud-eu/libre-graph-api-go v1.0.8-0.20260310090739-853d972b282d/go.mod h1:pzatilMEHZFT3qV7C/X3MqOa3NlRQuYhlRhZTL+hN6Q= -github.com/opencloud-eu/reva/v2 v2.44.0 h1:5SZRIjFzyc4e20dCJQbeZ15Lo7COvrSQ1jgjFVQWmRE= -github.com/opencloud-eu/reva/v2 v2.44.0/go.mod h1:ZYjHYcg3rLInH81yNnC5GgS4I0JS9KRFVwxJptw1/CM= +github.com/opencloud-eu/reva/v2 v2.44.1-0.20260513122109-583a11875721 h1:PH9Ia0HwdvpfaThYCid2atc5y+uwn4EJxvJU6L9wU6M= +github.com/opencloud-eu/reva/v2 v2.44.1-0.20260513122109-583a11875721/go.mod h1:tUL2X47YxLHrnBDArHrIP73UJliMI0PaY/3tPs31dTM= github.com/opencloud-eu/secure v0.0.0-20260312082735-b6f5cb2244e4 h1:l2oB/RctH+t8r7QBj5p8thfEHCM/jF35aAY3WQ3hADI= github.com/opencloud-eu/secure v0.0.0-20260312082735-b6f5cb2244e4/go.mod h1:BmF5hyM6tXczk3MpQkFf1hpKSRqCyhqcbiQtiAF7+40= github.com/opencontainers/go-digest v1.0.0 h1:apOUWs51W5PlhuyGyz9FCeeBIOUDA/6nW8Oi/yOhh5U= @@ -988,8 +988,8 @@ github.com/philhofer/fwd v1.2.0/go.mod h1:RqIHx9QI14HlwKwm98g9Re5prTQ6LdeRQn+gXJ github.com/pierrec/lz4 v2.0.5+incompatible/go.mod h1:pdkljMzZIN41W+lC3N2tnIh5sFi+IEE17M5jbnwPHcY= github.com/pierrec/lz4/v4 v4.1.15 h1:MO0/ucJhngq7299dKLwIMtgTfbkoSPF6AoMYDd8Q4q0= github.com/pierrec/lz4/v4 v4.1.15/go.mod h1:gZWDp/Ze/IJXGXf23ltt2EXimqmTUXEy0GFuRQyBid4= -github.com/pjbgf/sha1cd v0.3.2 h1:a9wb0bp1oC2TGwStyn0Umc/IGKQnEgF0vVaZ8QF8eo4= -github.com/pjbgf/sha1cd v0.3.2/go.mod h1:zQWigSxVmsHEZow5qaLtPYxpcKMMQpa09ixqBxuCS6A= +github.com/pjbgf/sha1cd v0.6.0 h1:3WJ8Wz8gvDz29quX1OcEmkAlUg9diU4GxJHqs0/XiwU= +github.com/pjbgf/sha1cd v0.6.0/go.mod h1:lhpGlyHLpQZoxMv8HcgXvZEhcGs0PG/vsZnEJ7H0iCM= github.com/pkg/errors v0.8.0/go.mod h1:bwawxfHBFNV+L2hUp1rHADufV3IMtnDRdf1r5NINEl0= github.com/pkg/errors v0.8.1/go.mod h1:bwawxfHBFNV+L2hUp1rHADufV3IMtnDRdf1r5NINEl0= github.com/pkg/errors v0.9.1 h1:FEBLx1zS214owpjy7qsBeixbURkuhQAwrK5UwLGTwt4= @@ -1374,8 +1374,8 @@ golang.org/x/exp v0.0.0-20191227195350-da58074b4299/go.mod h1:2RIsYlXP63K8oxa1u0 golang.org/x/exp v0.0.0-20200119233911-0405dc783f0a/go.mod h1:2RIsYlXP63K8oxa1u096TMicItID8zy7Y6sNkU49FU4= golang.org/x/exp v0.0.0-20200207192155-f17229e696bd/go.mod h1:J/WKrq2StrnmMY6+EHIKF9dgMWnmCNThgcyBT1FY9mM= golang.org/x/exp v0.0.0-20200224162631-6cc2880d07d6/go.mod h1:3jZMyOhIsHpP37uCMkUooju7aAi5cS1Q23tOzKc+0MU= -golang.org/x/exp v0.0.0-20250210185358-939b2ce775ac h1:l5+whBCLH3iH2ZNHYLbAe58bo7yrN4mVcnkHDYz5vvs= -golang.org/x/exp v0.0.0-20250210185358-939b2ce775ac/go.mod h1:hH+7mtFmImwwcMvScyxUhjuVHR3HGaDPMn9rMSUUbxo= +golang.org/x/exp v0.0.0-20260410095643-746e56fc9e2f h1:W3F4c+6OLc6H2lb//N1q4WpJkhzJCK5J6kUi1NTVXfM= +golang.org/x/exp v0.0.0-20260410095643-746e56fc9e2f/go.mod h1:J1xhfL/vlindoeF/aINzNzt2Bket5bjo9sdOYzOsU80= golang.org/x/image v0.0.0-20190227222117-0694c2d4d067/go.mod h1:kZ7UVZpmo3dzQBMxlp+ypCbDeSB+sBbTgSJuh5dn5js= golang.org/x/image v0.0.0-20190802002840-cff245a6509b/go.mod h1:FeLwcggjj3mMvU+oOTbSwawSJRM1uh48EjtB4UJZlP0= golang.org/x/image v0.38.0 h1:5l+q+Y9JDC7mBOMjo4/aPhMDcxEptsX+Tt3GgRQRPuE= diff --git a/opencloud/pkg/command/shares.go b/opencloud/pkg/command/shares.go index 59e391ff2..98cee2da4 100644 --- a/opencloud/pkg/command/shares.go +++ b/opencloud/pkg/command/shares.go @@ -85,12 +85,16 @@ func cleanup(_ *cobra.Command, cfg *config.Config) error { return configlog.ReturnError(errors.New("cleanup is only implemented for the jsoncs3 share manager")) } + l := logger() + + zerolog.SetGlobalLevel(zerolog.InfoLevel) + rcfg := revaShareConfig(cfg.Sharing) f, ok := registry.NewFuncs[driver] if !ok { return configlog.ReturnError(errors.New("Unknown share manager type '" + driver + "'")) } - mgr, err := f(rcfg[driver].(map[string]any)) + mgr, err := f(rcfg[driver].(map[string]any), l) if err != nil { return configlog.ReturnError(err) } @@ -115,10 +119,6 @@ func cleanup(_ *cobra.Command, cfg *config.Config) error { if err != nil { return configlog.ReturnError(err) } - - l := logger() - - zerolog.SetGlobalLevel(zerolog.InfoLevel) serviceUserCtx = l.WithContext(serviceUserCtx) mgr.(*jsoncs3.Manager).CleanupStaleShares(serviceUserCtx) diff --git a/opencloud/pkg/init/init.go b/opencloud/pkg/init/init.go index 6d53b78f4..938205e6d 100644 --- a/opencloud/pkg/init/init.go +++ b/opencloud/pkg/init/init.go @@ -272,6 +272,9 @@ func CreateConfig(insecure, forceOverwrite, diff bool, configPath, adminPassword Activitylog: Activitylog{ ServiceAccount: serviceAccount, }, + Sharing: Sharing{ + ServiceAccount: serviceAccount, + }, } if insecure { diff --git a/opencloud/pkg/init/structs.go b/opencloud/pkg/init/structs.go index b49ae8726..3e6d0ae4f 100644 --- a/opencloud/pkg/init/structs.go +++ b/opencloud/pkg/init/structs.go @@ -204,7 +204,8 @@ type SettingsService struct { // Sharing is the configuration for the sharing service type Sharing struct { - Events Events + Events Events + ServiceAccount ServiceAccount `yaml:"service_account"` } // StorageRegistry is the configuration for the storage registry diff --git a/services/gateway/pkg/revaconfig/config.go b/services/gateway/pkg/revaconfig/config.go index 9dffd62f1..55790fe3b 100644 --- a/services/gateway/pkg/revaconfig/config.go +++ b/services/gateway/pkg/revaconfig/config.go @@ -51,7 +51,8 @@ func GatewayConfigFromStruct(cfg *config.Config, logger log.Logger) map[string]a "ocminvitemanagersvc": cfg.OCMEndpoint, "ocmproviderauthorizersvc": cfg.OCMEndpoint, "ocmcoresvc": cfg.OCMEndpoint, - "commit_share_to_storage_grant": cfg.CommitShareToStorageGrant, + "use_common_space_root_share_logic": true, + "commit_share_to_storage_grant": cfg.CommitShareToStorageGrant, "share_folder": cfg.ShareFolder, // ShareFolder is the location where to create shares in the recipient's storage provider. // other "disable_home_creation_on_login": cfg.DisableHomeCreationOnLogin, diff --git a/services/graph/pkg/service/v0/api_driveitem_permissions.go b/services/graph/pkg/service/v0/api_driveitem_permissions.go index 3d61f3472..70ee8c236 100644 --- a/services/graph/pkg/service/v0/api_driveitem_permissions.go +++ b/services/graph/pkg/service/v0/api_driveitem_permissions.go @@ -251,10 +251,6 @@ func (s DriveItemPermissionsService) Invite(ctx context.Context, resourceId *sto if shareid != "" { permission.Id = conversions.ToPointer(shareid) - } else if IsSpaceRoot(statResponse.GetInfo().GetId()) { - // permissions on a space root are not handled by a share manager so - // they don't get a share-id - permission.SetId(identitySetToSpacePermissionID(permission.GetGrantedToV2())) } if expiration != nil { @@ -420,12 +416,12 @@ func (s DriveItemPermissionsService) ListPermissions(ctx context.Context, itemID var permissionsCount int if IsSpaceRoot(statResponse.GetInfo().GetId()) { - var permissions []libregraph.Permission - permissions, permissionsCount, err = s.getSpaceRootPermissions(ctx, statResponse.GetInfo().GetSpace().GetId(), queryOptions.NoValues) + driveItems, err = s.listSpaceRootUserShares(ctx, []*collaboration.Filter{ + share.ResourceIDFilter(itemID), + }, driveItems) if err != nil { return collectionOfPermissions, err } - collectionOfPermissions.Value = permissions } else { // "normal" driveItem, populate user permissions via share providers driveItems, err = s.listUserShares(ctx, []*collaboration.Filter{ @@ -541,12 +537,10 @@ func (s DriveItemPermissionsService) DeletePermission(ctx context.Context, itemI } switch permissionType { - case User: + case User, Space: return s.removeUserShare(ctx, permissionID) case Public: return s.removePublicShare(ctx, permissionID) - case Space: - return s.removeSpacePermission(ctx, permissionID, sharedResourceID) case OCM: return s.removeOCMPermission(ctx, permissionID) default: diff --git a/services/graph/pkg/service/v0/api_driveitem_permissions_test.go b/services/graph/pkg/service/v0/api_driveitem_permissions_test.go index 3adb5b2dc..4a088664d 100644 --- a/services/graph/pkg/service/v0/api_driveitem_permissions_test.go +++ b/services/graph/pkg/service/v0/api_driveitem_permissions_test.go @@ -24,7 +24,6 @@ import ( "github.com/opencloud-eu/opencloud/services/graph/pkg/config" "github.com/stretchr/testify/mock" "github.com/tidwall/gjson" - "google.golang.org/grpc" roleconversions "github.com/opencloud-eu/reva/v2/pkg/conversions" revactx "github.com/opencloud-eu/reva/v2/pkg/ctx" @@ -391,6 +390,25 @@ var _ = Describe("DriveItemPermissionsService", func() { Expect(len(permissions.LibreGraphPermissionsActionsAllowedValues)).ToNot(BeZero()) Expect(len(permissions.LibreGraphPermissionsRolesAllowedValues)).ToNot(BeZero()) }) + It("sends SpaceRootFilter(false) when listing shares for a non-space-root item", func() { + gatewayClient.On("Stat", mock.Anything, mock.Anything).Return(statResponse, nil) + gatewayClient.On("ListPublicShares", mock.Anything, mock.Anything).Return(listPublicSharesResponse, nil) + gatewayClient.On("ListShares", + mock.Anything, + mock.MatchedBy(func(req *collaboration.ListSharesRequest) bool { + for _, f := range req.Filters { + if f.Type == collaboration.Filter_TYPE_SPACE_ROOT && !f.GetSpaceRoot() { + return true + } + } + return false + }), + ).Return(listSharesResponse, nil) + + _, err := driveItemPermissionsService.ListPermissions(context.Background(), itemID, svc.ListPermissionsQueryOptions{}) + Expect(err).ToNot(HaveOccurred()) + gatewayClient.AssertExpectations(GinkgoT()) + }) It("returns one permission per share", func() { statResponse.Info.PermissionSet = roleconversions.NewEditorRole().CS3ResourcePermissions() listSharesResponse.Shares = []*collaboration.Share{ @@ -442,6 +460,8 @@ var _ = Describe("DriveItemPermissionsService", func() { }) It("returns role denied", func() { statResponse.Info.PermissionSet = roleconversions.NewManagerRole().CS3ResourcePermissions() + statResponse.Info.Type = provider.ResourceType_RESOURCE_TYPE_CONTAINER + listSharesResponse.Shares = []*collaboration.Share{ { Id: &collaboration.ShareId{OpaqueId: "1"}, @@ -666,6 +686,7 @@ var _ = Describe("DriveItemPermissionsService", func() { } gatewayClient.On("ListStorageSpaces", mock.Anything, mock.Anything).Return(listSpacesResponse, nil) + gatewayClient.On("ListShares", mock.Anything, mock.Anything).Return(&collaboration.ListSharesResponse{Status: status.NewOK(ctx)}, nil) gatewayClient.On("ListPublicShares", mock.Anything, mock.Anything).Return(listPublicSharesResponse, nil) statResponse.Info.Id = listSpacesResponse.StorageSpaces[0].Root gatewayClient.On("Stat", mock.Anything, mock.Anything).Return(statResponse, nil) @@ -765,12 +786,10 @@ var _ = Describe("DriveItemPermissionsService", func() { gatewayClient.On("RemoveShare", mock.Anything, - mock.Anything, - ).Return(func(ctx context.Context, in *collaboration.RemoveShareRequest, opts ...grpc.CallOption) (*collaboration.RemoveShareResponse, error) { - Expect(in.Ref.GetKey()).ToNot(BeNil()) - Expect(in.Ref.GetKey().GetGrantee().GetUserId().GetOpaqueId()).To(Equal("userid")) - return &collaboration.RemoveShareResponse{Status: status.NewOK(ctx)}, nil - }) + mock.MatchedBy(func(req *collaboration.RemoveShareRequest) bool { + return req.GetRef().GetId().GetOpaqueId() == "shareid" + }), + ).Return(&collaboration.RemoveShareResponse{Status: status.NewOK(ctx)}, nil) err := driveItemPermissionsService.DeletePermission(context.Background(), &provider.ResourceId{ @@ -778,7 +797,7 @@ var _ = Describe("DriveItemPermissionsService", func() { SpaceId: "2", OpaqueId: "2", }, - "u:userid", + "shareid", ) Expect(err).ToNot(HaveOccurred()) }) @@ -1045,24 +1064,40 @@ var _ = Describe("DriveItemPermissionsService", func() { Expect(res).To(BeZero()) }) It("fails to update the space permissions for a space share when setting a file specific role", func() { - gatewayClient.On("Stat", mock.Anything, mock.Anything).Return(statResponse, nil) getPublicShareMockResponse.Share = nil getPublicShareMockResponse.Status = status.NewNotFound(ctx, "not found") gatewayClient.On("GetPublicShare", mock.Anything, mock.Anything).Return(getPublicShareMockResponse, nil) - gatewayClient.On("ListStorageSpaces", mock.Anything, mock.Anything).Return(listSpacesResponse, nil) - - statResponse.Info.Id = listSpacesResponse.StorageSpaces[0].Root - gatewayClient.On("Stat", mock.Anything, mock.Anything).Return(statResponse, nil) - gatewayClient.On("GetUser", mock.Anything, mock.Anything).Return(getUserResponse, nil) - - driveItemPermission.SetRoles([]string{unifiedrole.UnifiedRoleFileEditorID}) spaceId := &provider.ResourceId{ StorageId: "1", SpaceId: "2", OpaqueId: "2", } - res, err := driveItemPermissionsService.UpdatePermission(ctx, spaceId, "u:userid", driveItemPermission) + statResponse.Info.Id = spaceId + gatewayClient.On("Stat", mock.Anything, mock.Anything).Return(statResponse, nil) + + gatewayClient.On("ListShares", mock.Anything, mock.Anything).Return(&collaboration.ListSharesResponse{ + Status: status.NewOK(ctx), + Shares: []*collaboration.Share{ + { + Id: &collaboration.ShareId{OpaqueId: "spaceShareId"}, + ResourceId: spaceId, + Grantee: &provider.Grantee{ + Type: provider.GranteeType_GRANTEE_TYPE_USER, + Id: &provider.Grantee_UserId{ + UserId: &userpb.UserId{OpaqueId: "userid"}, + }, + }, + Permissions: &collaboration.SharePermissions{ + Permissions: roleconversions.NewSpaceViewerRole().CS3ResourcePermissions(), + }, + }, + }, + }, nil) + gatewayClient.On("GetUser", mock.Anything, mock.Anything).Return(getUserResponse, nil) + + driveItemPermission.SetRoles([]string{unifiedrole.UnifiedRoleFileEditorID}) + res, err := driveItemPermissionsService.UpdatePermission(ctx, spaceId, "spaceShareId", driveItemPermission) Expect(err).To(MatchError(errorcode.New(errorcode.InvalidRequest, "role not applicable to this resource"))) Expect(res).To(BeZero()) }) diff --git a/services/graph/pkg/service/v0/base.go b/services/graph/pkg/service/v0/base.go index bebd28ea0..85076870c 100644 --- a/services/graph/pkg/service/v0/base.go +++ b/services/graph/pkg/service/v0/base.go @@ -52,22 +52,6 @@ type BaseGraphService struct { publicBaseURL *url.URL } -func (g BaseGraphService) getSpaceRootPermissions(ctx context.Context, spaceID *storageprovider.StorageSpaceId, countOnly bool) ([]libregraph.Permission, int, error) { - gatewayClient, err := g.gatewaySelector.Next() - - if err != nil { - g.logger.Debug().Err(err).Msg("selecting gatewaySelector failed") - return nil, 0, err - } - space, err := utils.GetSpace(ctx, spaceID.GetOpaqueId(), gatewayClient) - if err != nil { - return nil, 0, errorcode.FromUtilsStatusCodeError(err) - } - - perm, count := g.cs3SpacePermissionsToLibreGraph(ctx, space, countOnly, APIVersion_1_Beta_1) - return perm, count, nil -} - func (g BaseGraphService) getDriveItem(ctx context.Context, ref *storageprovider.Reference) (*libregraph.DriveItem, error) { gatewayClient, err := g.gatewaySelector.Next() if err != nil { @@ -270,6 +254,17 @@ func (g BaseGraphService) libreGraphPermissionFromCS3PublicShare(createdLink *li } func (g BaseGraphService) listUserShares(ctx context.Context, filters []*collaboration.Filter, driveItems driveItemsByResourceID) (driveItemsByResourceID, error) { + return g.listSharesWithSpaceRootFilter(ctx, false, filters, driveItems) +} + +// listSpaceRootUserShares lists user/group shares whose resource is a space root (i.e. space +// memberships). It uses SpaceRootFilter(true) so only space-root shares are returned, mirroring +// how listUserShares works for regular file/folder shares. +func (g BaseGraphService) listSpaceRootUserShares(ctx context.Context, filters []*collaboration.Filter, driveItems driveItemsByResourceID) (driveItemsByResourceID, error) { + return g.listSharesWithSpaceRootFilter(ctx, true, filters, driveItems) +} + +func (g BaseGraphService) listSharesWithSpaceRootFilter(ctx context.Context, spaceRoot bool, filters []*collaboration.Filter, driveItems driveItemsByResourceID) (driveItemsByResourceID, error) { gatewayClient, err := g.gatewaySelector.Next() if err != nil { g.logger.Error().Err(err).Msg("could not select next gateway client") @@ -279,6 +274,7 @@ func (g BaseGraphService) listUserShares(ctx context.Context, filters []*collabo concreteFilters := []*collaboration.Filter{ share.UserGranteeFilter(), share.GroupGranteeFilter(), + share.SpaceRootFilter(spaceRoot), } concreteFilters = append(concreteFilters, filters...) @@ -563,9 +559,7 @@ func (g BaseGraphService) cs3OCMSharesToDriveItems(ctx context.Context, shares [ func (g BaseGraphService) cs3UserShareToPermission(ctx context.Context, share *collaboration.Share, roleCondition string) (*libregraph.Permission, error) { perm := libregraph.Permission{} perm.SetRoles([]string{}) - if roleCondition != unifiedrole.UnifiedRoleConditionDrive { - perm.SetId(share.GetId().GetOpaqueId()) - } + perm.SetId(share.GetId().GetOpaqueId()) grantedTo := libregraph.SharePointIdentitySet{} switch share.GetGrantee().GetType() { case storageprovider.GranteeType_GRANTEE_TYPE_USER: @@ -579,9 +573,6 @@ func (g BaseGraphService) cs3UserShareToPermission(ctx context.Context, share *c return nil, errorcode.New(errorcode.GeneralException, err.Error()) default: grantedTo.SetUser(user) - if roleCondition == unifiedrole.UnifiedRoleConditionDrive { - perm.SetId("u:" + user.GetId()) - } } case storageprovider.GranteeType_GRANTEE_TYPE_GROUP: group, err := groupIdToIdentity(ctx, g.identityCache, share.Grantee.GetGroupId().GetOpaqueId()) @@ -594,9 +585,6 @@ func (g BaseGraphService) cs3UserShareToPermission(ctx context.Context, share *c return nil, errorcode.New(errorcode.GeneralException, err.Error()) default: grantedTo.SetGroup(group) - if roleCondition == unifiedrole.UnifiedRoleConditionDrive { - perm.SetId("g:" + group.GetId()) - } } } @@ -927,35 +915,6 @@ func (g BaseGraphService) removeUserShare(ctx context.Context, permissionID stri return nil } -func (g BaseGraphService) removeSpacePermission(ctx context.Context, permissionID string, resourceId *storageprovider.ResourceId) error { - grantee, err := spacePermissionIdToCS3Grantee(permissionID) - if err != nil { - return err - } - - gatewayClient, err := g.gatewaySelector.Next() - if err != nil { - g.logger.Debug().Err(err).Msg("selecting gatewaySelector failed") - return err - } - removeShareResp, err := gatewayClient.RemoveShare(ctx, &collaboration.RemoveShareRequest{ - Ref: &collaboration.ShareReference{ - Spec: &collaboration.ShareReference_Key{ - Key: &collaboration.ShareKey{ - ResourceId: resourceId, - Grantee: &grantee, - }, - }, - }, - }) - if err := errorcode.FromCS3Status(removeShareResp.GetStatus(), err); err != nil { - return err - } - - // We need to return an untyped nil here otherwise the error==nil check won't work - return nil -} - func (g BaseGraphService) getOCMPermissionResourceID(ctx context.Context, permissionID string) (*storageprovider.ResourceId, error) { cs3Share, err := g.getCS3OCMShareByID(ctx, permissionID) if err != nil { @@ -1071,20 +1030,19 @@ func (g BaseGraphService) getPermissionByID(ctx context.Context, permissionID st } return permission, publicShare.GetResourceId(), nil case IsSpaceRoot(itemID): - // itemID is referencing a spaceroot this is a space permission. Handle - // that here and get space id - resourceInfo, err := utils.GetResourceByID(ctx, itemID, gatewayClient) + // itemID is referencing a space root — use the share manager to look up the permission + driveItems := make(driveItemsByResourceID) + driveItems, err = g.listSpaceRootUserShares(ctx, []*collaboration.Filter{ + share.ResourceIDFilter(itemID), + }, driveItems) if err != nil { return nil, nil, err } - - perms, _, err := g.getSpaceRootPermissions(ctx, resourceInfo.GetSpace().GetId(), false) - if err != nil { - return nil, nil, err - } - for _, p := range perms { - if p.GetId() == permissionID { - return &p, itemID, nil + for _, item := range driveItems { + for i := range item.Permissions { + if item.Permissions[i].GetId() == permissionID { + return &item.Permissions[i], itemID, nil + } } } case errors.As(err, &errcode) && errcode.GetCode() == errorcode.ItemNotFound: @@ -1239,29 +1197,10 @@ func (g BaseGraphService) updateUserShare(ctx context.Context, permissionID stri } var cs3UpdateShareReq collaboration.UpdateShareRequest - // When updating a space root we need to reference the share by resourceId and grantee - if IsSpaceRoot(itemID) { - grantee, err := spacePermissionIdToCS3Grantee(permissionID) - if err != nil { - g.logger.Debug().Err(err).Str("permissionid", permissionID).Msg("failed to parse space permission id") - return nil, err - } - cs3UpdateShareReq.Share = &collaboration.Share{ - ResourceId: itemID, - Grantee: &grantee, - } - cs3UpdateShareReq.Opaque = &types.Opaque{ - Map: map[string]*types.OpaqueEntry{ - "spacegrant": {}, - }, - } - cs3UpdateShareReq.Opaque = utils.AppendPlainToOpaque(cs3UpdateShareReq.Opaque, "spacetype", _spaceTypeProject) - } else { - cs3UpdateShareReq.Share = &collaboration.Share{ - Id: &collaboration.ShareId{ - OpaqueId: permissionID, - }, - } + cs3UpdateShareReq.Share = &collaboration.Share{ + Id: &collaboration.ShareId{ + OpaqueId: permissionID, + }, } fieldmask := []string{} if expiration, ok := newPermission.GetExpirationDateTimeOk(); ok { diff --git a/services/graph/pkg/service/v0/driveitems.go b/services/graph/pkg/service/v0/driveitems.go index 83908cb61..f9ae229da 100644 --- a/services/graph/pkg/service/v0/driveitems.go +++ b/services/graph/pkg/service/v0/driveitems.go @@ -15,8 +15,6 @@ import ( "time" gateway "github.com/cs3org/go-cs3apis/cs3/gateway/v1beta1" - grouppb "github.com/cs3org/go-cs3apis/cs3/identity/group/v1beta1" - userpb "github.com/cs3org/go-cs3apis/cs3/identity/user/v1beta1" cs3rpc "github.com/cs3org/go-cs3apis/cs3/rpc/v1beta1" storageprovider "github.com/cs3org/go-cs3apis/cs3/storage/provider/v1beta1" types "github.com/cs3org/go-cs3apis/cs3/types/v1beta1" @@ -349,35 +347,6 @@ func (g Graph) GetDriveItemChildren(w http.ResponseWriter, r *http.Request) { render.JSON(w, r, &ListResponse{Value: files}) } -func spacePermissionIdToCS3Grantee(permissionID string) (storageprovider.Grantee, error) { - // the permission ID for space permission is made of two parts - // the grantee type ('u' or user, 'g' for group) and the user or group id - var grantee storageprovider.Grantee - parts := strings.SplitN(permissionID, ":", 2) - if len(parts) != 2 { - return grantee, errorcode.New(errorcode.InvalidRequest, "invalid space permission id") - } - switch parts[0] { - case "u": - grantee.Type = storageprovider.GranteeType_GRANTEE_TYPE_USER - grantee.Id = &storageprovider.Grantee_UserId{ - UserId: &userpb.UserId{ - OpaqueId: parts[1], - }, - } - case "g": - grantee.Type = storageprovider.GranteeType_GRANTEE_TYPE_GROUP - grantee.Id = &storageprovider.Grantee_GroupId{ - GroupId: &grouppb.GroupId{ - OpaqueId: parts[1], - }, - } - default: - return grantee, errorcode.New(errorcode.InvalidRequest, "invalid space permission id") - } - return grantee, nil -} - func (g Graph) getRemoteItem(ctx context.Context, root *storageprovider.ResourceId, baseURL *url.URL) (*libregraph.RemoteItem, error) { gatewayClient, err := g.gatewaySelector.Next() if err != nil { @@ -465,14 +434,22 @@ func cs3ResourceToDriveItem(logger *log.Logger, publicBaseURL *url.URL, res *sto parentRef.SetPath(path.Dir(res.GetPath())) driveItem.ParentReference = parentRef } - if res.GetType() == storageprovider.ResourceType_RESOURCE_TYPE_FILE && res.GetMimeType() != "" { + switch res.GetType() { + case storageprovider.ResourceType_RESOURCE_TYPE_FILE: + mimeType := res.GetMimeType() + if mimeType == "" { + mimeType = "application/octet-stream" + } // We cannot use a libregraph.File here because the openapi codegenerator autodetects 'File' as a go type ... driveItem.File = &libregraph.OpenGraphFile{ - MimeType: &res.MimeType, + MimeType: &mimeType, + } + case storageprovider.ResourceType_RESOURCE_TYPE_CONTAINER: + if IsSpaceRoot(res.GetId()) { + driveItem.SetRoot(map[string]any{}) + } else { + driveItem.SetFolder(libregraph.Folder{}) } - } - if res.GetType() == storageprovider.ResourceType_RESOURCE_TYPE_CONTAINER { - driveItem.Folder = &libregraph.Folder{} } if res.GetArbitraryMetadata() != nil { diff --git a/services/graph/pkg/service/v0/sharedwithme.go b/services/graph/pkg/service/v0/sharedwithme.go index f6e645e19..c9d1ca92c 100644 --- a/services/graph/pkg/service/v0/sharedwithme.go +++ b/services/graph/pkg/service/v0/sharedwithme.go @@ -10,6 +10,7 @@ import ( ocm "github.com/cs3org/go-cs3apis/cs3/sharing/ocm/v1beta1" "github.com/go-chi/render" libregraph "github.com/opencloud-eu/libre-graph-api-go" + "github.com/opencloud-eu/reva/v2/pkg/share" "github.com/opencloud-eu/opencloud/services/graph/pkg/errorcode" "github.com/opencloud-eu/opencloud/services/thumbnails/pkg/thumbnail" @@ -41,7 +42,11 @@ func (g Graph) listSharedWithMe(ctx context.Context, expandThumbnails bool) ([]l return nil, err } - listReceivedSharesResponse, err := gatewayClient.ListReceivedShares(ctx, &collaboration.ListReceivedSharesRequest{}) + listReceivedSharesResponse, err := gatewayClient.ListReceivedShares(ctx, &collaboration.ListReceivedSharesRequest{ + Filters: []*collaboration.Filter{ + share.SpaceRootFilter(false), + }, + }) if err := errorcode.FromCS3Status(listReceivedSharesResponse.GetStatus(), err); err != nil { g.logger.Error().Err(err).Msg("listing shares failed") return nil, err diff --git a/services/sharing/pkg/config/config.go b/services/sharing/pkg/config/config.go index 0ba4a330f..2f3f7178e 100644 --- a/services/sharing/pkg/config/config.go +++ b/services/sharing/pkg/config/config.go @@ -18,7 +18,8 @@ type Config struct { Reva *shared.Reva `yaml:"reva"` Events Events `yaml:"events"` - SkipUserGroupsInToken bool `yaml:"skip_user_groups_in_token" env:"SHARING_SKIP_USER_GROUPS_IN_TOKEN" desc:"Disables the loading of user's group memberships from the reva access token." introductionVersion:"1.0.0"` + ServiceAccount ServiceAccount `yaml:"service_account"` + SkipUserGroupsInToken bool `yaml:"skip_user_groups_in_token" env:"SHARING_SKIP_USER_GROUPS_IN_TOKEN" desc:"Disables the loading of user's group memberships from the reva access token." introductionVersion:"1.0.0"` UserSharingDriver string `yaml:"user_sharing_driver" env:"SHARING_USER_DRIVER" desc:"Driver to be used to persist shares. Supported values are 'jsoncs3', 'json', 'cs3' (deprecated) and 'owncloudsql'." introductionVersion:"1.0.0"` UserSharingDrivers UserSharingDrivers `yaml:"user_sharing_drivers"` @@ -100,6 +101,13 @@ type UserSharingJSONCS3Driver struct { CacheTTL int `yaml:"cache_ttl" env:"SHARING_USER_JSONCS3_CACHE_TTL" desc:"TTL for the internal caches in seconds." introductionVersion:"1.0.0"` MaxConcurrency int `yaml:"max_concurrency" env:"OC_MAX_CONCURRENCY;SHARING_USER_JSONCS3_MAX_CONCURRENCY" desc:"Maximum number of concurrent go-routines. Higher values can potentially get work done faster but will also cause more load on the system. Values of 0 or below will be ignored and the default value will be used." introductionVersion:"1.0.0"` } + +// ServiceAccount is the configuration for the used service account +type ServiceAccount struct { + ServiceAccountID string `yaml:"service_account_id" env:"OC_SERVICE_ACCOUNT_ID;SHARING_SERVICE_ACCOUNT" desc:"The ID of the service account the service should use. See the 'auth-service' service description for more details." introductionVersion:"%%NEXT%%"` + ServiceAccountSecret string `yaml:"service_account_secret" env:"OC_SERVICE_ACCOUNT_SECRET;SHARING_SERVICE_ACCOUNT_SECRET" desc:"The service account secret." introductionVersion:"%%NEXT%%"` +} + type PublicSharingDrivers struct { JSON PublicSharingJSONDriver `yaml:"json"` JSONCS3 PublicSharingJSONCS3Driver `yaml:"jsoncs3"` diff --git a/services/sharing/pkg/config/parser/parse.go b/services/sharing/pkg/config/parser/parse.go index 678f50d25..96adde279 100644 --- a/services/sharing/pkg/config/parser/parse.go +++ b/services/sharing/pkg/config/parser/parse.go @@ -58,5 +58,13 @@ func Validate(cfg *config.Config) error { return shared.MissingSystemUserID(cfg.Service.Name) } + if cfg.ServiceAccount.ServiceAccountID == "" { + return shared.MissingServiceAccountID(cfg.Service.Name) + } + + if cfg.ServiceAccount.ServiceAccountSecret == "" { + return shared.MissingServiceAccountSecret(cfg.Service.Name) + } + return nil } diff --git a/services/sharing/pkg/revaconfig/config.go b/services/sharing/pkg/revaconfig/config.go index 57b12b9b0..b7244e37b 100644 --- a/services/sharing/pkg/revaconfig/config.go +++ b/services/sharing/pkg/revaconfig/config.go @@ -71,13 +71,15 @@ func SharingConfigFromStruct(cfg *config.Config, logger log.Logger) (map[string] "machine_auth_apikey": cfg.UserSharingDrivers.CS3.SystemUserAPIKey, }, "jsoncs3": map[string]any{ - "gateway_addr": cfg.Reva.Address, - "provider_addr": cfg.UserSharingDrivers.JSONCS3.ProviderAddr, - "service_user_id": cfg.UserSharingDrivers.JSONCS3.SystemUserID, - "service_user_idp": cfg.UserSharingDrivers.JSONCS3.SystemUserIDP, - "machine_auth_apikey": cfg.UserSharingDrivers.JSONCS3.SystemUserAPIKey, - "ttl": cfg.UserSharingDrivers.JSONCS3.CacheTTL, - "max_concurrency": cfg.UserSharingDrivers.JSONCS3.MaxConcurrency, + "gateway_addr": cfg.Reva.Address, + "provider_addr": cfg.UserSharingDrivers.JSONCS3.ProviderAddr, + "system_user_id": cfg.UserSharingDrivers.JSONCS3.SystemUserID, + "system_user_idp": cfg.UserSharingDrivers.JSONCS3.SystemUserIDP, + "machine_auth_apikey": cfg.UserSharingDrivers.JSONCS3.SystemUserAPIKey, + "ttl": cfg.UserSharingDrivers.JSONCS3.CacheTTL, + "max_concurrency": cfg.UserSharingDrivers.JSONCS3.MaxConcurrency, + "service_account_id": cfg.ServiceAccount.ServiceAccountID, + "service_account_secret": cfg.ServiceAccount.ServiceAccountSecret, "events": map[string]any{ "natsaddress": cfg.Events.Addr, "natsclusterid": cfg.Events.ClusterID, diff --git a/tests/acceptance/bootstrap/SharingNgContext.php b/tests/acceptance/bootstrap/SharingNgContext.php index 7f9be3b01..50c91e001 100644 --- a/tests/acceptance/bootstrap/SharingNgContext.php +++ b/tests/acceptance/bootstrap/SharingNgContext.php @@ -420,7 +420,7 @@ class SharingNgContext implements Context { $expirationDateTime = (\array_key_exists('expirationDateTime', $rows)) ? \date(DATE_RFC3339, \strtotime($rows['expirationDateTime'])) : null; - return GraphHelper::sendSharingInvitationForDrive( + $response = GraphHelper::sendSharingInvitationForDrive( $this->featureContext->getBaseUrl(), $this->featureContext->getStepLineRef(), $user, @@ -432,6 +432,10 @@ class SharingNgContext implements Context { $permissionsAction, $expirationDateTime ); + if ($response->getStatusCode() === 200) { + $this->featureContext->shareNgAddToCreatedUserGroupShares($response); + } + return $response; } /** @@ -651,13 +655,7 @@ class SharingNgContext implements Context { string $sharee, TableNode $table ) { - $permissionID = ""; - if ($shareType === "user") { - $permissionID = "u:" . $this->featureContext->getAttributeOfCreatedUser($sharee, 'id'); - } elseif ($shareType === "group") { - $permissionID = "g:" . $this->featureContext->getAttributeOfCreatedGroup($sharee, 'id'); - } - + $permissionID = $this->featureContext->shareNgGetLastCreatedUserGroupShareID(); $this->featureContext->setResponse( $this->updateResourceShare( $user, @@ -974,7 +972,6 @@ class SharingNgContext implements Context { * @param string $shareType (user|group|link) * @param string $space * @param string|null $resource - * @param string|null $recipient * * @return ResponseInterface * @throws GuzzleException @@ -984,29 +981,15 @@ class SharingNgContext implements Context { string $sharer, string $shareType, string $space, - ?string $resource = null, - ?string $recipient = null + ?string $resource = null ): ResponseInterface { $spaceId = ($this->spacesContext->getSpaceByName($sharer, $space))["id"]; $itemId = (isset($resource)) ? $this->spacesContext->getResourceId($sharer, $space, $resource) : $this->spacesContext->getResourceId($sharer, $space, $space); - $permissionID = ""; - - // if resource is not provided then it indicates a space share - // and the space shares are not stored - // so build the permission-id using the user or group id - if ($resource === null) { - if ($shareType === "user") { - $permissionID = "u:" . $this->featureContext->getAttributeOfCreatedUser($recipient, 'id'); - } elseif ($shareType === "group") { - $permissionID = "g:" . $this->featureContext->getAttributeOfCreatedGroup($recipient, 'id'); - } - } else { - $permissionID = ($shareType === 'link') + $permissionID = ($shareType === 'link') ? $this->featureContext->shareNgGetLastCreatedLinkShareID() : $this->featureContext->shareNgGetLastCreatedUserGroupShareID(); - } return GraphHelper::removeAccessToSpaceItem( @@ -1040,12 +1023,18 @@ class SharingNgContext implements Context { ): ResponseInterface { $spaceId = ($this->spacesContext->getSpaceByName($sharer, $space))["id"]; - $permissionID = match ($shareType) { - 'link' => $this->featureContext->shareNgGetLastCreatedLinkShareID(), - 'user' => 'u:' . $this->featureContext->getAttributeOfCreatedUser($recipient, 'id'), - 'group' => 'g:' . $this->featureContext->getAttributeOfCreatedGroup($recipient, 'id'), - default => throw new Exception("shareType '$shareType' does not match user|group|link "), - }; + // if recipient is not provided, it means user tries to remove own access, then we need to get the user permission id + if ($shareType == 'user' && !isset($recipient)) { + $this->featureContext->shareNgAddToCreatedUserGroupShares($this->getDrivePermissionsList($sharer, $space)); + $permissionID = $this->featureContext->shareNgGetLastCreatedUserGroupShareID(); + } else { + $permissionID = match ($shareType) { + 'link' => $this->featureContext->shareNgGetLastCreatedLinkShareID(), + 'user' => $this->featureContext->shareNgGetLastCreatedUserGroupShareID(), + 'group' => $this->featureContext->shareNgGetLastCreatedUserGroupShareID(), + default => throw new Exception("shareType '$shareType' does not match user|group|link "), + }; + } return GraphHelper::removeAccessToSpace( @@ -1078,7 +1067,7 @@ class SharingNgContext implements Context { string $resource, string $space ): void { - $response = $this->removeAccessToSpaceItem($sharer, $recipientType, $space, $resource); + $response = $this->removeAccessToSpaceItem($sharer, $recipientType, $space, $resource, $recipient); $this->featureContext->theHTTPStatusCodeShouldBe(204, "", $response); } @@ -1195,6 +1184,44 @@ class SharingNgContext implements Context { ); } + /** + * @When /^user "([^"]*)" removes own access from space "([^"]*)" using root endpoint of the Graph API$/ + * @When /^user "([^"]*)" tries to remove own access from space "([^"]*)" using root endpoint of the Graph API$/ + * + * @param string $user + * @param string $space + * + * @return void + * @throws JsonException + * @throws GuzzleException + */ + public function userRemovesOwnAccessFromSpaceUsingGraphAPI( + string $user, + string $space + ): void { + $this->featureContext->setResponse( + $this->removeAccessToSpace($user, 'user', $space) + ); + } + + /** + * @Given /^user "([^"]*)" has removed own access from space "([^"]*)"$/ + * + * @param string $user + * @param string $space + * + * @return void + * @throws JsonException + * @throws GuzzleException + */ + public function userHasRemovedOwnAccessFromSpace( + string $user, + string $space + ): void { + $response = $this->removeAccessToSpace($user, 'user', $space); + $this->featureContext->theHTTPStatusCodeShouldBe(204, "", $response); + } + /** * @When /^user "([^"]*)" removes the link from space "([^"]*)" using root endpoint of the Graph API$/ * @@ -1650,11 +1677,7 @@ class SharingNgContext implements Context { TableNode $table ): void { $bodyRows = $table->getRowsHash(); - $permissionID = match ($bodyRows['shareType']) { - 'user' => 'u:' . $this->featureContext->getAttributeOfCreatedUser($bodyRows['sharee'], 'id'), - 'group' => 'g:' . $this->featureContext->getAttributeOfCreatedGroup($bodyRows['sharee'], 'id'), - default => throw new Exception("shareType {$bodyRows['shareType']} does not match user|group "), - }; + $permissionID = $this->featureContext->shareNgGetLastCreatedUserGroupShareID(); $space = $bodyRows['space']; $spaceId = ($this->spacesContext->getSpaceByName($user, $space))["id"]; $body = []; diff --git a/tests/acceptance/expected-failures-posix-storage.md b/tests/acceptance/expected-failures-posix-storage.md index 5bce2f1e9..971ded304 100644 --- a/tests/acceptance/expected-failures-posix-storage.md +++ b/tests/acceptance/expected-failures-posix-storage.md @@ -345,6 +345,10 @@ _ocdav: api compatibility, return correct status code_ - [coreApiWebdavPreviews/previews.feature:264](https://github.com/opencloud-eu/opencloud/blob/main/tests/acceptance/features/coreApiWebdavPreviews/previews.feature#L264) - [coreApiWebdavPreviews/previews.feature:265](https://github.com/opencloud-eu/opencloud/blob/main/tests/acceptance/features/coreApiWebdavPreviews/previews.feature#L265) +### TODO: adjust test + +- [apiSharingNg1/removeAccessToDrive.feature:145](https://github.com/opencloud-eu/opencloud/blob/main/tests/acceptance/features/apiSharingNg1/removeAccessToDrive.feature#L145) + ### Won't fix diff --git a/tests/acceptance/features/apiSharingNg1/listPermissions.feature b/tests/acceptance/features/apiSharingNg1/listPermissions.feature index 1e1c62ea7..0c44e084e 100644 --- a/tests/acceptance/features/apiSharingNg1/listPermissions.feature +++ b/tests/acceptance/features/apiSharingNg1/listPermissions.feature @@ -414,7 +414,7 @@ Feature: List a sharing permissions }, "id": { "type": "string", - "pattern": "^u:%user_id_pattern%$" + "pattern": "^%permissions_id_pattern%$" }, "roles": { "type": "array", @@ -456,7 +456,7 @@ Feature: List a sharing permissions }, "id": { "type": "string", - "pattern": "^u:%user_id_pattern%$" + "pattern": "^%permissions_id_pattern%$" }, "roles": { "type": "array", @@ -1428,7 +1428,7 @@ Feature: List a sharing permissions }, "id": { "type": "string", - "pattern": "^u:%user_id_pattern%$" + "pattern": "^%permissions_id_pattern%$" }, "roles": { "type": "array", @@ -1470,7 +1470,7 @@ Feature: List a sharing permissions }, "id": { "type": "string", - "pattern": "^u:%user_id_pattern%$" + "pattern": "^%permissions_id_pattern%$" }, "roles": { "type": "array", @@ -2769,4 +2769,4 @@ Feature: List a sharing permissions } } } - """ \ No newline at end of file + """ diff --git a/tests/acceptance/features/apiSharingNg1/removeAccessToDrive.feature b/tests/acceptance/features/apiSharingNg1/removeAccessToDrive.feature index 267020f6b..fc0ef7563 100644 --- a/tests/acceptance/features/apiSharingNg1/removeAccessToDrive.feature +++ b/tests/acceptance/features/apiSharingNg1/removeAccessToDrive.feature @@ -137,7 +137,7 @@ Feature: Remove access to a drive Scenario: user cannot remove himself from the project space if he is the last manager using root endpoint Given the administrator has assigned the role "Space Admin" to user "Alice" using the Graph API And user "Alice" has created a space "NewSpace" with the default quota using the Graph API - When user "Alice" tries to remove the access of user "Alice" from space "NewSpace" using root endpoint of the Graph API + When user "Alice" tries to remove own access from space "NewSpace" using root endpoint of the Graph API Then the HTTP status code should be "403" And the user "Alice" should have a space called "NewSpace" @@ -152,7 +152,7 @@ Feature: Remove access to a drive | sharee | group1 | | shareType | group | | permissionsRole | Manager | - And user "Alice" has removed the access of user "Alice" from space "NewSpace" + And user "Alice" has removed own access from space "NewSpace" When user "Brian" tries to remove the access of group "group1" from space "NewSpace" using root endpoint of the Graph API Then the HTTP status code should be "403" And the user "Brian" should have a space called "NewSpace" diff --git a/tests/acceptance/features/apiSharingNg1/sharedByMe.feature b/tests/acceptance/features/apiSharingNg1/sharedByMe.feature index 2b4d69ae6..1223b03c2 100644 --- a/tests/acceptance/features/apiSharingNg1/sharedByMe.feature +++ b/tests/acceptance/features/apiSharingNg1/sharedByMe.feature @@ -3407,7 +3407,7 @@ Feature: resources shared by user "name", "id", "eTag", - "folder", + "root", "lastModifiedDateTime", "size" ], @@ -3415,7 +3415,7 @@ Feature: resources shared by user "name": { "const": "." }, - "folder": { + "root": { "const": {} }, "id": { diff --git a/tests/acceptance/features/apiSharingNgShareInvitation/shareInvitations.feature b/tests/acceptance/features/apiSharingNgShareInvitation/shareInvitations.feature index 55813fcb6..1e81e376e 100644 --- a/tests/acceptance/features/apiSharingNgShareInvitation/shareInvitations.feature +++ b/tests/acceptance/features/apiSharingNgShareInvitation/shareInvitations.feature @@ -1777,7 +1777,7 @@ Feature: Send a sharing invitations }, "id": { "type": "string", - "pattern": "^g:%group_id_pattern%$" + "pattern": "^%permissions_id_pattern%$" }, "roles": { "type": "array", diff --git a/tests/acceptance/features/apiSharingNgShareInvitation/updateShareInvitations.feature b/tests/acceptance/features/apiSharingNgShareInvitation/updateShareInvitations.feature index e8addc6a8..ad024c006 100644 --- a/tests/acceptance/features/apiSharingNgShareInvitation/updateShareInvitations.feature +++ b/tests/acceptance/features/apiSharingNgShareInvitation/updateShareInvitations.feature @@ -278,7 +278,7 @@ Feature: Update permission of a share }, "id": { "type": "string", - "pattern": "^u:%user_id_pattern%$" + "pattern": "^%permissions_id_pattern%$" }, "roles": { "type": "array", @@ -437,7 +437,7 @@ Feature: Update permission of a share }, "id": { "type": "string", - "pattern": "^g:%group_id_pattern%$" + "pattern": "^%permissions_id_pattern%$" }, "roles": { "type": "array", @@ -517,7 +517,7 @@ Feature: Update permission of a share }, "id": { "type": "string", - "pattern": "^g:%group_id_pattern%$" + "pattern": "^%permissions_id_pattern%$" }, "roles": { "type": "array", @@ -602,7 +602,7 @@ Feature: Update permission of a share }, "id": { "type": "string", - "pattern": "^g:%group_id_pattern%$" + "pattern": "^%permissions_id_pattern%$" }, "roles": { "type": "array", @@ -680,7 +680,7 @@ Feature: Update permission of a share }, "id": { "type": "string", - "pattern": "^g:%group_id_pattern%$" + "pattern": "^%permissions_id_pattern%$" }, "roles": { "type": "array", @@ -766,7 +766,7 @@ Feature: Update permission of a share }, "id": { "type": "string", - "pattern": "^g:%group_id_pattern%$" + "pattern": "^%permissions_id_pattern%$" }, "roles": { "type": "array", @@ -842,7 +842,7 @@ Feature: Update permission of a share }, "id": { "type": "string", - "pattern": "^u:%user_id_pattern%$" + "pattern": "^%permissions_id_pattern%$" }, "roles": { "type": "array", @@ -918,7 +918,7 @@ Feature: Update permission of a share }, "id": { "type": "string", - "pattern": "^u:%user_id_pattern%$" + "pattern": "^%permissions_id_pattern%$" }, "roles": { "type": "array", @@ -1000,7 +1000,7 @@ Feature: Update permission of a share }, "id": { "type": "string", - "pattern": "^u:%user_id_pattern%$" + "pattern": "^%permissions_id_pattern%$" }, "roles": { "type": "array", @@ -1077,7 +1077,7 @@ Feature: Update permission of a share }, "id": { "type": "string", - "pattern": "^u:%user_id_pattern%$" + "pattern": "^%permissions_id_pattern%$" }, "roles": { "type": "array", @@ -1159,7 +1159,7 @@ Feature: Update permission of a share }, "id": { "type": "string", - "pattern": "^u:%user_id_pattern%$" + "pattern": "^%permissions_id_pattern%$" }, "roles": { "type": "array", @@ -1417,7 +1417,7 @@ Feature: Update permission of a share } }, "id": { - "pattern": "^u:%user_id_pattern%$" + "pattern": "^%permissions_id_pattern%$" } } } diff --git a/vendor/github.com/cyphar/filepath-securejoin/.golangci.yml b/vendor/github.com/cyphar/filepath-securejoin/.golangci.yml index e965034ed..3e8dd99bd 100644 --- a/vendor/github.com/cyphar/filepath-securejoin/.golangci.yml +++ b/vendor/github.com/cyphar/filepath-securejoin/.golangci.yml @@ -9,6 +9,10 @@ version: "2" +run: + build-tags: + - libpathrs + linters: enable: - asasalint diff --git a/vendor/github.com/cyphar/filepath-securejoin/CHANGELOG.md b/vendor/github.com/cyphar/filepath-securejoin/CHANGELOG.md index 3faee0bc5..6d016d05c 100644 --- a/vendor/github.com/cyphar/filepath-securejoin/CHANGELOG.md +++ b/vendor/github.com/cyphar/filepath-securejoin/CHANGELOG.md @@ -4,7 +4,54 @@ All notable changes to this project will be documented in this file. The format is based on [Keep a Changelog](http://keepachangelog.com/) and this project adheres to [Semantic Versioning](http://semver.org/). -## [Unreleased 0.5.z] ## +## [Unreleased] ## + +## [0.6.1] - 2025-11-19 ## + +> At last up jumped the cunning spider, and fiercely held her fast. + +### Fixed ### +- Our logic for deciding whether to use `openat2(2)` or fallback to an `O_PATH` + resolver would cache the result to avoid doing needless test runs of + `openat2(2)`. However, this causes issues when `pathrs-lite` is being used by + a program that applies new seccomp-bpf filters onto itself -- if the filter + denies `openat2(2)` then we would return that error rather than falling back + to the `O_PATH` resolver. To resolve this issue, we no longer cache the + result if `openat2(2)` was successful, only if there was an error. +- A file descriptor leak in our `openat2` wrapper (when doing the necessary + `dup` for `RESOLVE_IN_ROOT`) has been removed. + +## [0.5.2] - 2025-11-19 ## + +> "Will you walk into my parlour?" said a spider to a fly. + +### Fixed ### +- Our logic for deciding whether to use `openat2(2)` or fallback to an `O_PATH` + resolver would cache the result to avoid doing needless test runs of + `openat2(2)`. However, this causes issues when `pathrs-lite` is being used by + a program that applies new seccomp-bpf filters onto itself -- if the filter + denies `openat2(2)` then we would return that error rather than falling back + to the `O_PATH` resolver. To resolve this issue, we no longer cache the + result if `openat2(2)` was successful, only if there was an error. +- A file descriptor leak in our `openat2` wrapper (when doing the necessary + `dup` for `RESOLVE_IN_ROOT`) has been removed. + +## [0.6.0] - 2025-11-03 ## + +> By the Power of Greyskull! + +### Breaking ### +- The deprecated `MkdirAll`, `MkdirAllHandle`, `OpenInRoot`, `OpenatInRoot` and + `Reopen` wrappers have been removed. Please switch to using `pathrs-lite` + directly. + +### Added ### +- `pathrs-lite` now has support for using libpathrs as a backend. This is + opt-in and can be enabled at build time with the `libpathrs` build tag. The + intention is to allow for downstream libraries and other projects to make use + of the pure-Go `github.com/cyphar/filepath-securejoin/pathrs-lite` package + and distributors can then opt-in to using `libpathrs` for the entire binary + if they wish. ## [0.5.1] - 2025-10-31 ## @@ -383,7 +430,10 @@ This is our first release of `github.com/cyphar/filepath-securejoin`, containing a full implementation with a coverage of 93.5% (the only missing cases are the error cases, which are hard to mocktest at the moment). -[Unreleased 0.5.z]: https://github.com/cyphar/filepath-securejoin/compare/v0.5.1...release-0.5 +[Unreleased]: https://github.com/cyphar/filepath-securejoin/compare/v0.6.1...HEAD +[0.6.1]: https://github.com/cyphar/filepath-securejoin/compare/v0.6.0...v0.6.1 +[0.6.0]: https://github.com/cyphar/filepath-securejoin/compare/v0.5.0...v0.6.0 +[0.5.2]: https://github.com/cyphar/filepath-securejoin/compare/v0.5.1...v0.5.2 [0.5.1]: https://github.com/cyphar/filepath-securejoin/compare/v0.5.0...v0.5.1 [0.5.0]: https://github.com/cyphar/filepath-securejoin/compare/v0.4.1...v0.5.0 [0.4.1]: https://github.com/cyphar/filepath-securejoin/compare/v0.4.0...v0.4.1 diff --git a/vendor/github.com/cyphar/filepath-securejoin/VERSION b/vendor/github.com/cyphar/filepath-securejoin/VERSION index 4b9fcbec1..ee6cdce3c 100644 --- a/vendor/github.com/cyphar/filepath-securejoin/VERSION +++ b/vendor/github.com/cyphar/filepath-securejoin/VERSION @@ -1 +1 @@ -0.5.1 +0.6.1 diff --git a/vendor/github.com/cyphar/filepath-securejoin/deprecated_linux.go b/vendor/github.com/cyphar/filepath-securejoin/deprecated_linux.go deleted file mode 100644 index 3e427b164..000000000 --- a/vendor/github.com/cyphar/filepath-securejoin/deprecated_linux.go +++ /dev/null @@ -1,48 +0,0 @@ -// SPDX-License-Identifier: MPL-2.0 - -//go:build linux - -// Copyright (C) 2024-2025 Aleksa Sarai -// Copyright (C) 2024-2025 SUSE LLC -// -// This Source Code Form is subject to the terms of the Mozilla Public -// License, v. 2.0. If a copy of the MPL was not distributed with this -// file, You can obtain one at https://mozilla.org/MPL/2.0/. - -package securejoin - -import ( - "github.com/cyphar/filepath-securejoin/pathrs-lite" -) - -var ( - // MkdirAll is a wrapper around [pathrs.MkdirAll]. - // - // Deprecated: You should use [pathrs.MkdirAll] directly instead. This - // wrapper will be removed in filepath-securejoin v0.6. - MkdirAll = pathrs.MkdirAll - - // MkdirAllHandle is a wrapper around [pathrs.MkdirAllHandle]. - // - // Deprecated: You should use [pathrs.MkdirAllHandle] directly instead. - // This wrapper will be removed in filepath-securejoin v0.6. - MkdirAllHandle = pathrs.MkdirAllHandle - - // OpenInRoot is a wrapper around [pathrs.OpenInRoot]. - // - // Deprecated: You should use [pathrs.OpenInRoot] directly instead. This - // wrapper will be removed in filepath-securejoin v0.6. - OpenInRoot = pathrs.OpenInRoot - - // OpenatInRoot is a wrapper around [pathrs.OpenatInRoot]. - // - // Deprecated: You should use [pathrs.OpenatInRoot] directly instead. This - // wrapper will be removed in filepath-securejoin v0.6. - OpenatInRoot = pathrs.OpenatInRoot - - // Reopen is a wrapper around [pathrs.Reopen]. - // - // Deprecated: You should use [pathrs.Reopen] directly instead. This - // wrapper will be removed in filepath-securejoin v0.6. - Reopen = pathrs.Reopen -) diff --git a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/README.md b/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/README.md deleted file mode 100644 index 1be727e75..000000000 --- a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/README.md +++ /dev/null @@ -1,33 +0,0 @@ -## `pathrs-lite` ## - -`github.com/cyphar/filepath-securejoin/pathrs-lite` provides a minimal **pure -Go** implementation of the core bits of [libpathrs][]. This is not intended to -be a complete replacement for libpathrs, instead it is mainly intended to be -useful as a transition tool for existing Go projects. - -The long-term plan for `pathrs-lite` is to provide a build tag that will cause -all `pathrs-lite` operations to call into libpathrs directly, thus removing -code duplication for projects that wish to make use of libpathrs (and providing -the ability for software packagers to opt-in to libpathrs support without -needing to patch upstream). - -[libpathrs]: https://github.com/cyphar/libpathrs - -### License ### - -Most of this subpackage is licensed under the Mozilla Public License (version -2.0). For more information, see the top-level [COPYING.md][] and -[LICENSE.MPL-2.0][] files, as well as the individual license headers for each -file. - -``` -Copyright (C) 2024-2025 Aleksa Sarai -Copyright (C) 2024-2025 SUSE LLC - -This Source Code Form is subject to the terms of the Mozilla Public -License, v. 2.0. If a copy of the MPL was not distributed with this -file, You can obtain one at https://mozilla.org/MPL/2.0/. -``` - -[COPYING.md]: ../COPYING.md -[LICENSE.MPL-2.0]: ../LICENSE.MPL-2.0 diff --git a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/doc.go b/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/doc.go deleted file mode 100644 index d3d745175..000000000 --- a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/doc.go +++ /dev/null @@ -1,14 +0,0 @@ -// SPDX-License-Identifier: MPL-2.0 - -//go:build linux - -// Copyright (C) 2024-2025 Aleksa Sarai -// Copyright (C) 2024-2025 SUSE LLC -// -// This Source Code Form is subject to the terms of the Mozilla Public -// License, v. 2.0. If a copy of the MPL was not distributed with this -// file, You can obtain one at https://mozilla.org/MPL/2.0/. - -// Package pathrs (pathrs-lite) is a less complete pure Go implementation of -// some of the APIs provided by [libpathrs]. -package pathrs diff --git a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/assert/assert.go b/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/assert/assert.go deleted file mode 100644 index 595dfbf1a..000000000 --- a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/assert/assert.go +++ /dev/null @@ -1,30 +0,0 @@ -// SPDX-License-Identifier: MPL-2.0 - -// Copyright (C) 2025 Aleksa Sarai -// Copyright (C) 2025 SUSE LLC -// -// This Source Code Form is subject to the terms of the Mozilla Public -// License, v. 2.0. If a copy of the MPL was not distributed with this -// file, You can obtain one at https://mozilla.org/MPL/2.0/. - -// Package assert provides some basic assertion helpers for Go. -package assert - -import ( - "fmt" -) - -// Assert panics if the predicate is false with the provided argument. -func Assert(predicate bool, msg any) { - if !predicate { - panic(msg) - } -} - -// Assertf panics if the predicate is false and formats the message using the -// same formatting as [fmt.Printf]. -// -// [fmt.Printf]: https://pkg.go.dev/fmt#Printf -func Assertf(predicate bool, fmtMsg string, args ...any) { - Assert(predicate, fmt.Sprintf(fmtMsg, args...)) -} diff --git a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/errors_linux.go b/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/errors_linux.go deleted file mode 100644 index d0b200f4f..000000000 --- a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/errors_linux.go +++ /dev/null @@ -1,41 +0,0 @@ -// SPDX-License-Identifier: MPL-2.0 - -//go:build linux - -// Copyright (C) 2024-2025 Aleksa Sarai -// Copyright (C) 2024-2025 SUSE LLC -// -// This Source Code Form is subject to the terms of the Mozilla Public -// License, v. 2.0. If a copy of the MPL was not distributed with this -// file, You can obtain one at https://mozilla.org/MPL/2.0/. - -// Package internal contains unexported common code for filepath-securejoin. -package internal - -import ( - "errors" - - "golang.org/x/sys/unix" -) - -type xdevErrorish struct { - description string -} - -func (err xdevErrorish) Error() string { return err.description } -func (err xdevErrorish) Is(target error) bool { return target == unix.EXDEV } - -var ( - // ErrPossibleAttack indicates that some attack was detected. - ErrPossibleAttack error = xdevErrorish{"possible attack detected"} - - // ErrPossibleBreakout indicates that during an operation we ended up in a - // state that could be a breakout but we detected it. - ErrPossibleBreakout error = xdevErrorish{"possible breakout detected"} - - // ErrInvalidDirectory indicates an unlinked directory. - ErrInvalidDirectory = errors.New("wandered into deleted directory") - - // ErrDeletedInode indicates an unlinked file (non-directory). - ErrDeletedInode = errors.New("cannot verify path of deleted inode") -) diff --git a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/fd/at_linux.go b/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/fd/at_linux.go deleted file mode 100644 index 091054913..000000000 --- a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/fd/at_linux.go +++ /dev/null @@ -1,148 +0,0 @@ -// SPDX-License-Identifier: MPL-2.0 - -//go:build linux - -// Copyright (C) 2024-2025 Aleksa Sarai -// Copyright (C) 2024-2025 SUSE LLC -// -// This Source Code Form is subject to the terms of the Mozilla Public -// License, v. 2.0. If a copy of the MPL was not distributed with this -// file, You can obtain one at https://mozilla.org/MPL/2.0/. - -package fd - -import ( - "fmt" - "os" - "path/filepath" - "runtime" - - "golang.org/x/sys/unix" - - "github.com/cyphar/filepath-securejoin/pathrs-lite/internal/gocompat" -) - -// prepareAtWith returns -EBADF (an invalid fd) if dir is nil, otherwise using -// the dir.Fd(). We use -EBADF because in filepath-securejoin we generally -// don't want to allow relative-to-cwd paths. The returned path is an -// *informational* string that describes a reasonable pathname for the given -// *at(2) arguments. You must not use the full path for any actual filesystem -// operations. -func prepareAt(dir Fd, path string) (dirFd int, unsafeUnmaskedPath string) { - dirFd, dirPath := -int(unix.EBADF), "." - if dir != nil { - dirFd, dirPath = int(dir.Fd()), dir.Name() - } - if !filepath.IsAbs(path) { - // only prepend the dirfd path for relative paths - path = dirPath + "/" + path - } - // NOTE: If path is "." or "", the returned path won't be filepath.Clean, - // but that's okay since this path is either used for errors (in which case - // a trailing "/" or "/." is important information) or will be - // filepath.Clean'd later (in the case of fd.Openat). - return dirFd, path -} - -// Openat is an [Fd]-based wrapper around unix.Openat. -func Openat(dir Fd, path string, flags int, mode int) (*os.File, error) { //nolint:unparam // wrapper func - dirFd, fullPath := prepareAt(dir, path) - // Make sure we always set O_CLOEXEC. - flags |= unix.O_CLOEXEC - fd, err := unix.Openat(dirFd, path, flags, uint32(mode)) - if err != nil { - return nil, &os.PathError{Op: "openat", Path: fullPath, Err: err} - } - runtime.KeepAlive(dir) - // openat is only used with lexically-safe paths so we can use - // filepath.Clean here, and also the path itself is not going to be used - // for actual path operations. - fullPath = filepath.Clean(fullPath) - return os.NewFile(uintptr(fd), fullPath), nil -} - -// Fstatat is an [Fd]-based wrapper around unix.Fstatat. -func Fstatat(dir Fd, path string, flags int) (unix.Stat_t, error) { - dirFd, fullPath := prepareAt(dir, path) - var stat unix.Stat_t - if err := unix.Fstatat(dirFd, path, &stat, flags); err != nil { - return stat, &os.PathError{Op: "fstatat", Path: fullPath, Err: err} - } - runtime.KeepAlive(dir) - return stat, nil -} - -// Faccessat is an [Fd]-based wrapper around unix.Faccessat. -func Faccessat(dir Fd, path string, mode uint32, flags int) error { - dirFd, fullPath := prepareAt(dir, path) - err := unix.Faccessat(dirFd, path, mode, flags) - if err != nil { - err = &os.PathError{Op: "faccessat", Path: fullPath, Err: err} - } - runtime.KeepAlive(dir) - return err -} - -// Readlinkat is an [Fd]-based wrapper around unix.Readlinkat. -func Readlinkat(dir Fd, path string) (string, error) { - dirFd, fullPath := prepareAt(dir, path) - size := 4096 - for { - linkBuf := make([]byte, size) - n, err := unix.Readlinkat(dirFd, path, linkBuf) - if err != nil { - return "", &os.PathError{Op: "readlinkat", Path: fullPath, Err: err} - } - runtime.KeepAlive(dir) - if n != size { - return string(linkBuf[:n]), nil - } - // Possible truncation, resize the buffer. - size *= 2 - } -} - -const ( - // STATX_MNT_ID_UNIQUE is provided in golang.org/x/sys@v0.20.0, but in order to - // avoid bumping the requirement for a single constant we can just define it - // ourselves. - _STATX_MNT_ID_UNIQUE = 0x4000 //nolint:revive // unix.* name - - // We don't care which mount ID we get. The kernel will give us the unique - // one if it is supported. If the kernel doesn't support - // STATX_MNT_ID_UNIQUE, the bit is ignored and the returned request mask - // will only contain STATX_MNT_ID (if supported). - wantStatxMntMask = _STATX_MNT_ID_UNIQUE | unix.STATX_MNT_ID -) - -var hasStatxMountID = gocompat.SyncOnceValue(func() bool { - var stx unix.Statx_t - err := unix.Statx(-int(unix.EBADF), "/", 0, wantStatxMntMask, &stx) - return err == nil && stx.Mask&wantStatxMntMask != 0 -}) - -// GetMountID gets the mount identifier associated with the fd and path -// combination. It is effectively a wrapper around fetching -// STATX_MNT_ID{,_UNIQUE} with unix.Statx, but with a fallback to 0 if the -// kernel doesn't support the feature. -func GetMountID(dir Fd, path string) (uint64, error) { - // If we don't have statx(STATX_MNT_ID*) support, we can't do anything. - if !hasStatxMountID() { - return 0, nil - } - - dirFd, fullPath := prepareAt(dir, path) - - var stx unix.Statx_t - err := unix.Statx(dirFd, path, unix.AT_EMPTY_PATH|unix.AT_SYMLINK_NOFOLLOW, wantStatxMntMask, &stx) - if stx.Mask&wantStatxMntMask == 0 { - // It's not a kernel limitation, for some reason we couldn't get a - // mount ID. Assume it's some kind of attack. - err = fmt.Errorf("could not get mount id: %w", err) - } - if err != nil { - return 0, &os.PathError{Op: "statx(STATX_MNT_ID_...)", Path: fullPath, Err: err} - } - runtime.KeepAlive(dir) - return stx.Mnt_id, nil -} diff --git a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/fd/fd.go b/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/fd/fd.go deleted file mode 100644 index d2206a386..000000000 --- a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/fd/fd.go +++ /dev/null @@ -1,55 +0,0 @@ -// SPDX-License-Identifier: MPL-2.0 - -// Copyright (C) 2025 Aleksa Sarai -// Copyright (C) 2025 SUSE LLC -// -// This Source Code Form is subject to the terms of the Mozilla Public -// License, v. 2.0. If a copy of the MPL was not distributed with this -// file, You can obtain one at https://mozilla.org/MPL/2.0/. - -// Package fd provides a drop-in interface-based replacement of [*os.File] that -// allows for things like noop-Close wrappers to be used. -// -// [*os.File]: https://pkg.go.dev/os#File -package fd - -import ( - "io" - "os" -) - -// Fd is an interface that mirrors most of the API of [*os.File], allowing you -// to create wrappers that can be used in place of [*os.File]. -// -// [*os.File]: https://pkg.go.dev/os#File -type Fd interface { - io.Closer - Name() string - Fd() uintptr -} - -// Compile-time interface checks. -var ( - _ Fd = (*os.File)(nil) - _ Fd = noClose{} -) - -type noClose struct{ inner Fd } - -func (f noClose) Name() string { return f.inner.Name() } -func (f noClose) Fd() uintptr { return f.inner.Fd() } - -func (f noClose) Close() error { return nil } - -// NopCloser returns an [*os.File]-like object where the [Close] method is now -// a no-op. -// -// Note that for [*os.File] and similar objects, the Go garbage collector will -// still call [Close] on the underlying file unless you use -// [runtime.SetFinalizer] to disable this behaviour. This is up to the caller -// to do (if necessary). -// -// [*os.File]: https://pkg.go.dev/os#File -// [Close]: https://pkg.go.dev/io#Closer -// [runtime.SetFinalizer]: https://pkg.go.dev/runtime#SetFinalizer -func NopCloser(f Fd) Fd { return noClose{inner: f} } diff --git a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/fd/fd_linux.go b/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/fd/fd_linux.go deleted file mode 100644 index e1ec3c0b8..000000000 --- a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/fd/fd_linux.go +++ /dev/null @@ -1,78 +0,0 @@ -// SPDX-License-Identifier: MPL-2.0 - -//go:build linux - -// Copyright (C) 2024-2025 Aleksa Sarai -// Copyright (C) 2024-2025 SUSE LLC -// -// This Source Code Form is subject to the terms of the Mozilla Public -// License, v. 2.0. If a copy of the MPL was not distributed with this -// file, You can obtain one at https://mozilla.org/MPL/2.0/. - -package fd - -import ( - "fmt" - "os" - "runtime" - - "golang.org/x/sys/unix" - - "github.com/cyphar/filepath-securejoin/pathrs-lite/internal" -) - -// DupWithName creates a new file descriptor referencing the same underlying -// file, but with the provided name instead of fd.Name(). -func DupWithName(fd Fd, name string) (*os.File, error) { - fd2, err := unix.FcntlInt(fd.Fd(), unix.F_DUPFD_CLOEXEC, 0) - if err != nil { - return nil, os.NewSyscallError("fcntl(F_DUPFD_CLOEXEC)", err) - } - runtime.KeepAlive(fd) - return os.NewFile(uintptr(fd2), name), nil -} - -// Dup creates a new file description referencing the same underlying file. -func Dup(fd Fd) (*os.File, error) { - return DupWithName(fd, fd.Name()) -} - -// Fstat is an [Fd]-based wrapper around unix.Fstat. -func Fstat(fd Fd) (unix.Stat_t, error) { - var stat unix.Stat_t - if err := unix.Fstat(int(fd.Fd()), &stat); err != nil { - return stat, &os.PathError{Op: "fstat", Path: fd.Name(), Err: err} - } - runtime.KeepAlive(fd) - return stat, nil -} - -// Fstatfs is an [Fd]-based wrapper around unix.Fstatfs. -func Fstatfs(fd Fd) (unix.Statfs_t, error) { - var statfs unix.Statfs_t - if err := unix.Fstatfs(int(fd.Fd()), &statfs); err != nil { - return statfs, &os.PathError{Op: "fstatfs", Path: fd.Name(), Err: err} - } - runtime.KeepAlive(fd) - return statfs, nil -} - -// IsDeadInode detects whether the file has been unlinked from a filesystem and -// is thus a "dead inode" from the kernel's perspective. -func IsDeadInode(file Fd) error { - // If the nlink of a file drops to 0, there is an attacker deleting - // directories during our walk, which could result in weird /proc values. - // It's better to error out in this case. - stat, err := Fstat(file) - if err != nil { - return fmt.Errorf("check for dead inode: %w", err) - } - if stat.Nlink == 0 { - err := internal.ErrDeletedInode - if stat.Mode&unix.S_IFMT == unix.S_IFDIR { - err = internal.ErrInvalidDirectory - } - return fmt.Errorf("%w %q", err, file.Name()) - } - return nil -} diff --git a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/fd/mount_linux.go b/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/fd/mount_linux.go deleted file mode 100644 index 77549c7a9..000000000 --- a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/fd/mount_linux.go +++ /dev/null @@ -1,54 +0,0 @@ -// SPDX-License-Identifier: MPL-2.0 - -//go:build linux - -// Copyright (C) 2024-2025 Aleksa Sarai -// Copyright (C) 2024-2025 SUSE LLC -// -// This Source Code Form is subject to the terms of the Mozilla Public -// License, v. 2.0. If a copy of the MPL was not distributed with this -// file, You can obtain one at https://mozilla.org/MPL/2.0/. - -package fd - -import ( - "os" - "runtime" - - "golang.org/x/sys/unix" -) - -// Fsopen is an [Fd]-based wrapper around unix.Fsopen. -func Fsopen(fsName string, flags int) (*os.File, error) { - // Make sure we always set O_CLOEXEC. - flags |= unix.FSOPEN_CLOEXEC - fd, err := unix.Fsopen(fsName, flags) - if err != nil { - return nil, os.NewSyscallError("fsopen "+fsName, err) - } - return os.NewFile(uintptr(fd), "fscontext:"+fsName), nil -} - -// Fsmount is an [Fd]-based wrapper around unix.Fsmount. -func Fsmount(ctx Fd, flags, mountAttrs int) (*os.File, error) { - // Make sure we always set O_CLOEXEC. - flags |= unix.FSMOUNT_CLOEXEC - fd, err := unix.Fsmount(int(ctx.Fd()), flags, mountAttrs) - if err != nil { - return nil, os.NewSyscallError("fsmount "+ctx.Name(), err) - } - return os.NewFile(uintptr(fd), "fsmount:"+ctx.Name()), nil -} - -// OpenTree is an [Fd]-based wrapper around unix.OpenTree. -func OpenTree(dir Fd, path string, flags uint) (*os.File, error) { - dirFd, fullPath := prepareAt(dir, path) - // Make sure we always set O_CLOEXEC. - flags |= unix.OPEN_TREE_CLOEXEC - fd, err := unix.OpenTree(dirFd, path, flags) - if err != nil { - return nil, &os.PathError{Op: "open_tree", Path: fullPath, Err: err} - } - runtime.KeepAlive(dir) - return os.NewFile(uintptr(fd), fullPath), nil -} diff --git a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/fd/openat2_linux.go b/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/fd/openat2_linux.go deleted file mode 100644 index 3e937fe3c..000000000 --- a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/fd/openat2_linux.go +++ /dev/null @@ -1,62 +0,0 @@ -// SPDX-License-Identifier: MPL-2.0 - -//go:build linux - -// Copyright (C) 2024-2025 Aleksa Sarai -// Copyright (C) 2024-2025 SUSE LLC -// -// This Source Code Form is subject to the terms of the Mozilla Public -// License, v. 2.0. If a copy of the MPL was not distributed with this -// file, You can obtain one at https://mozilla.org/MPL/2.0/. - -package fd - -import ( - "errors" - "os" - "runtime" - - "golang.org/x/sys/unix" -) - -func scopedLookupShouldRetry(how *unix.OpenHow, err error) bool { - // RESOLVE_IN_ROOT (and RESOLVE_BENEATH) can return -EAGAIN if we resolve - // ".." while a mount or rename occurs anywhere on the system. This could - // happen spuriously, or as the result of an attacker trying to mess with - // us during lookup. - // - // In addition, scoped lookups have a "safety check" at the end of - // complete_walk which will return -EXDEV if the final path is not in the - // root. - return how.Resolve&(unix.RESOLVE_IN_ROOT|unix.RESOLVE_BENEATH) != 0 && - (errors.Is(err, unix.EAGAIN) || errors.Is(err, unix.EXDEV)) -} - -// This is a fairly arbitrary limit we have just to avoid an attacker being -// able to make us spin in an infinite retry loop -- callers can choose to -// retry on EAGAIN if they prefer. -const scopedLookupMaxRetries = 128 - -// Openat2 is an [Fd]-based wrapper around unix.Openat2, but with some retry -// logic in case of EAGAIN errors. -func Openat2(dir Fd, path string, how *unix.OpenHow) (*os.File, error) { - dirFd, fullPath := prepareAt(dir, path) - // Make sure we always set O_CLOEXEC. - how.Flags |= unix.O_CLOEXEC - var tries int - for { - fd, err := unix.Openat2(dirFd, path, how) - if err != nil { - if scopedLookupShouldRetry(how, err) && tries < scopedLookupMaxRetries { - // We retry a couple of times to avoid the spurious errors, and - // if we are being attacked then returning -EAGAIN is the best - // we can do. - tries++ - continue - } - return nil, &os.PathError{Op: "openat2", Path: fullPath, Err: err} - } - runtime.KeepAlive(dir) - return os.NewFile(uintptr(fd), fullPath), nil - } -} diff --git a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/gocompat/README.md b/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/gocompat/README.md deleted file mode 100644 index 5dcb6ae00..000000000 --- a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/gocompat/README.md +++ /dev/null @@ -1,10 +0,0 @@ -## gocompat ## - -This directory contains backports of stdlib functions from later Go versions so -the filepath-securejoin can continue to be used by projects that are stuck with -Go 1.18 support. Note that often filepath-securejoin is added in security -patches for old releases, so avoiding the need to bump Go compiler requirements -is a huge plus to downstreams. - -The source code is licensed under the same license as the Go stdlib. See the -source files for the precise license information. diff --git a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/gocompat/doc.go b/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/gocompat/doc.go deleted file mode 100644 index 4b1803f58..000000000 --- a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/gocompat/doc.go +++ /dev/null @@ -1,13 +0,0 @@ -// SPDX-License-Identifier: BSD-3-Clause -//go:build linux && go1.20 - -// Copyright (C) 2025 SUSE LLC. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// Package gocompat includes compatibility shims (backported from future Go -// stdlib versions) to permit filepath-securejoin to be used with older Go -// versions (often filepath-securejoin is added in security patches for old -// releases, so avoiding the need to bump Go compiler requirements is a huge -// plus to downstreams). -package gocompat diff --git a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/gocompat/gocompat_errors_go120.go b/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/gocompat/gocompat_errors_go120.go deleted file mode 100644 index 4a114bd3d..000000000 --- a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/gocompat/gocompat_errors_go120.go +++ /dev/null @@ -1,19 +0,0 @@ -// SPDX-License-Identifier: BSD-3-Clause -//go:build linux && go1.20 - -// Copyright (C) 2024 SUSE LLC. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package gocompat - -import ( - "fmt" -) - -// WrapBaseError is a helper that is equivalent to fmt.Errorf("%w: %w"), except -// that on pre-1.20 Go versions only errors.Is() works properly (errors.Unwrap) -// is only guaranteed to give you baseErr. -func WrapBaseError(baseErr, extraErr error) error { - return fmt.Errorf("%w: %w", extraErr, baseErr) -} diff --git a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/gocompat/gocompat_errors_unsupported.go b/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/gocompat/gocompat_errors_unsupported.go deleted file mode 100644 index 3061016a6..000000000 --- a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/gocompat/gocompat_errors_unsupported.go +++ /dev/null @@ -1,40 +0,0 @@ -// SPDX-License-Identifier: BSD-3-Clause - -//go:build linux && !go1.20 - -// Copyright (C) 2024 SUSE LLC. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package gocompat - -import ( - "fmt" -) - -type wrappedError struct { - inner error - isError error -} - -func (err wrappedError) Is(target error) bool { - return err.isError == target -} - -func (err wrappedError) Unwrap() error { - return err.inner -} - -func (err wrappedError) Error() string { - return fmt.Sprintf("%v: %v", err.isError, err.inner) -} - -// WrapBaseError is a helper that is equivalent to fmt.Errorf("%w: %w"), except -// that on pre-1.20 Go versions only errors.Is() works properly (errors.Unwrap) -// is only guaranteed to give you baseErr. -func WrapBaseError(baseErr, extraErr error) error { - return wrappedError{ - inner: baseErr, - isError: extraErr, - } -} diff --git a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/gocompat/gocompat_generics_go121.go b/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/gocompat/gocompat_generics_go121.go deleted file mode 100644 index d4a938186..000000000 --- a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/gocompat/gocompat_generics_go121.go +++ /dev/null @@ -1,53 +0,0 @@ -// SPDX-License-Identifier: BSD-3-Clause - -//go:build linux && go1.21 - -// Copyright (C) 2024-2025 SUSE LLC. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package gocompat - -import ( - "cmp" - "slices" - "sync" -) - -// SlicesDeleteFunc is equivalent to Go 1.21's slices.DeleteFunc. -func SlicesDeleteFunc[S ~[]E, E any](slice S, delFn func(E) bool) S { - return slices.DeleteFunc(slice, delFn) -} - -// SlicesContains is equivalent to Go 1.21's slices.Contains. -func SlicesContains[S ~[]E, E comparable](slice S, val E) bool { - return slices.Contains(slice, val) -} - -// SlicesClone is equivalent to Go 1.21's slices.Clone. -func SlicesClone[S ~[]E, E any](slice S) S { - return slices.Clone(slice) -} - -// SyncOnceValue is equivalent to Go 1.21's sync.OnceValue. -func SyncOnceValue[T any](f func() T) func() T { - return sync.OnceValue(f) -} - -// SyncOnceValues is equivalent to Go 1.21's sync.OnceValues. -func SyncOnceValues[T1, T2 any](f func() (T1, T2)) func() (T1, T2) { - return sync.OnceValues(f) -} - -// CmpOrdered is equivalent to Go 1.21's cmp.Ordered generic type definition. -type CmpOrdered = cmp.Ordered - -// CmpCompare is equivalent to Go 1.21's cmp.Compare. -func CmpCompare[T CmpOrdered](x, y T) int { - return cmp.Compare(x, y) -} - -// Max2 is equivalent to Go 1.21's max builtin (but only for two parameters). -func Max2[T CmpOrdered](x, y T) T { - return max(x, y) -} diff --git a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/gocompat/gocompat_generics_unsupported.go b/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/gocompat/gocompat_generics_unsupported.go deleted file mode 100644 index 0ea6218aa..000000000 --- a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/gocompat/gocompat_generics_unsupported.go +++ /dev/null @@ -1,187 +0,0 @@ -// SPDX-License-Identifier: BSD-3-Clause - -//go:build linux && !go1.21 - -// Copyright (C) 2021, 2022 The Go Authors. All rights reserved. -// Copyright (C) 2024-2025 SUSE LLC. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE.BSD file. - -package gocompat - -import ( - "sync" -) - -// These are very minimal implementations of functions that appear in Go 1.21's -// stdlib, included so that we can build on older Go versions. Most are -// borrowed directly from the stdlib, and a few are modified to be "obviously -// correct" without needing to copy too many other helpers. - -// clearSlice is equivalent to Go 1.21's builtin clear. -// Copied from the Go 1.24 stdlib implementation. -func clearSlice[S ~[]E, E any](slice S) { - var zero E - for i := range slice { - slice[i] = zero - } -} - -// slicesIndexFunc is equivalent to Go 1.21's slices.IndexFunc. -// Copied from the Go 1.24 stdlib implementation. -func slicesIndexFunc[S ~[]E, E any](s S, f func(E) bool) int { - for i := range s { - if f(s[i]) { - return i - } - } - return -1 -} - -// SlicesDeleteFunc is equivalent to Go 1.21's slices.DeleteFunc. -// Copied from the Go 1.24 stdlib implementation. -func SlicesDeleteFunc[S ~[]E, E any](s S, del func(E) bool) S { - i := slicesIndexFunc(s, del) - if i == -1 { - return s - } - // Don't start copying elements until we find one to delete. - for j := i + 1; j < len(s); j++ { - if v := s[j]; !del(v) { - s[i] = v - i++ - } - } - clearSlice(s[i:]) // zero/nil out the obsolete elements, for GC - return s[:i] -} - -// SlicesContains is equivalent to Go 1.21's slices.Contains. -// Similar to the stdlib slices.Contains, except that we don't have -// slices.Index so we need to use slices.IndexFunc for this non-Func helper. -func SlicesContains[S ~[]E, E comparable](s S, v E) bool { - return slicesIndexFunc(s, func(e E) bool { return e == v }) >= 0 -} - -// SlicesClone is equivalent to Go 1.21's slices.Clone. -// Copied from the Go 1.24 stdlib implementation. -func SlicesClone[S ~[]E, E any](s S) S { - // Preserve nil in case it matters. - if s == nil { - return nil - } - return append(S([]E{}), s...) -} - -// SyncOnceValue is equivalent to Go 1.21's sync.OnceValue. -// Copied from the Go 1.25 stdlib implementation. -func SyncOnceValue[T any](f func() T) func() T { - // Use a struct so that there's a single heap allocation. - d := struct { - f func() T - once sync.Once - valid bool - p any - result T - }{ - f: f, - } - return func() T { - d.once.Do(func() { - defer func() { - d.f = nil - d.p = recover() - if !d.valid { - panic(d.p) - } - }() - d.result = d.f() - d.valid = true - }) - if !d.valid { - panic(d.p) - } - return d.result - } -} - -// SyncOnceValues is equivalent to Go 1.21's sync.OnceValues. -// Copied from the Go 1.25 stdlib implementation. -func SyncOnceValues[T1, T2 any](f func() (T1, T2)) func() (T1, T2) { - // Use a struct so that there's a single heap allocation. - d := struct { - f func() (T1, T2) - once sync.Once - valid bool - p any - r1 T1 - r2 T2 - }{ - f: f, - } - return func() (T1, T2) { - d.once.Do(func() { - defer func() { - d.f = nil - d.p = recover() - if !d.valid { - panic(d.p) - } - }() - d.r1, d.r2 = d.f() - d.valid = true - }) - if !d.valid { - panic(d.p) - } - return d.r1, d.r2 - } -} - -// CmpOrdered is equivalent to Go 1.21's cmp.Ordered generic type definition. -// Copied from the Go 1.25 stdlib implementation. -type CmpOrdered interface { - ~int | ~int8 | ~int16 | ~int32 | ~int64 | - ~uint | ~uint8 | ~uint16 | ~uint32 | ~uint64 | ~uintptr | - ~float32 | ~float64 | - ~string -} - -// isNaN reports whether x is a NaN without requiring the math package. -// This will always return false if T is not floating-point. -// Copied from the Go 1.25 stdlib implementation. -func isNaN[T CmpOrdered](x T) bool { - return x != x -} - -// CmpCompare is equivalent to Go 1.21's cmp.Compare. -// Copied from the Go 1.25 stdlib implementation. -func CmpCompare[T CmpOrdered](x, y T) int { - xNaN := isNaN(x) - yNaN := isNaN(y) - if xNaN { - if yNaN { - return 0 - } - return -1 - } - if yNaN { - return +1 - } - if x < y { - return -1 - } - if x > y { - return +1 - } - return 0 -} - -// Max2 is equivalent to Go 1.21's max builtin for two parameters. -func Max2[T CmpOrdered](x, y T) T { - m := x - if y > m { - m = y - } - return m -} diff --git a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/kernelversion/kernel_linux.go b/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/kernelversion/kernel_linux.go deleted file mode 100644 index cb6de4186..000000000 --- a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/kernelversion/kernel_linux.go +++ /dev/null @@ -1,123 +0,0 @@ -// SPDX-License-Identifier: BSD-3-Clause - -// Copyright (C) 2022 The Go Authors. All rights reserved. -// Copyright (C) 2025 SUSE LLC. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE.BSD file. - -// The parsing logic is very loosely based on the Go stdlib's -// src/internal/syscall/unix/kernel_version_linux.go but with an API that looks -// a bit like runc's libcontainer/system/kernelversion. -// -// TODO(cyphar): This API has been copied around to a lot of different projects -// (Docker, containerd, runc, and now filepath-securejoin) -- maybe we should -// put it in a separate project? - -// Package kernelversion provides a simple mechanism for checking whether the -// running kernel is at least as new as some baseline kernel version. This is -// often useful when checking for features that would be too complicated to -// test support for (or in cases where we know that some kernel features in -// backport-heavy kernels are broken and need to be avoided). -package kernelversion - -import ( - "bytes" - "errors" - "fmt" - "strconv" - "strings" - - "golang.org/x/sys/unix" - - "github.com/cyphar/filepath-securejoin/pathrs-lite/internal/gocompat" -) - -// KernelVersion is a numeric representation of the key numerical elements of a -// kernel version (for instance, "4.1.2-default-1" would be represented as -// KernelVersion{4, 1, 2}). -type KernelVersion []uint64 - -func (kver KernelVersion) String() string { - var str strings.Builder - for idx, elem := range kver { - if idx != 0 { - _, _ = str.WriteRune('.') - } - _, _ = str.WriteString(strconv.FormatUint(elem, 10)) - } - return str.String() -} - -var errInvalidKernelVersion = errors.New("invalid kernel version") - -// parseKernelVersion parses a string and creates a KernelVersion based on it. -func parseKernelVersion(kverStr string) (KernelVersion, error) { - kver := make(KernelVersion, 1, 3) - for idx, ch := range kverStr { - if '0' <= ch && ch <= '9' { - v := &kver[len(kver)-1] - *v = (*v * 10) + uint64(ch-'0') - } else { - if idx == 0 || kverStr[idx-1] < '0' || '9' < kverStr[idx-1] { - // "." must be preceded by a digit while in version section - return nil, fmt.Errorf("%w %q: kernel version has dot(s) followed by non-digit in version section", errInvalidKernelVersion, kverStr) - } - if ch != '.' { - break - } - kver = append(kver, 0) - } - } - if len(kver) < 2 { - return nil, fmt.Errorf("%w %q: kernel versions must contain at least two components", errInvalidKernelVersion, kverStr) - } - return kver, nil -} - -// getKernelVersion gets the current kernel version. -var getKernelVersion = gocompat.SyncOnceValues(func() (KernelVersion, error) { - var uts unix.Utsname - if err := unix.Uname(&uts); err != nil { - return nil, err - } - // Remove the \x00 from the release. - release := uts.Release[:] - return parseKernelVersion(string(release[:bytes.IndexByte(release, 0)])) -}) - -// GreaterEqualThan returns true if the the host kernel version is greater than -// or equal to the provided [KernelVersion]. When doing this comparison, any -// non-numerical suffixes of the host kernel version are ignored. -// -// If the number of components provided is not equal to the number of numerical -// components of the host kernel version, any missing components are treated as -// 0. This means that GreaterEqualThan(KernelVersion{4}) will be treated the -// same as GreaterEqualThan(KernelVersion{4, 0, 0, ..., 0, 0}), and that if the -// host kernel version is "4" then GreaterEqualThan(KernelVersion{4, 1}) will -// return false (because the host version will be treated as "4.0"). -func GreaterEqualThan(wantKver KernelVersion) (bool, error) { - hostKver, err := getKernelVersion() - if err != nil { - return false, err - } - - // Pad out the kernel version lengths to match one another. - cmpLen := gocompat.Max2(len(hostKver), len(wantKver)) - hostKver = append(hostKver, make(KernelVersion, cmpLen-len(hostKver))...) - wantKver = append(wantKver, make(KernelVersion, cmpLen-len(wantKver))...) - - for i := 0; i < cmpLen; i++ { - switch gocompat.CmpCompare(hostKver[i], wantKver[i]) { - case -1: - // host < want - return false, nil - case +1: - // host > want - return true, nil - case 0: - continue - } - } - // equal version values - return true, nil -} diff --git a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/linux/doc.go b/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/linux/doc.go deleted file mode 100644 index 4635714f6..000000000 --- a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/linux/doc.go +++ /dev/null @@ -1,12 +0,0 @@ -// SPDX-License-Identifier: MPL-2.0 - -// Copyright (C) 2024-2025 Aleksa Sarai -// Copyright (C) 2024-2025 SUSE LLC -// -// This Source Code Form is subject to the terms of the Mozilla Public -// License, v. 2.0. If a copy of the MPL was not distributed with this -// file, You can obtain one at https://mozilla.org/MPL/2.0/. - -// Package linux returns information about what features are supported on the -// running kernel. -package linux diff --git a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/linux/mount_linux.go b/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/linux/mount_linux.go deleted file mode 100644 index b29905bff..000000000 --- a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/linux/mount_linux.go +++ /dev/null @@ -1,47 +0,0 @@ -// SPDX-License-Identifier: MPL-2.0 - -//go:build linux - -// Copyright (C) 2024-2025 Aleksa Sarai -// Copyright (C) 2024-2025 SUSE LLC -// -// This Source Code Form is subject to the terms of the Mozilla Public -// License, v. 2.0. If a copy of the MPL was not distributed with this -// file, You can obtain one at https://mozilla.org/MPL/2.0/. - -package linux - -import ( - "golang.org/x/sys/unix" - - "github.com/cyphar/filepath-securejoin/pathrs-lite/internal/gocompat" - "github.com/cyphar/filepath-securejoin/pathrs-lite/internal/kernelversion" -) - -// HasNewMountAPI returns whether the new fsopen(2) mount API is supported on -// the running kernel. -var HasNewMountAPI = gocompat.SyncOnceValue(func() bool { - // All of the pieces of the new mount API we use (fsopen, fsconfig, - // fsmount, open_tree) were added together in Linux 5.2[1,2], so we can - // just check for one of the syscalls and the others should also be - // available. - // - // Just try to use open_tree(2) to open a file without OPEN_TREE_CLONE. - // This is equivalent to openat(2), but tells us if open_tree is - // available (and thus all of the other basic new mount API syscalls). - // open_tree(2) is most light-weight syscall to test here. - // - // [1]: merge commit 400913252d09 - // [2]: - fd, err := unix.OpenTree(-int(unix.EBADF), "/", unix.OPEN_TREE_CLOEXEC) - if err != nil { - return false - } - _ = unix.Close(fd) - - // RHEL 8 has a backport of fsopen(2) that appears to have some very - // difficult to debug performance pathology. As such, it seems prudent to - // simply reject pre-5.2 kernels. - isNotBackport, _ := kernelversion.GreaterEqualThan(kernelversion.KernelVersion{5, 2}) - return isNotBackport -}) diff --git a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/linux/openat2_linux.go b/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/linux/openat2_linux.go deleted file mode 100644 index 399609dc3..000000000 --- a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/linux/openat2_linux.go +++ /dev/null @@ -1,31 +0,0 @@ -// SPDX-License-Identifier: MPL-2.0 - -//go:build linux - -// Copyright (C) 2024-2025 Aleksa Sarai -// Copyright (C) 2024-2025 SUSE LLC -// -// This Source Code Form is subject to the terms of the Mozilla Public -// License, v. 2.0. If a copy of the MPL was not distributed with this -// file, You can obtain one at https://mozilla.org/MPL/2.0/. - -package linux - -import ( - "golang.org/x/sys/unix" - - "github.com/cyphar/filepath-securejoin/pathrs-lite/internal/gocompat" -) - -// HasOpenat2 returns whether openat2(2) is supported on the running kernel. -var HasOpenat2 = gocompat.SyncOnceValue(func() bool { - fd, err := unix.Openat2(unix.AT_FDCWD, ".", &unix.OpenHow{ - Flags: unix.O_PATH | unix.O_CLOEXEC, - Resolve: unix.RESOLVE_NO_SYMLINKS | unix.RESOLVE_IN_ROOT, - }) - if err != nil { - return false - } - _ = unix.Close(fd) - return true -}) diff --git a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/procfs/procfs_linux.go b/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/procfs/procfs_linux.go deleted file mode 100644 index 21e0a62e8..000000000 --- a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/procfs/procfs_linux.go +++ /dev/null @@ -1,544 +0,0 @@ -// SPDX-License-Identifier: MPL-2.0 - -//go:build linux - -// Copyright (C) 2024-2025 Aleksa Sarai -// Copyright (C) 2024-2025 SUSE LLC -// -// This Source Code Form is subject to the terms of the Mozilla Public -// License, v. 2.0. If a copy of the MPL was not distributed with this -// file, You can obtain one at https://mozilla.org/MPL/2.0/. - -// Package procfs provides a safe API for operating on /proc on Linux. Note -// that this is the *internal* procfs API, mainy needed due to Go's -// restrictions on cyclic dependencies and its incredibly minimal visibility -// system without making a separate internal/ package. -package procfs - -import ( - "errors" - "fmt" - "io" - "os" - "runtime" - "strconv" - - "golang.org/x/sys/unix" - - "github.com/cyphar/filepath-securejoin/pathrs-lite/internal" - "github.com/cyphar/filepath-securejoin/pathrs-lite/internal/assert" - "github.com/cyphar/filepath-securejoin/pathrs-lite/internal/fd" - "github.com/cyphar/filepath-securejoin/pathrs-lite/internal/gocompat" - "github.com/cyphar/filepath-securejoin/pathrs-lite/internal/linux" -) - -// The kernel guarantees that the root inode of a procfs mount has an -// f_type of PROC_SUPER_MAGIC and st_ino of PROC_ROOT_INO. -const ( - procSuperMagic = 0x9fa0 // PROC_SUPER_MAGIC - procRootIno = 1 // PROC_ROOT_INO -) - -// verifyProcHandle checks that the handle is from a procfs filesystem. -// Contrast this to [verifyProcRoot], which also verifies that the handle is -// the root of a procfs mount. -func verifyProcHandle(procHandle fd.Fd) error { - if statfs, err := fd.Fstatfs(procHandle); err != nil { - return err - } else if statfs.Type != procSuperMagic { - return fmt.Errorf("%w: incorrect procfs root filesystem type 0x%x", errUnsafeProcfs, statfs.Type) - } - return nil -} - -// verifyProcRoot verifies that the handle is the root of a procfs filesystem. -// Contrast this to [verifyProcHandle], which only verifies if the handle is -// some file on procfs (regardless of what file it is). -func verifyProcRoot(procRoot fd.Fd) error { - if err := verifyProcHandle(procRoot); err != nil { - return err - } - if stat, err := fd.Fstat(procRoot); err != nil { - return err - } else if stat.Ino != procRootIno { - return fmt.Errorf("%w: incorrect procfs root inode number %d", errUnsafeProcfs, stat.Ino) - } - return nil -} - -type procfsFeatures struct { - // hasSubsetPid was added in Linux 5.8, along with hidepid=ptraceable (and - // string-based hidepid= values). Before this patchset, it was not really - // safe to try to modify procfs superblock flags because the superblock was - // shared -- so if this feature is not available, **you should not set any - // superblock flags**. - // - // 6814ef2d992a ("proc: add option to mount only a pids subset") - // fa10fed30f25 ("proc: allow to mount many instances of proc in one pid namespace") - // 24a71ce5c47f ("proc: instantiate only pids that we can ptrace on 'hidepid=4' mount option") - // 1c6c4d112e81 ("proc: use human-readable values for hidepid") - // 9ff7258575d5 ("Merge branch 'proc-linus' of git://git.kernel.org/pub/scm/linux/kernel/git/ebiederm/user-namespace") - hasSubsetPid bool -} - -var getProcfsFeatures = gocompat.SyncOnceValue(func() procfsFeatures { - if !linux.HasNewMountAPI() { - return procfsFeatures{} - } - procfsCtx, err := fd.Fsopen("proc", unix.FSOPEN_CLOEXEC) - if err != nil { - return procfsFeatures{} - } - defer procfsCtx.Close() //nolint:errcheck // close failures aren't critical here - - return procfsFeatures{ - hasSubsetPid: unix.FsconfigSetString(int(procfsCtx.Fd()), "subset", "pid") == nil, - } -}) - -func newPrivateProcMount(subset bool) (_ *Handle, Err error) { - procfsCtx, err := fd.Fsopen("proc", unix.FSOPEN_CLOEXEC) - if err != nil { - return nil, err - } - defer procfsCtx.Close() //nolint:errcheck // close failures aren't critical here - - if subset && getProcfsFeatures().hasSubsetPid { - // Try to configure hidepid=ptraceable,subset=pid if possible, but - // ignore errors. - _ = unix.FsconfigSetString(int(procfsCtx.Fd()), "hidepid", "ptraceable") - _ = unix.FsconfigSetString(int(procfsCtx.Fd()), "subset", "pid") - } - - // Get an actual handle. - if err := unix.FsconfigCreate(int(procfsCtx.Fd())); err != nil { - return nil, os.NewSyscallError("fsconfig create procfs", err) - } - // TODO: Output any information from the fscontext log to debug logs. - procRoot, err := fd.Fsmount(procfsCtx, unix.FSMOUNT_CLOEXEC, unix.MS_NODEV|unix.MS_NOEXEC|unix.MS_NOSUID) - if err != nil { - return nil, err - } - defer func() { - if Err != nil { - _ = procRoot.Close() - } - }() - return newHandle(procRoot) -} - -func clonePrivateProcMount() (_ *Handle, Err error) { - // Try to make a clone without using AT_RECURSIVE if we can. If this works, - // we can be sure there are no over-mounts and so if the root is valid then - // we're golden. Otherwise, we have to deal with over-mounts. - procRoot, err := fd.OpenTree(nil, "/proc", unix.OPEN_TREE_CLONE) - if err != nil || hookForcePrivateProcRootOpenTreeAtRecursive(procRoot) { - procRoot, err = fd.OpenTree(nil, "/proc", unix.OPEN_TREE_CLONE|unix.AT_RECURSIVE) - } - if err != nil { - return nil, fmt.Errorf("creating a detached procfs clone: %w", err) - } - defer func() { - if Err != nil { - _ = procRoot.Close() - } - }() - return newHandle(procRoot) -} - -func privateProcRoot(subset bool) (*Handle, error) { - if !linux.HasNewMountAPI() || hookForceGetProcRootUnsafe() { - return nil, fmt.Errorf("new mount api: %w", unix.ENOTSUP) - } - // Try to create a new procfs mount from scratch if we can. This ensures we - // can get a procfs mount even if /proc is fake (for whatever reason). - procRoot, err := newPrivateProcMount(subset) - if err != nil || hookForcePrivateProcRootOpenTree(procRoot) { - // Try to clone /proc then... - procRoot, err = clonePrivateProcMount() - } - return procRoot, err -} - -func unsafeHostProcRoot() (_ *Handle, Err error) { - procRoot, err := os.OpenFile("/proc", unix.O_PATH|unix.O_NOFOLLOW|unix.O_DIRECTORY|unix.O_CLOEXEC, 0) - if err != nil { - return nil, err - } - defer func() { - if Err != nil { - _ = procRoot.Close() - } - }() - return newHandle(procRoot) -} - -// Handle is a wrapper around an *os.File handle to "/proc", which can be used -// to do further procfs-related operations in a safe way. -type Handle struct { - Inner fd.Fd - // Does this handle have subset=pid set? - isSubset bool -} - -func newHandle(procRoot fd.Fd) (*Handle, error) { - if err := verifyProcRoot(procRoot); err != nil { - // This is only used in methods that - _ = procRoot.Close() - return nil, err - } - proc := &Handle{Inner: procRoot} - // With subset=pid we can be sure that /proc/uptime will not exist. - if err := fd.Faccessat(proc.Inner, "uptime", unix.F_OK, unix.AT_SYMLINK_NOFOLLOW); err != nil { - proc.isSubset = errors.Is(err, os.ErrNotExist) - } - return proc, nil -} - -// Close closes the underlying file for the Handle. -func (proc *Handle) Close() error { return proc.Inner.Close() } - -var getCachedProcRoot = gocompat.SyncOnceValue(func() *Handle { - procRoot, err := getProcRoot(true) - if err != nil { - return nil // just don't cache if we see an error - } - if !procRoot.isSubset { - return nil // we only cache verified subset=pid handles - } - - // Disarm (*Handle).Close() to stop someone from accidentally closing - // the global handle. - procRoot.Inner = fd.NopCloser(procRoot.Inner) - return procRoot -}) - -// OpenProcRoot tries to open a "safer" handle to "/proc". -func OpenProcRoot() (*Handle, error) { - if proc := getCachedProcRoot(); proc != nil { - return proc, nil - } - return getProcRoot(true) -} - -// OpenUnsafeProcRoot opens a handle to "/proc" without any overmounts or -// masked paths (but also without "subset=pid"). -func OpenUnsafeProcRoot() (*Handle, error) { return getProcRoot(false) } - -func getProcRoot(subset bool) (*Handle, error) { - proc, err := privateProcRoot(subset) - if err != nil { - // Fall back to using a /proc handle if making a private mount failed. - // If we have openat2, at least we can avoid some kinds of over-mount - // attacks, but without openat2 there's not much we can do. - proc, err = unsafeHostProcRoot() - } - return proc, err -} - -var hasProcThreadSelf = gocompat.SyncOnceValue(func() bool { - return unix.Access("/proc/thread-self/", unix.F_OK) == nil -}) - -var errUnsafeProcfs = errors.New("unsafe procfs detected") - -// lookup is a very minimal wrapper around [procfsLookupInRoot] which is -// intended to be called from the external API. -func (proc *Handle) lookup(subpath string) (*os.File, error) { - handle, err := procfsLookupInRoot(proc.Inner, subpath) - if err != nil { - return nil, err - } - return handle, nil -} - -// procfsBase is an enum indicating the prefix of a subpath in operations -// involving [Handle]s. -type procfsBase string - -const ( - // ProcRoot refers to the root of the procfs (i.e., "/proc/"). - ProcRoot procfsBase = "/proc" - // ProcSelf refers to the current process' subdirectory (i.e., - // "/proc/self/"). - ProcSelf procfsBase = "/proc/self" - // ProcThreadSelf refers to the current thread's subdirectory (i.e., - // "/proc/thread-self/"). In multi-threaded programs (i.e., all Go - // programs) where one thread has a different CLONE_FS, it is possible for - // "/proc/self" to point the wrong thread and so "/proc/thread-self" may be - // necessary. Note that on pre-3.17 kernels, "/proc/thread-self" doesn't - // exist and so a fallback will be used in that case. - ProcThreadSelf procfsBase = "/proc/thread-self" - // TODO: Switch to an interface setup so we can have a more type-safe - // version of ProcPid and remove the need to worry about invalid string - // values. -) - -// prefix returns a prefix that can be used with the given [Handle]. -func (base procfsBase) prefix(proc *Handle) (string, error) { - switch base { - case ProcRoot: - return ".", nil - case ProcSelf: - return "self", nil - case ProcThreadSelf: - threadSelf := "thread-self" - if !hasProcThreadSelf() || hookForceProcSelfTask() { - // Pre-3.17 kernels don't have /proc/thread-self, so do it - // manually. - threadSelf = "self/task/" + strconv.Itoa(unix.Gettid()) - if err := fd.Faccessat(proc.Inner, threadSelf, unix.F_OK, unix.AT_SYMLINK_NOFOLLOW); err != nil || hookForceProcSelf() { - // In this case, we running in a pid namespace that doesn't - // match the /proc mount we have. This can happen inside runc. - // - // Unfortunately, there is no nice way to get the correct TID - // to use here because of the age of the kernel, so we have to - // just use /proc/self and hope that it works. - threadSelf = "self" - } - } - return threadSelf, nil - } - return "", fmt.Errorf("invalid procfs base %q", base) -} - -// ProcThreadSelfCloser is a callback that needs to be called when you are done -// operating on an [os.File] fetched using [ProcThreadSelf]. -// -// [os.File]: https://pkg.go.dev/os#File -type ProcThreadSelfCloser func() - -// open is the core lookup operation for [Handle]. It returns a handle to -// "/proc//". If the returned [ProcThreadSelfCloser] is non-nil, -// you should call it after you are done interacting with the returned handle. -// -// In general you should use prefer to use the other helpers, as they remove -// the need to interact with [procfsBase] and do not return a nil -// [ProcThreadSelfCloser] for [procfsBase] values other than [ProcThreadSelf] -// where it is necessary. -func (proc *Handle) open(base procfsBase, subpath string) (_ *os.File, closer ProcThreadSelfCloser, Err error) { - prefix, err := base.prefix(proc) - if err != nil { - return nil, nil, err - } - subpath = prefix + "/" + subpath - - switch base { - case ProcRoot: - file, err := proc.lookup(subpath) - if errors.Is(err, os.ErrNotExist) { - // The Handle handle in use might be a subset=pid one, which will - // result in spurious errors. In this case, just open a temporary - // unmasked procfs handle for this operation. - proc, err2 := OpenUnsafeProcRoot() // !subset=pid - if err2 != nil { - return nil, nil, err - } - defer proc.Close() //nolint:errcheck // close failures aren't critical here - - file, err = proc.lookup(subpath) - } - return file, nil, err - - case ProcSelf: - file, err := proc.lookup(subpath) - return file, nil, err - - case ProcThreadSelf: - // We need to lock our thread until the caller is done with the handle - // because between getting the handle and using it we could get - // interrupted by the Go runtime and hit the case where the underlying - // thread is swapped out and the original thread is killed, resulting - // in pull-your-hair-out-hard-to-debug issues in the caller. - runtime.LockOSThread() - defer func() { - if Err != nil { - runtime.UnlockOSThread() - closer = nil - } - }() - - file, err := proc.lookup(subpath) - return file, runtime.UnlockOSThread, err - } - // should never be reached - return nil, nil, fmt.Errorf("[internal error] invalid procfs base %q", base) -} - -// OpenThreadSelf returns a handle to "/proc/thread-self/" (or an -// equivalent handle on older kernels where "/proc/thread-self" doesn't exist). -// Once finished with the handle, you must call the returned closer function -// (runtime.UnlockOSThread). You must not pass the returned *os.File to other -// Go threads or use the handle after calling the closer. -func (proc *Handle) OpenThreadSelf(subpath string) (_ *os.File, _ ProcThreadSelfCloser, Err error) { - return proc.open(ProcThreadSelf, subpath) -} - -// OpenSelf returns a handle to /proc/self/. -func (proc *Handle) OpenSelf(subpath string) (*os.File, error) { - file, closer, err := proc.open(ProcSelf, subpath) - assert.Assert(closer == nil, "closer for ProcSelf must be nil") - return file, err -} - -// OpenRoot returns a handle to /proc/. -func (proc *Handle) OpenRoot(subpath string) (*os.File, error) { - file, closer, err := proc.open(ProcRoot, subpath) - assert.Assert(closer == nil, "closer for ProcRoot must be nil") - return file, err -} - -// OpenPid returns a handle to /proc/$pid/ (pid can be a pid or tid). -// This is mainly intended for usage when operating on other processes. -func (proc *Handle) OpenPid(pid int, subpath string) (*os.File, error) { - return proc.OpenRoot(strconv.Itoa(pid) + "/" + subpath) -} - -// checkSubpathOvermount checks if the dirfd and path combination is on the -// same mount as the given root. -func checkSubpathOvermount(root, dir fd.Fd, path string) error { - // Get the mntID of our procfs handle. - expectedMountID, err := fd.GetMountID(root, "") - if err != nil { - return fmt.Errorf("get root mount id: %w", err) - } - // Get the mntID of the target magic-link. - gotMountID, err := fd.GetMountID(dir, path) - if err != nil { - return fmt.Errorf("get subpath mount id: %w", err) - } - // As long as the directory mount is alive, even with wrapping mount IDs, - // we would expect to see a different mount ID here. (Of course, if we're - // using unsafeHostProcRoot() then an attaker could change this after we - // did this check.) - if expectedMountID != gotMountID { - return fmt.Errorf("%w: subpath %s/%s has an overmount obscuring the real path (mount ids do not match %d != %d)", - errUnsafeProcfs, dir.Name(), path, expectedMountID, gotMountID) - } - return nil -} - -// Readlink performs a readlink operation on "/proc//" in a way -// that should be free from race attacks. This is most commonly used to get the -// real path of a file by looking at "/proc/self/fd/$n", with the same safety -// protections as [Open] (as well as some additional checks against -// overmounts). -func (proc *Handle) Readlink(base procfsBase, subpath string) (string, error) { - link, closer, err := proc.open(base, subpath) - if closer != nil { - defer closer() - } - if err != nil { - return "", fmt.Errorf("get safe %s/%s handle: %w", base, subpath, err) - } - defer link.Close() //nolint:errcheck // close failures aren't critical here - - // Try to detect if there is a mount on top of the magic-link. This should - // be safe in general (a mount on top of the path afterwards would not - // affect the handle itself) and will definitely be safe if we are using - // privateProcRoot() (at least since Linux 5.12[1], when anonymous mount - // namespaces were completely isolated from external mounts including mount - // propagation events). - // - // [1]: Linux commit ee2e3f50629f ("mount: fix mounting of detached mounts - // onto targets that reside on shared mounts"). - if err := checkSubpathOvermount(proc.Inner, link, ""); err != nil { - return "", fmt.Errorf("check safety of %s/%s magiclink: %w", base, subpath, err) - } - - // readlinkat implies AT_EMPTY_PATH since Linux 2.6.39. See Linux commit - // 65cfc6722361 ("readlinkat(), fchownat() and fstatat() with empty - // relative pathnames"). - return fd.Readlinkat(link, "") -} - -// ProcSelfFdReadlink gets the real path of the given file by looking at -// readlink(/proc/thread-self/fd/$n). -// -// This is just a wrapper around [Handle.Readlink]. -func ProcSelfFdReadlink(fd fd.Fd) (string, error) { - procRoot, err := OpenProcRoot() // subset=pid - if err != nil { - return "", err - } - defer procRoot.Close() //nolint:errcheck // close failures aren't critical here - - fdPath := "fd/" + strconv.Itoa(int(fd.Fd())) - return procRoot.Readlink(ProcThreadSelf, fdPath) -} - -// CheckProcSelfFdPath returns whether the given file handle matches the -// expected path. (This is inherently racy.) -func CheckProcSelfFdPath(path string, file fd.Fd) error { - if err := fd.IsDeadInode(file); err != nil { - return err - } - actualPath, err := ProcSelfFdReadlink(file) - if err != nil { - return fmt.Errorf("get path of handle: %w", err) - } - if actualPath != path { - return fmt.Errorf("%w: handle path %q doesn't match expected path %q", internal.ErrPossibleBreakout, actualPath, path) - } - return nil -} - -// ReopenFd takes an existing file descriptor and "re-opens" it through -// /proc/thread-self/fd/. This allows for O_PATH file descriptors to be -// upgraded to regular file descriptors, as well as changing the open mode of a -// regular file descriptor. Some filesystems have unique handling of open(2) -// which make this incredibly useful (such as /dev/ptmx). -func ReopenFd(handle fd.Fd, flags int) (*os.File, error) { - procRoot, err := OpenProcRoot() // subset=pid - if err != nil { - return nil, err - } - defer procRoot.Close() //nolint:errcheck // close failures aren't critical here - - // We can't operate on /proc/thread-self/fd/$n directly when doing a - // re-open, so we need to open /proc/thread-self/fd and then open a single - // final component. - procFdDir, closer, err := procRoot.OpenThreadSelf("fd/") - if err != nil { - return nil, fmt.Errorf("get safe /proc/thread-self/fd handle: %w", err) - } - defer procFdDir.Close() //nolint:errcheck // close failures aren't critical here - defer closer() - - // Try to detect if there is a mount on top of the magic-link we are about - // to open. If we are using unsafeHostProcRoot(), this could change after - // we check it (and there's nothing we can do about that) but for - // privateProcRoot() this should be guaranteed to be safe (at least since - // Linux 5.12[1], when anonymous mount namespaces were completely isolated - // from external mounts including mount propagation events). - // - // [1]: Linux commit ee2e3f50629f ("mount: fix mounting of detached mounts - // onto targets that reside on shared mounts"). - fdStr := strconv.Itoa(int(handle.Fd())) - if err := checkSubpathOvermount(procRoot.Inner, procFdDir, fdStr); err != nil { - return nil, fmt.Errorf("check safety of /proc/thread-self/fd/%s magiclink: %w", fdStr, err) - } - - flags |= unix.O_CLOEXEC - // Rather than just wrapping fd.Openat, open-code it so we can copy - // handle.Name(). - reopenFd, err := unix.Openat(int(procFdDir.Fd()), fdStr, flags, 0) - if err != nil { - return nil, fmt.Errorf("reopen fd %d: %w", handle.Fd(), err) - } - return os.NewFile(uintptr(reopenFd), handle.Name()), nil -} - -// Test hooks used in the procfs tests to verify that the fallback logic works. -// See testing_mocks_linux_test.go and procfs_linux_test.go for more details. -var ( - hookForcePrivateProcRootOpenTree = hookDummyFile - hookForcePrivateProcRootOpenTreeAtRecursive = hookDummyFile - hookForceGetProcRootUnsafe = hookDummy - - hookForceProcSelfTask = hookDummy - hookForceProcSelf = hookDummy -) - -func hookDummy() bool { return false } -func hookDummyFile(_ io.Closer) bool { return false } diff --git a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/procfs/procfs_lookup_linux.go b/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/procfs/procfs_lookup_linux.go deleted file mode 100644 index 1ad1f18ee..000000000 --- a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/procfs/procfs_lookup_linux.go +++ /dev/null @@ -1,222 +0,0 @@ -// SPDX-License-Identifier: MPL-2.0 - -//go:build linux - -// Copyright (C) 2024-2025 Aleksa Sarai -// Copyright (C) 2024-2025 SUSE LLC -// -// This Source Code Form is subject to the terms of the Mozilla Public -// License, v. 2.0. If a copy of the MPL was not distributed with this -// file, You can obtain one at https://mozilla.org/MPL/2.0/. - -// This code is adapted to be a minimal version of the libpathrs proc resolver -// . -// As we only need O_PATH|O_NOFOLLOW support, this is not too much to port. - -package procfs - -import ( - "fmt" - "os" - "path" - "path/filepath" - "strings" - - "golang.org/x/sys/unix" - - "github.com/cyphar/filepath-securejoin/internal/consts" - "github.com/cyphar/filepath-securejoin/pathrs-lite/internal" - "github.com/cyphar/filepath-securejoin/pathrs-lite/internal/fd" - "github.com/cyphar/filepath-securejoin/pathrs-lite/internal/gocompat" - "github.com/cyphar/filepath-securejoin/pathrs-lite/internal/linux" -) - -// procfsLookupInRoot is a stripped down version of completeLookupInRoot, -// entirely designed to support the very small set of features necessary to -// make procfs handling work. Unlike completeLookupInRoot, we always have -// O_PATH|O_NOFOLLOW behaviour for trailing symlinks. -// -// The main restrictions are: -// -// - ".." is not supported (as it requires either os.Root-style replays, -// which is more bug-prone; or procfs verification, which is not possible -// due to re-entrancy issues). -// - Absolute symlinks for the same reason (and all absolute symlinks in -// procfs are magic-links, which we want to skip anyway). -// - If statx is supported (checkSymlinkOvermount), any mount-point crossings -// (which is the main attack of concern against /proc). -// - Partial lookups are not supported, so the symlink stack is not needed. -// - Trailing slash special handling is not necessary in most cases (if we -// operating on procfs, it's usually with programmer-controlled strings -// that will then be re-opened), so we skip it since whatever re-opens it -// can deal with it. It's a creature comfort anyway. -// -// If the system supports openat2(), this is implemented using equivalent flags -// (RESOLVE_BENEATH | RESOLVE_NO_XDEV | RESOLVE_NO_MAGICLINKS). -func procfsLookupInRoot(procRoot fd.Fd, unsafePath string) (Handle *os.File, _ error) { - unsafePath = filepath.ToSlash(unsafePath) // noop - - // Make sure that an empty unsafe path still returns something sane, even - // with openat2 (which doesn't have AT_EMPTY_PATH semantics yet). - if unsafePath == "" { - unsafePath = "." - } - - // This is already checked by getProcRoot, but make sure here since the - // core security of this lookup is based on this assumption. - if err := verifyProcRoot(procRoot); err != nil { - return nil, err - } - - if linux.HasOpenat2() { - // We prefer being able to use RESOLVE_NO_XDEV if we can, to be - // absolutely sure we are operating on a clean /proc handle that - // doesn't have any cheeky overmounts that could trick us (including - // symlink mounts on top of /proc/thread-self). RESOLVE_BENEATH isn't - // strictly needed, but just use it since we have it. - // - // NOTE: /proc/self is technically a magic-link (the contents of the - // symlink are generated dynamically), but it doesn't use - // nd_jump_link() so RESOLVE_NO_MAGICLINKS allows it. - // - // TODO: It would be nice to have RESOLVE_NO_DOTDOT, purely for - // self-consistency with the backup O_PATH resolver. - handle, err := fd.Openat2(procRoot, unsafePath, &unix.OpenHow{ - Flags: unix.O_PATH | unix.O_NOFOLLOW | unix.O_CLOEXEC, - Resolve: unix.RESOLVE_BENEATH | unix.RESOLVE_NO_XDEV | unix.RESOLVE_NO_MAGICLINKS, - }) - if err != nil { - // TODO: Once we bump the minimum Go version to 1.20, we can use - // multiple %w verbs for this wrapping. For now we need to use a - // compatibility shim for older Go versions. - // err = fmt.Errorf("%w: %w", errUnsafeProcfs, err) - return nil, gocompat.WrapBaseError(err, errUnsafeProcfs) - } - return handle, nil - } - - // To mirror openat2(RESOLVE_BENEATH), we need to return an error if the - // path is absolute. - if path.IsAbs(unsafePath) { - return nil, fmt.Errorf("%w: cannot resolve absolute paths in procfs resolver", internal.ErrPossibleBreakout) - } - - currentDir, err := fd.Dup(procRoot) - if err != nil { - return nil, fmt.Errorf("clone root fd: %w", err) - } - defer func() { - // If a handle is not returned, close the internal handle. - if Handle == nil { - _ = currentDir.Close() - } - }() - - var ( - linksWalked int - currentPath string - remainingPath = unsafePath - ) - for remainingPath != "" { - // Get the next path component. - var part string - if i := strings.IndexByte(remainingPath, '/'); i == -1 { - part, remainingPath = remainingPath, "" - } else { - part, remainingPath = remainingPath[:i], remainingPath[i+1:] - } - if part == "" { - // no-op component, but treat it the same as "." - part = "." - } - if part == ".." { - // not permitted - return nil, fmt.Errorf("%w: cannot walk into '..' in procfs resolver", internal.ErrPossibleBreakout) - } - - // Apply the component lexically to the path we are building. - // currentPath does not contain any symlinks, and we are lexically - // dealing with a single component, so it's okay to do a filepath.Clean - // here. (Not to mention that ".." isn't allowed.) - nextPath := path.Join("/", currentPath, part) - // If we logically hit the root, just clone the root rather than - // opening the part and doing all of the other checks. - if nextPath == "/" { - // Jump to root. - rootClone, err := fd.Dup(procRoot) - if err != nil { - return nil, fmt.Errorf("clone root fd: %w", err) - } - _ = currentDir.Close() - currentDir = rootClone - currentPath = nextPath - continue - } - - // Try to open the next component. - nextDir, err := fd.Openat(currentDir, part, unix.O_PATH|unix.O_NOFOLLOW|unix.O_CLOEXEC, 0) - if err != nil { - return nil, err - } - - // Make sure we are still on procfs and haven't crossed mounts. - if err := verifyProcHandle(nextDir); err != nil { - _ = nextDir.Close() - return nil, fmt.Errorf("check %q component is on procfs: %w", part, err) - } - if err := checkSubpathOvermount(procRoot, nextDir, ""); err != nil { - _ = nextDir.Close() - return nil, fmt.Errorf("check %q component is not overmounted: %w", part, err) - } - - // We are emulating O_PATH|O_NOFOLLOW, so we only need to traverse into - // trailing symlinks if we are not the final component. Otherwise we - // can just return the currentDir. - if remainingPath != "" { - st, err := nextDir.Stat() - if err != nil { - _ = nextDir.Close() - return nil, fmt.Errorf("stat component %q: %w", part, err) - } - - if st.Mode()&os.ModeType == os.ModeSymlink { - // readlinkat implies AT_EMPTY_PATH since Linux 2.6.39. See - // Linux commit 65cfc6722361 ("readlinkat(), fchownat() and - // fstatat() with empty relative pathnames"). - linkDest, err := fd.Readlinkat(nextDir, "") - // We don't need the handle anymore. - _ = nextDir.Close() - if err != nil { - return nil, err - } - - linksWalked++ - if linksWalked > consts.MaxSymlinkLimit { - return nil, &os.PathError{Op: "securejoin.procfsLookupInRoot", Path: "/proc/" + unsafePath, Err: unix.ELOOP} - } - - // Update our logical remaining path. - remainingPath = linkDest + "/" + remainingPath - // Absolute symlinks are probably magiclinks, we reject them. - if path.IsAbs(linkDest) { - return nil, fmt.Errorf("%w: cannot jump to / in procfs resolver -- possible magiclink", internal.ErrPossibleBreakout) - } - continue - } - } - - // Walk into the next component. - _ = currentDir.Close() - currentDir = nextDir - currentPath = nextPath - } - - // One final sanity-check. - if err := verifyProcHandle(currentDir); err != nil { - return nil, fmt.Errorf("check final handle is on procfs: %w", err) - } - if err := checkSubpathOvermount(procRoot, currentDir, ""); err != nil { - return nil, fmt.Errorf("check final handle is not overmounted: %w", err) - } - return currentDir, nil -} diff --git a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/lookup_linux.go b/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/lookup_linux.go deleted file mode 100644 index f47504e66..000000000 --- a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/lookup_linux.go +++ /dev/null @@ -1,399 +0,0 @@ -// SPDX-License-Identifier: MPL-2.0 - -//go:build linux - -// Copyright (C) 2024-2025 Aleksa Sarai -// Copyright (C) 2024-2025 SUSE LLC -// -// This Source Code Form is subject to the terms of the Mozilla Public -// License, v. 2.0. If a copy of the MPL was not distributed with this -// file, You can obtain one at https://mozilla.org/MPL/2.0/. - -package pathrs - -import ( - "errors" - "fmt" - "os" - "path" - "path/filepath" - "strings" - - "golang.org/x/sys/unix" - - "github.com/cyphar/filepath-securejoin/internal/consts" - "github.com/cyphar/filepath-securejoin/pathrs-lite/internal/fd" - "github.com/cyphar/filepath-securejoin/pathrs-lite/internal/gocompat" - "github.com/cyphar/filepath-securejoin/pathrs-lite/internal/linux" - "github.com/cyphar/filepath-securejoin/pathrs-lite/internal/procfs" -) - -type symlinkStackEntry struct { - // (dir, remainingPath) is what we would've returned if the link didn't - // exist. This matches what openat2(RESOLVE_IN_ROOT) would return in - // this case. - dir *os.File - remainingPath string - // linkUnwalked is the remaining path components from the original - // Readlink which we have yet to walk. When this slice is empty, we - // drop the link from the stack. - linkUnwalked []string -} - -func (se symlinkStackEntry) String() string { - return fmt.Sprintf("<%s>/%s [->%s]", se.dir.Name(), se.remainingPath, strings.Join(se.linkUnwalked, "/")) -} - -func (se symlinkStackEntry) Close() { - _ = se.dir.Close() -} - -type symlinkStack []*symlinkStackEntry - -func (s *symlinkStack) IsEmpty() bool { - return s == nil || len(*s) == 0 -} - -func (s *symlinkStack) Close() { - if s != nil { - for _, link := range *s { - link.Close() - } - // TODO: Switch to clear once we switch to Go 1.21. - *s = nil - } -} - -var ( - errEmptyStack = errors.New("[internal] stack is empty") - errBrokenSymlinkStack = errors.New("[internal error] broken symlink stack") -) - -func (s *symlinkStack) popPart(part string) error { - if s == nil || s.IsEmpty() { - // If there is nothing in the symlink stack, then the part was from the - // real path provided by the user, and this is a no-op. - return errEmptyStack - } - if part == "." { - // "." components are no-ops -- we drop them when doing SwapLink. - return nil - } - - tailEntry := (*s)[len(*s)-1] - - // Double-check that we are popping the component we expect. - if len(tailEntry.linkUnwalked) == 0 { - return fmt.Errorf("%w: trying to pop component %q of empty stack entry %s", errBrokenSymlinkStack, part, tailEntry) - } - headPart := tailEntry.linkUnwalked[0] - if headPart != part { - return fmt.Errorf("%w: trying to pop component %q but the last stack entry is %s (%q)", errBrokenSymlinkStack, part, tailEntry, headPart) - } - - // Drop the component, but keep the entry around in case we are dealing - // with a "tail-chained" symlink. - tailEntry.linkUnwalked = tailEntry.linkUnwalked[1:] - return nil -} - -func (s *symlinkStack) PopPart(part string) error { - if err := s.popPart(part); err != nil { - if errors.Is(err, errEmptyStack) { - // Skip empty stacks. - err = nil - } - return err - } - - // Clean up any of the trailing stack entries that are empty. - for lastGood := len(*s) - 1; lastGood >= 0; lastGood-- { - entry := (*s)[lastGood] - if len(entry.linkUnwalked) > 0 { - break - } - entry.Close() - (*s) = (*s)[:lastGood] - } - return nil -} - -func (s *symlinkStack) push(dir *os.File, remainingPath, linkTarget string) error { - if s == nil { - return nil - } - // Split the link target and clean up any "" parts. - linkTargetParts := gocompat.SlicesDeleteFunc( - strings.Split(linkTarget, "/"), - func(part string) bool { return part == "" || part == "." }) - - // Copy the directory so the caller doesn't close our copy. - dirCopy, err := fd.Dup(dir) - if err != nil { - return err - } - - // Add to the stack. - *s = append(*s, &symlinkStackEntry{ - dir: dirCopy, - remainingPath: remainingPath, - linkUnwalked: linkTargetParts, - }) - return nil -} - -func (s *symlinkStack) SwapLink(linkPart string, dir *os.File, remainingPath, linkTarget string) error { - // If we are currently inside a symlink resolution, remove the symlink - // component from the last symlink entry, but don't remove the entry even - // if it's empty. If we are a "tail-chained" symlink (a trailing symlink we - // hit during a symlink resolution) we need to keep the old symlink until - // we finish the resolution. - if err := s.popPart(linkPart); err != nil { - if !errors.Is(err, errEmptyStack) { - return err - } - // Push the component regardless of whether the stack was empty. - } - return s.push(dir, remainingPath, linkTarget) -} - -func (s *symlinkStack) PopTopSymlink() (*os.File, string, bool) { - if s == nil || s.IsEmpty() { - return nil, "", false - } - tailEntry := (*s)[0] - *s = (*s)[1:] - return tailEntry.dir, tailEntry.remainingPath, true -} - -// partialLookupInRoot tries to lookup as much of the request path as possible -// within the provided root (a-la RESOLVE_IN_ROOT) and opens the final existing -// component of the requested path, returning a file handle to the final -// existing component and a string containing the remaining path components. -func partialLookupInRoot(root fd.Fd, unsafePath string) (*os.File, string, error) { - return lookupInRoot(root, unsafePath, true) -} - -func completeLookupInRoot(root fd.Fd, unsafePath string) (*os.File, error) { - handle, remainingPath, err := lookupInRoot(root, unsafePath, false) - if remainingPath != "" && err == nil { - // should never happen - err = fmt.Errorf("[bug] non-empty remaining path when doing a non-partial lookup: %q", remainingPath) - } - // lookupInRoot(partial=false) will always close the handle if an error is - // returned, so no need to double-check here. - return handle, err -} - -func lookupInRoot(root fd.Fd, unsafePath string, partial bool) (Handle *os.File, _ string, _ error) { - unsafePath = filepath.ToSlash(unsafePath) // noop - - // This is very similar to SecureJoin, except that we operate on the - // components using file descriptors. We then return the last component we - // managed open, along with the remaining path components not opened. - - // Try to use openat2 if possible. - if linux.HasOpenat2() { - return lookupOpenat2(root, unsafePath, partial) - } - - // Get the "actual" root path from /proc/self/fd. This is necessary if the - // root is some magic-link like /proc/$pid/root, in which case we want to - // make sure when we do procfs.CheckProcSelfFdPath that we are using the - // correct root path. - logicalRootPath, err := procfs.ProcSelfFdReadlink(root) - if err != nil { - return nil, "", fmt.Errorf("get real root path: %w", err) - } - - currentDir, err := fd.Dup(root) - if err != nil { - return nil, "", fmt.Errorf("clone root fd: %w", err) - } - defer func() { - // If a handle is not returned, close the internal handle. - if Handle == nil { - _ = currentDir.Close() - } - }() - - // symlinkStack is used to emulate how openat2(RESOLVE_IN_ROOT) treats - // dangling symlinks. If we hit a non-existent path while resolving a - // symlink, we need to return the (dir, remainingPath) that we had when we - // hit the symlink (treating the symlink as though it were a regular file). - // The set of (dir, remainingPath) sets is stored within the symlinkStack - // and we add and remove parts when we hit symlink and non-symlink - // components respectively. We need a stack because of recursive symlinks - // (symlinks that contain symlink components in their target). - // - // Note that the stack is ONLY used for book-keeping. All of the actual - // path walking logic is still based on currentPath/remainingPath and - // currentDir (as in SecureJoin). - var symStack *symlinkStack - if partial { - symStack = new(symlinkStack) - defer symStack.Close() - } - - var ( - linksWalked int - currentPath string - remainingPath = unsafePath - ) - for remainingPath != "" { - // Save the current remaining path so if the part is not real we can - // return the path including the component. - oldRemainingPath := remainingPath - - // Get the next path component. - var part string - if i := strings.IndexByte(remainingPath, '/'); i == -1 { - part, remainingPath = remainingPath, "" - } else { - part, remainingPath = remainingPath[:i], remainingPath[i+1:] - } - // If we hit an empty component, we need to treat it as though it is - // "." so that trailing "/" and "//" components on a non-directory - // correctly return the right error code. - if part == "" { - part = "." - } - - // Apply the component lexically to the path we are building. - // currentPath does not contain any symlinks, and we are lexically - // dealing with a single component, so it's okay to do a filepath.Clean - // here. - nextPath := path.Join("/", currentPath, part) - // If we logically hit the root, just clone the root rather than - // opening the part and doing all of the other checks. - if nextPath == "/" { - if err := symStack.PopPart(part); err != nil { - return nil, "", fmt.Errorf("walking into root with part %q failed: %w", part, err) - } - // Jump to root. - rootClone, err := fd.Dup(root) - if err != nil { - return nil, "", fmt.Errorf("clone root fd: %w", err) - } - _ = currentDir.Close() - currentDir = rootClone - currentPath = nextPath - continue - } - - // Try to open the next component. - nextDir, err := fd.Openat(currentDir, part, unix.O_PATH|unix.O_NOFOLLOW|unix.O_CLOEXEC, 0) - switch err { - case nil: - st, err := nextDir.Stat() - if err != nil { - _ = nextDir.Close() - return nil, "", fmt.Errorf("stat component %q: %w", part, err) - } - - switch st.Mode() & os.ModeType { //nolint:exhaustive // just a glorified if statement - case os.ModeSymlink: - // readlinkat implies AT_EMPTY_PATH since Linux 2.6.39. See - // Linux commit 65cfc6722361 ("readlinkat(), fchownat() and - // fstatat() with empty relative pathnames"). - linkDest, err := fd.Readlinkat(nextDir, "") - // We don't need the handle anymore. - _ = nextDir.Close() - if err != nil { - return nil, "", err - } - - linksWalked++ - if linksWalked > consts.MaxSymlinkLimit { - return nil, "", &os.PathError{Op: "securejoin.lookupInRoot", Path: logicalRootPath + "/" + unsafePath, Err: unix.ELOOP} - } - - // Swap out the symlink's component for the link entry itself. - if err := symStack.SwapLink(part, currentDir, oldRemainingPath, linkDest); err != nil { - return nil, "", fmt.Errorf("walking into symlink %q failed: push symlink: %w", part, err) - } - - // Update our logical remaining path. - remainingPath = linkDest + "/" + remainingPath - // Absolute symlinks reset any work we've already done. - if path.IsAbs(linkDest) { - // Jump to root. - rootClone, err := fd.Dup(root) - if err != nil { - return nil, "", fmt.Errorf("clone root fd: %w", err) - } - _ = currentDir.Close() - currentDir = rootClone - currentPath = "/" - } - - default: - // If we are dealing with a directory, simply walk into it. - _ = currentDir.Close() - currentDir = nextDir - currentPath = nextPath - - // The part was real, so drop it from the symlink stack. - if err := symStack.PopPart(part); err != nil { - return nil, "", fmt.Errorf("walking into directory %q failed: %w", part, err) - } - - // If we are operating on a .., make sure we haven't escaped. - // We only have to check for ".." here because walking down - // into a regular component component cannot cause you to - // escape. This mirrors the logic in RESOLVE_IN_ROOT, except we - // have to check every ".." rather than only checking after a - // rename or mount on the system. - if part == ".." { - // Make sure the root hasn't moved. - if err := procfs.CheckProcSelfFdPath(logicalRootPath, root); err != nil { - return nil, "", fmt.Errorf("root path moved during lookup: %w", err) - } - // Make sure the path is what we expect. - fullPath := logicalRootPath + nextPath - if err := procfs.CheckProcSelfFdPath(fullPath, currentDir); err != nil { - return nil, "", fmt.Errorf("walking into %q had unexpected result: %w", part, err) - } - } - } - - default: - if !partial { - return nil, "", err - } - // If there are any remaining components in the symlink stack, we - // are still within a symlink resolution and thus we hit a dangling - // symlink. So pretend that the first symlink in the stack we hit - // was an ENOENT (to match openat2). - if oldDir, remainingPath, ok := symStack.PopTopSymlink(); ok { - _ = currentDir.Close() - return oldDir, remainingPath, err - } - // We have hit a final component that doesn't exist, so we have our - // partial open result. Note that we have to use the OLD remaining - // path, since the lookup failed. - return currentDir, oldRemainingPath, err - } - } - - // If the unsafePath had a trailing slash, we need to make sure we try to - // do a relative "." open so that we will correctly return an error when - // the final component is a non-directory (to match openat2). In the - // context of openat2, a trailing slash and a trailing "/." are completely - // equivalent. - if strings.HasSuffix(unsafePath, "/") { - nextDir, err := fd.Openat(currentDir, ".", unix.O_PATH|unix.O_NOFOLLOW|unix.O_CLOEXEC, 0) - if err != nil { - if !partial { - _ = currentDir.Close() - currentDir = nil - } - return currentDir, "", err - } - _ = currentDir.Close() - currentDir = nextDir - } - - // All of the components existed! - return currentDir, "", nil -} diff --git a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/mkdir_linux.go b/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/mkdir_linux.go deleted file mode 100644 index f3c62b0da..000000000 --- a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/mkdir_linux.go +++ /dev/null @@ -1,246 +0,0 @@ -// SPDX-License-Identifier: MPL-2.0 - -//go:build linux - -// Copyright (C) 2024-2025 Aleksa Sarai -// Copyright (C) 2024-2025 SUSE LLC -// -// This Source Code Form is subject to the terms of the Mozilla Public -// License, v. 2.0. If a copy of the MPL was not distributed with this -// file, You can obtain one at https://mozilla.org/MPL/2.0/. - -package pathrs - -import ( - "errors" - "fmt" - "os" - "path/filepath" - "strings" - - "golang.org/x/sys/unix" - - "github.com/cyphar/filepath-securejoin/pathrs-lite/internal/fd" - "github.com/cyphar/filepath-securejoin/pathrs-lite/internal/gocompat" - "github.com/cyphar/filepath-securejoin/pathrs-lite/internal/linux" -) - -var errInvalidMode = errors.New("invalid permission mode") - -// modePermExt is like os.ModePerm except that it also includes the set[ug]id -// and sticky bits. -const modePermExt = os.ModePerm | os.ModeSetuid | os.ModeSetgid | os.ModeSticky - -//nolint:cyclop // this function needs to handle a lot of cases -func toUnixMode(mode os.FileMode) (uint32, error) { - sysMode := uint32(mode.Perm()) - if mode&os.ModeSetuid != 0 { - sysMode |= unix.S_ISUID - } - if mode&os.ModeSetgid != 0 { - sysMode |= unix.S_ISGID - } - if mode&os.ModeSticky != 0 { - sysMode |= unix.S_ISVTX - } - // We don't allow file type bits. - if mode&os.ModeType != 0 { - return 0, fmt.Errorf("%w %+.3o (%s): type bits not permitted", errInvalidMode, mode, mode) - } - // We don't allow other unknown modes. - if mode&^modePermExt != 0 || sysMode&unix.S_IFMT != 0 { - return 0, fmt.Errorf("%w %+.3o (%s): unknown mode bits", errInvalidMode, mode, mode) - } - return sysMode, nil -} - -// MkdirAllHandle is equivalent to [MkdirAll], except that it is safer to use -// in two respects: -// -// - The caller provides the root directory as an *[os.File] (preferably O_PATH) -// handle. This means that the caller can be sure which root directory is -// being used. Note that this can be emulated by using /proc/self/fd/... as -// the root path with [os.MkdirAll]. -// -// - Once all of the directories have been created, an *[os.File] O_PATH handle -// to the directory at unsafePath is returned to the caller. This is done in -// an effectively-race-free way (an attacker would only be able to swap the -// final directory component), which is not possible to emulate with -// [MkdirAll]. -// -// In addition, the returned handle is obtained far more efficiently than doing -// a brand new lookup of unsafePath (such as with [SecureJoin] or openat2) after -// doing [MkdirAll]. If you intend to open the directory after creating it, you -// should use MkdirAllHandle. -// -// [SecureJoin]: https://pkg.go.dev/github.com/cyphar/filepath-securejoin#SecureJoin -func MkdirAllHandle(root *os.File, unsafePath string, mode os.FileMode) (_ *os.File, Err error) { - unixMode, err := toUnixMode(mode) - if err != nil { - return nil, err - } - // On Linux, mkdirat(2) (and os.Mkdir) silently ignore the suid and sgid - // bits. We could also silently ignore them but since we have very few - // users it seems more prudent to return an error so users notice that - // these bits will not be set. - if unixMode&^0o1777 != 0 { - return nil, fmt.Errorf("%w for mkdir %+.3o: suid and sgid are ignored by mkdir", errInvalidMode, mode) - } - - // Try to open as much of the path as possible. - currentDir, remainingPath, err := partialLookupInRoot(root, unsafePath) - defer func() { - if Err != nil { - _ = currentDir.Close() - } - }() - if err != nil && !errors.Is(err, unix.ENOENT) { - return nil, fmt.Errorf("find existing subpath of %q: %w", unsafePath, err) - } - - // If there is an attacker deleting directories as we walk into them, - // detect this proactively. Note this is guaranteed to detect if the - // attacker deleted any part of the tree up to currentDir. - // - // Once we walk into a dead directory, partialLookupInRoot would not be - // able to walk further down the tree (directories must be empty before - // they are deleted), and if the attacker has removed the entire tree we - // can be sure that anything that was originally inside a dead directory - // must also be deleted and thus is a dead directory in its own right. - // - // This is mostly a quality-of-life check, because mkdir will simply fail - // later if the attacker deletes the tree after this check. - if err := fd.IsDeadInode(currentDir); err != nil { - return nil, fmt.Errorf("finding existing subpath of %q: %w", unsafePath, err) - } - - // Re-open the path to match the O_DIRECTORY reopen loop later (so that we - // always return a non-O_PATH handle). We also check that we actually got a - // directory. - if reopenDir, err := Reopen(currentDir, unix.O_DIRECTORY|unix.O_CLOEXEC); errors.Is(err, unix.ENOTDIR) { - return nil, fmt.Errorf("cannot create subdirectories in %q: %w", currentDir.Name(), unix.ENOTDIR) - } else if err != nil { - return nil, fmt.Errorf("re-opening handle to %q: %w", currentDir.Name(), err) - } else { //nolint:revive // indent-error-flow lint doesn't make sense here - _ = currentDir.Close() - currentDir = reopenDir - } - - remainingParts := strings.Split(remainingPath, string(filepath.Separator)) - if gocompat.SlicesContains(remainingParts, "..") { - // The path contained ".." components after the end of the "real" - // components. We could try to safely resolve ".." here but that would - // add a bunch of extra logic for something that it's not clear even - // needs to be supported. So just return an error. - // - // If we do filepath.Clean(remainingPath) then we end up with the - // problem that ".." can erase a trailing dangling symlink and produce - // a path that doesn't quite match what the user asked for. - return nil, fmt.Errorf("%w: yet-to-be-created path %q contains '..' components", unix.ENOENT, remainingPath) - } - - // Create the remaining components. - for _, part := range remainingParts { - switch part { - case "", ".": - // Skip over no-op paths. - continue - } - - // NOTE: mkdir(2) will not follow trailing symlinks, so we can safely - // create the final component without worrying about symlink-exchange - // attacks. - // - // If we get -EEXIST, it's possible that another program created the - // directory at the same time as us. In that case, just continue on as - // if we created it (if the created inode is not a directory, the - // following open call will fail). - if err := unix.Mkdirat(int(currentDir.Fd()), part, unixMode); err != nil && !errors.Is(err, unix.EEXIST) { - err = &os.PathError{Op: "mkdirat", Path: currentDir.Name() + "/" + part, Err: err} - // Make the error a bit nicer if the directory is dead. - if deadErr := fd.IsDeadInode(currentDir); deadErr != nil { - // TODO: Once we bump the minimum Go version to 1.20, we can use - // multiple %w verbs for this wrapping. For now we need to use a - // compatibility shim for older Go versions. - // err = fmt.Errorf("%w (%w)", err, deadErr) - err = gocompat.WrapBaseError(err, deadErr) - } - return nil, err - } - - // Get a handle to the next component. O_DIRECTORY means we don't need - // to use O_PATH. - var nextDir *os.File - if linux.HasOpenat2() { - nextDir, err = openat2(currentDir, part, &unix.OpenHow{ - Flags: unix.O_NOFOLLOW | unix.O_DIRECTORY | unix.O_CLOEXEC, - Resolve: unix.RESOLVE_BENEATH | unix.RESOLVE_NO_SYMLINKS | unix.RESOLVE_NO_XDEV, - }) - } else { - nextDir, err = fd.Openat(currentDir, part, unix.O_NOFOLLOW|unix.O_DIRECTORY|unix.O_CLOEXEC, 0) - } - if err != nil { - return nil, err - } - _ = currentDir.Close() - currentDir = nextDir - - // It's possible that the directory we just opened was swapped by an - // attacker. Unfortunately there isn't much we can do to protect - // against this, and MkdirAll's behaviour is that we will reuse - // existing directories anyway so the need to protect against this is - // incredibly limited (and arguably doesn't even deserve mention here). - // - // Ideally we might want to check that the owner and mode match what we - // would've created -- unfortunately, it is non-trivial to verify that - // the owner and mode of the created directory match. While plain Unix - // DAC rules seem simple enough to emulate, there are a bunch of other - // factors that can change the mode or owner of created directories - // (default POSIX ACLs, mount options like uid=1,gid=2,umask=0 on - // filesystems like vfat, etc etc). We used to try to verify this but - // it just lead to a series of spurious errors. - // - // We could also check that the directory is non-empty, but - // unfortunately some pseduofilesystems (like cgroupfs) create - // non-empty directories, which would result in different spurious - // errors. - } - return currentDir, nil -} - -// MkdirAll is a race-safe alternative to the [os.MkdirAll] function, -// where the new directory is guaranteed to be within the root directory (if an -// attacker can move directories from inside the root to outside the root, the -// created directory tree might be outside of the root but the key constraint -// is that at no point will we walk outside of the directory tree we are -// creating). -// -// Effectively, MkdirAll(root, unsafePath, mode) is equivalent to -// -// path, _ := securejoin.SecureJoin(root, unsafePath) -// err := os.MkdirAll(path, mode) -// -// But is much safer. The above implementation is unsafe because if an attacker -// can modify the filesystem tree between [SecureJoin] and [os.MkdirAll], it is -// possible for MkdirAll to resolve unsafe symlink components and create -// directories outside of the root. -// -// If you plan to open the directory after you have created it or want to use -// an open directory handle as the root, you should use [MkdirAllHandle] instead. -// This function is a wrapper around [MkdirAllHandle]. -// -// [SecureJoin]: https://pkg.go.dev/github.com/cyphar/filepath-securejoin#SecureJoin -func MkdirAll(root, unsafePath string, mode os.FileMode) error { - rootDir, err := os.OpenFile(root, unix.O_PATH|unix.O_DIRECTORY|unix.O_CLOEXEC, 0) - if err != nil { - return err - } - defer rootDir.Close() //nolint:errcheck // close failures aren't critical here - - f, err := MkdirAllHandle(rootDir, unsafePath, mode) - if err != nil { - return err - } - _ = f.Close() - return nil -} diff --git a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/open_linux.go b/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/open_linux.go deleted file mode 100644 index 7492d8cfa..000000000 --- a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/open_linux.go +++ /dev/null @@ -1,74 +0,0 @@ -// SPDX-License-Identifier: MPL-2.0 - -//go:build linux - -// Copyright (C) 2024-2025 Aleksa Sarai -// Copyright (C) 2024-2025 SUSE LLC -// -// This Source Code Form is subject to the terms of the Mozilla Public -// License, v. 2.0. If a copy of the MPL was not distributed with this -// file, You can obtain one at https://mozilla.org/MPL/2.0/. - -package pathrs - -import ( - "os" - - "golang.org/x/sys/unix" - - "github.com/cyphar/filepath-securejoin/pathrs-lite/internal/procfs" -) - -// OpenatInRoot is equivalent to [OpenInRoot], except that the root is provided -// using an *[os.File] handle, to ensure that the correct root directory is used. -func OpenatInRoot(root *os.File, unsafePath string) (*os.File, error) { - handle, err := completeLookupInRoot(root, unsafePath) - if err != nil { - return nil, &os.PathError{Op: "securejoin.OpenInRoot", Path: unsafePath, Err: err} - } - return handle, nil -} - -// OpenInRoot safely opens the provided unsafePath within the root. -// Effectively, OpenInRoot(root, unsafePath) is equivalent to -// -// path, _ := securejoin.SecureJoin(root, unsafePath) -// handle, err := os.OpenFile(path, unix.O_PATH|unix.O_CLOEXEC) -// -// But is much safer. The above implementation is unsafe because if an attacker -// can modify the filesystem tree between [SecureJoin] and [os.OpenFile], it is -// possible for the returned file to be outside of the root. -// -// Note that the returned handle is an O_PATH handle, meaning that only a very -// limited set of operations will work on the handle. This is done to avoid -// accidentally opening an untrusted file that could cause issues (such as a -// disconnected TTY that could cause a DoS, or some other issue). In order to -// use the returned handle, you can "upgrade" it to a proper handle using -// [Reopen]. -// -// [SecureJoin]: https://pkg.go.dev/github.com/cyphar/filepath-securejoin#SecureJoin -func OpenInRoot(root, unsafePath string) (*os.File, error) { - rootDir, err := os.OpenFile(root, unix.O_PATH|unix.O_DIRECTORY|unix.O_CLOEXEC, 0) - if err != nil { - return nil, err - } - defer rootDir.Close() //nolint:errcheck // close failures aren't critical here - return OpenatInRoot(rootDir, unsafePath) -} - -// Reopen takes an *[os.File] handle and re-opens it through /proc/self/fd. -// Reopen(file, flags) is effectively equivalent to -// -// fdPath := fmt.Sprintf("/proc/self/fd/%d", file.Fd()) -// os.OpenFile(fdPath, flags|unix.O_CLOEXEC) -// -// But with some extra hardenings to ensure that we are not tricked by a -// maliciously-configured /proc mount. While this attack scenario is not -// common, in container runtimes it is possible for higher-level runtimes to be -// tricked into configuring an unsafe /proc that can be used to attack file -// operations. See [CVE-2019-19921] for more details. -// -// [CVE-2019-19921]: https://github.com/advisories/GHSA-fh74-hm69-rqjw -func Reopen(handle *os.File, flags int) (*os.File, error) { - return procfs.ReopenFd(handle, flags) -} diff --git a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/openat2_linux.go b/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/openat2_linux.go deleted file mode 100644 index 937bc435f..000000000 --- a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/openat2_linux.go +++ /dev/null @@ -1,101 +0,0 @@ -// SPDX-License-Identifier: MPL-2.0 - -//go:build linux - -// Copyright (C) 2024-2025 Aleksa Sarai -// Copyright (C) 2024-2025 SUSE LLC -// -// This Source Code Form is subject to the terms of the Mozilla Public -// License, v. 2.0. If a copy of the MPL was not distributed with this -// file, You can obtain one at https://mozilla.org/MPL/2.0/. - -package pathrs - -import ( - "errors" - "fmt" - "os" - "path/filepath" - "strings" - - "golang.org/x/sys/unix" - - "github.com/cyphar/filepath-securejoin/pathrs-lite/internal/fd" - "github.com/cyphar/filepath-securejoin/pathrs-lite/procfs" -) - -func openat2(dir fd.Fd, path string, how *unix.OpenHow) (*os.File, error) { - file, err := fd.Openat2(dir, path, how) - if err != nil { - return nil, err - } - // If we are using RESOLVE_IN_ROOT, the name we generated may be wrong. - if how.Resolve&unix.RESOLVE_IN_ROOT == unix.RESOLVE_IN_ROOT { - if actualPath, err := procfs.ProcSelfFdReadlink(file); err == nil { - // TODO: Ideally we would not need to dup the fd, but you cannot - // easily just swap an *os.File with one from the same fd - // (the GC will close the old one, and you cannot clear the - // finaliser easily because it is associated with an internal - // field of *os.File not *os.File itself). - newFile, err := fd.DupWithName(file, actualPath) - if err != nil { - return nil, err - } - file = newFile - } - } - return file, nil -} - -func lookupOpenat2(root fd.Fd, unsafePath string, partial bool) (*os.File, string, error) { - if !partial { - file, err := openat2(root, unsafePath, &unix.OpenHow{ - Flags: unix.O_PATH | unix.O_CLOEXEC, - Resolve: unix.RESOLVE_IN_ROOT | unix.RESOLVE_NO_MAGICLINKS, - }) - return file, "", err - } - return partialLookupOpenat2(root, unsafePath) -} - -// partialLookupOpenat2 is an alternative implementation of -// partialLookupInRoot, using openat2(RESOLVE_IN_ROOT) to more safely get a -// handle to the deepest existing child of the requested path within the root. -func partialLookupOpenat2(root fd.Fd, unsafePath string) (*os.File, string, error) { - // TODO: Implement this as a git-bisect-like binary search. - - unsafePath = filepath.ToSlash(unsafePath) // noop - endIdx := len(unsafePath) - var lastError error - for endIdx > 0 { - subpath := unsafePath[:endIdx] - - handle, err := openat2(root, subpath, &unix.OpenHow{ - Flags: unix.O_PATH | unix.O_CLOEXEC, - Resolve: unix.RESOLVE_IN_ROOT | unix.RESOLVE_NO_MAGICLINKS, - }) - if err == nil { - // Jump over the slash if we have a non-"" remainingPath. - if endIdx < len(unsafePath) { - endIdx++ - } - // We found a subpath! - return handle, unsafePath[endIdx:], lastError - } - if errors.Is(err, unix.ENOENT) || errors.Is(err, unix.ENOTDIR) { - // That path doesn't exist, let's try the next directory up. - endIdx = strings.LastIndexByte(subpath, '/') - lastError = err - continue - } - return nil, "", fmt.Errorf("open subpath: %w", err) - } - // If we couldn't open anything, the whole subpath is missing. Return a - // copy of the root fd so that the caller doesn't close this one by - // accident. - rootClone, err := fd.Dup(root) - if err != nil { - return nil, "", err - } - return rootClone, unsafePath, lastError -} diff --git a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/procfs/procfs_linux.go b/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/procfs/procfs_linux.go deleted file mode 100644 index ec187a414..000000000 --- a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/procfs/procfs_linux.go +++ /dev/null @@ -1,157 +0,0 @@ -// SPDX-License-Identifier: MPL-2.0 - -//go:build linux - -// Copyright (C) 2024-2025 Aleksa Sarai -// Copyright (C) 2024-2025 SUSE LLC -// -// This Source Code Form is subject to the terms of the Mozilla Public -// License, v. 2.0. If a copy of the MPL was not distributed with this -// file, You can obtain one at https://mozilla.org/MPL/2.0/. - -// Package procfs provides a safe API for operating on /proc on Linux. -package procfs - -import ( - "os" - - "github.com/cyphar/filepath-securejoin/pathrs-lite/internal/procfs" -) - -// This package mostly just wraps internal/procfs APIs. This is necessary -// because we are forced to export some things from internal/procfs in order to -// avoid some dependency cycle issues, but we don't want users to see or use -// them. - -// ProcThreadSelfCloser is a callback that needs to be called when you are done -// operating on an [os.File] fetched using [Handle.OpenThreadSelf]. -// -// [os.File]: https://pkg.go.dev/os#File -type ProcThreadSelfCloser = procfs.ProcThreadSelfCloser - -// Handle is a wrapper around an *os.File handle to "/proc", which can be used -// to do further procfs-related operations in a safe way. -type Handle struct { - inner *procfs.Handle -} - -// Close close the resources associated with this [Handle]. Note that if this -// [Handle] was created with [OpenProcRoot], on some kernels the underlying -// procfs handle is cached and so this Close operation may be a no-op. However, -// you should always call Close on [Handle]s once you are done with them. -func (proc *Handle) Close() error { return proc.inner.Close() } - -// OpenProcRoot tries to open a "safer" handle to "/proc" (i.e., one with the -// "subset=pid" mount option applied, available from Linux 5.8). Unless you -// plan to do many [Handle.OpenRoot] operations, users should prefer to use -// this over [OpenUnsafeProcRoot] which is far more dangerous to keep open. -// -// If a safe handle cannot be opened, OpenProcRoot will fall back to opening a -// regular "/proc" handle. -// -// Note that using [Handle.OpenRoot] will still work with handles returned by -// this function. If a subpath cannot be operated on with a safe "/proc" -// handle, then [OpenUnsafeProcRoot] will be called internally and a temporary -// unsafe handle will be used. -func OpenProcRoot() (*Handle, error) { - proc, err := procfs.OpenProcRoot() - if err != nil { - return nil, err - } - return &Handle{inner: proc}, nil -} - -// OpenUnsafeProcRoot opens a handle to "/proc" without any overmounts or -// masked paths. You must be extremely careful to make sure this handle is -// never leaked to a container and that you program cannot be tricked into -// writing to arbitrary paths within it. -// -// This is not necessary if you just wish to use [Handle.OpenRoot], as handles -// returned by [OpenProcRoot] will fall back to using a *temporary* unsafe -// handle in that case. You should only really use this if you need to do many -// operations with [Handle.OpenRoot] and the performance overhead of making -// many procfs handles is an issue. If you do use OpenUnsafeProcRoot, you -// should make sure to close the handle as soon as possible to avoid -// known-fd-number attacks. -func OpenUnsafeProcRoot() (*Handle, error) { - proc, err := procfs.OpenUnsafeProcRoot() - if err != nil { - return nil, err - } - return &Handle{inner: proc}, nil -} - -// OpenThreadSelf returns a handle to "/proc/thread-self/" (or an -// equivalent handle on older kernels where "/proc/thread-self" doesn't exist). -// Once finished with the handle, you must call the returned closer function -// ([runtime.UnlockOSThread]). You must not pass the returned *os.File to other -// Go threads or use the handle after calling the closer. -// -// [runtime.UnlockOSThread]: https://pkg.go.dev/runtime#UnlockOSThread -func (proc *Handle) OpenThreadSelf(subpath string) (*os.File, ProcThreadSelfCloser, error) { - return proc.inner.OpenThreadSelf(subpath) -} - -// OpenSelf returns a handle to /proc/self/. -// -// Note that in Go programs with non-homogenous threads, this may result in -// spurious errors. If you are monkeying around with APIs that are -// thread-specific, you probably want to use [Handle.OpenThreadSelf] instead -// which will guarantee that the handle refers to the same thread as the caller -// is executing on. -func (proc *Handle) OpenSelf(subpath string) (*os.File, error) { - return proc.inner.OpenSelf(subpath) -} - -// OpenRoot returns a handle to /proc/. -// -// You should only use this when you need to operate on global procfs files -// (such as sysctls in /proc/sys). Unlike [Handle.OpenThreadSelf], -// [Handle.OpenSelf], and [Handle.OpenPid], the procfs handle used internally -// for this operation will never use "subset=pid", which makes it a more juicy -// target for [CVE-2024-21626]-style attacks (and doing something like opening -// a directory with OpenRoot effectively leaks [OpenUnsafeProcRoot] as long as -// the file descriptor is open). -// -// [CVE-2024-21626]: https://github.com/opencontainers/runc/security/advisories/GHSA-xr7r-f8xq-vfvv -func (proc *Handle) OpenRoot(subpath string) (*os.File, error) { - return proc.inner.OpenRoot(subpath) -} - -// OpenPid returns a handle to /proc/$pid/ (pid can be a pid or tid). -// This is mainly intended for usage when operating on other processes. -// -// You should not use this for the current thread, as special handling is -// needed for /proc/thread-self (or /proc/self/task/) when dealing with -// goroutine scheduling -- use [Handle.OpenThreadSelf] instead. -// -// To refer to the current thread-group, you should use prefer -// [Handle.OpenSelf] to passing os.Getpid as the pid argument. -func (proc *Handle) OpenPid(pid int, subpath string) (*os.File, error) { - return proc.inner.OpenPid(pid, subpath) -} - -// ProcSelfFdReadlink gets the real path of the given file by looking at -// /proc/self/fd/ with [readlink]. It is effectively just shorthand for -// something along the lines of: -// -// proc, err := procfs.OpenProcRoot() -// if err != nil { -// return err -// } -// link, err := proc.OpenThreadSelf(fmt.Sprintf("fd/%d", f.Fd())) -// if err != nil { -// return err -// } -// defer link.Close() -// var buf [4096]byte -// n, err := unix.Readlinkat(int(link.Fd()), "", buf[:]) -// if err != nil { -// return err -// } -// pathname := buf[:n] -// -// [readlink]: https://pkg.go.dev/golang.org/x/sys/unix#Readlinkat -func ProcSelfFdReadlink(f *os.File) (string, error) { - return procfs.ProcSelfFdReadlink(f) -} diff --git a/vendor/github.com/go-git/go-billy/v5/README.md b/vendor/github.com/go-git/go-billy/v5/README.md index da5c07478..f260f7944 100644 --- a/vendor/github.com/go-git/go-billy/v5/README.md +++ b/vendor/github.com/go-git/go-billy/v5/README.md @@ -5,6 +5,10 @@ Billy implements an interface based on the `os` standard library, allowing to de Billy was born as part of [go-git/go-git](https://github.com/go-git/go-git) project. +## Version support + +go-billy v5 is in maintenance mode. Users should upgrade to [go-billy v6](https://pkg.go.dev/github.com/go-git/go-billy/v6) where possible. + ## Installation ```go diff --git a/vendor/github.com/go-git/go-billy/v5/helper/chroot/chroot.go b/vendor/github.com/go-git/go-billy/v5/helper/chroot/chroot.go index dbdf11186..299d16537 100644 --- a/vendor/github.com/go-git/go-billy/v5/helper/chroot/chroot.go +++ b/vendor/github.com/go-git/go-billy/v5/helper/chroot/chroot.go @@ -3,19 +3,25 @@ package chroot import ( "errors" "os" + "path" "path/filepath" "strings" + "syscall" "github.com/go-git/go-billy/v5" "github.com/go-git/go-billy/v5/helper/polyfill" ) // ChrootHelper is a helper to implement billy.Chroot. +// It is not a security boundary, callers that need containment should use a +// filesystem implementation that enforces paths at the OS boundary instead. type ChrootHelper struct { underlying billy.Filesystem base string } +const maxFollowedSymlinks = 8 // Aligns with POSIX_SYMLOOP_MAX + // New creates a new filesystem wrapping up the given 'fs'. // The created filesystem has its base in the given ChrootHelperectory of the // underlying filesystem. @@ -34,15 +40,184 @@ func (fs *ChrootHelper) underlyingPath(filename string) (string, error) { return fs.Join(fs.Root(), filename), nil } -func isCrossBoundaries(path string) bool { - path = filepath.ToSlash(path) - path = filepath.Clean(path) +func (fs *ChrootHelper) followedPath(filename string, followFinal bool, op string) (string, error) { + fullpath, err := fs.underlyingPath(filename) + if err != nil { + return "", err + } - return strings.HasPrefix(path, ".."+string(filepath.Separator)) + sl, ok := fs.underlying.(billy.Symlink) + if !ok { + return fullpath, nil + } + + rel, err := fs.relativeToRoot(fullpath) + if err != nil { + return "", err + } + + fullpath, err = fs.resolveFollowedPath(rel, followFinal, op, sl) + if errors.Is(err, billy.ErrNotSupported) { + return fs.underlyingPath(filename) + } + + return fullpath, err +} + +func (fs *ChrootHelper) resolveFollowedPath(rel string, followFinal bool, op string, sl billy.Symlink) (string, error) { + if rel == "" { + return fs.resolveFollowedRoot(followFinal, op, sl) + } + + parts := splitRelativePath(rel) + resolved := "" + followed := 0 + + for len(parts) > 0 { + part := parts[0] + parts = parts[1:] + + currentRel := joinRelativePath(resolved, part) + currentPath := fs.Join(fs.Root(), currentRel) + if len(parts) == 0 && !followFinal { + return currentPath, nil + } + + fi, err := sl.Lstat(currentPath) + if err != nil { + if os.IsNotExist(err) { + return fs.Join(fs.Root(), joinRelativePath(append([]string{currentRel}, parts...)...)), nil + } + return "", err + } + + if fi.Mode()&os.ModeSymlink == 0 { + resolved = currentRel + continue + } + + followed++ + if followed > maxFollowedSymlinks { + return "", symlinkLoopError(op, currentPath) + } + + target, err := sl.Readlink(currentPath) + if err != nil { + return "", err + } + + targetRel, err := fs.linkTargetRel(currentPath, target) + if err != nil { + return "", err + } + if targetRel == currentRel { + return "", symlinkLoopError(op, currentPath) + } + + parts = append(splitRelativePath(targetRel), parts...) + resolved = "" + } + + return fs.Join(fs.Root(), resolved), nil +} + +func symlinkLoopError(op, path string) error { + return &os.PathError{Op: op, Path: path, Err: syscall.ELOOP} +} + +func (fs *ChrootHelper) resolveFollowedRoot(followFinal bool, op string, sl billy.Symlink) (string, error) { + root := fs.Join(fs.Root(), "") + if !followFinal { + return root, nil + } + + fi, err := sl.Lstat(root) + if err != nil { + if os.IsNotExist(err) { + return root, nil + } + return "", err + } + + if fi.Mode()&os.ModeSymlink == 0 { + return root, nil + } + + target, err := sl.Readlink(root) + if err != nil { + return "", err + } + + targetRel, err := fs.linkTargetRel(root, target) + if err != nil { + return root, err + } + if targetRel == "" { + return "", symlinkLoopError(op, root) + } + + return fs.resolveFollowedPath(targetRel, followFinal, op, sl) +} + +func (fs *ChrootHelper) relativeToRoot(filename string) (string, error) { + rel, err := filepath.Rel(filepath.Clean(fs.Root()), filepath.Clean(filename)) + if err != nil || isCrossBoundaries(rel) { + return "", billy.ErrCrossedBoundary + } + + if rel == "." { + return "", nil + } + return rel, nil +} + +func (fs *ChrootHelper) linkTargetRel(linkPath, target string) (string, error) { + target = filepath.FromSlash(target) + if filepath.IsAbs(target) || strings.HasPrefix(target, string(filepath.Separator)) { + return fs.relativeToRoot(target) + } + + return fs.relativeToRoot(fs.Join(filepath.Dir(linkPath), target)) +} + +func splitRelativePath(filename string) []string { + filename = filepath.Clean(filename) + if filename == "" || filename == "." { + return nil + } + + return strings.Split(filepath.ToSlash(filename), "/") +} + +func joinRelativePath(elem ...string) string { + parts := make([]string, 0, len(elem)) + for _, part := range elem { + if part == "" || part == "." { + continue + } + parts = append(parts, part) + } + + if len(parts) == 0 { + return "" + } + return filepath.Join(parts...) +} + +func isCreateExclusive(flag int) bool { + return flag&os.O_CREATE != 0 && flag&os.O_EXCL != 0 +} + +func isCrossBoundaries(name string) bool { + name = filepath.ToSlash(name) + name = strings.TrimLeft(name, "/") + name = path.Clean(name) + + return name == ".." || strings.HasPrefix(name, "../") } func (fs *ChrootHelper) Create(filename string) (billy.File, error) { - fullpath, err := fs.underlyingPath(filename) + fullpath, err := fs.followedPath(filename, true, "create") if err != nil { return nil, err } @@ -56,7 +231,7 @@ func (fs *ChrootHelper) Create(filename string) (billy.File, error) { } func (fs *ChrootHelper) Open(filename string) (billy.File, error) { - fullpath, err := fs.underlyingPath(filename) + fullpath, err := fs.followedPath(filename, true, "open") if err != nil { return nil, err } @@ -70,7 +245,7 @@ func (fs *ChrootHelper) Open(filename string) (billy.File, error) { } func (fs *ChrootHelper) OpenFile(filename string, flag int, mode os.FileMode) (billy.File, error) { - fullpath, err := fs.underlyingPath(filename) + fullpath, err := fs.followedPath(filename, !isCreateExclusive(flag), "open") if err != nil { return nil, err } @@ -84,12 +259,16 @@ func (fs *ChrootHelper) OpenFile(filename string, flag int, mode os.FileMode) (b } func (fs *ChrootHelper) Stat(filename string) (os.FileInfo, error) { - fullpath, err := fs.underlyingPath(filename) + fullpath, err := fs.followedPath(filename, true, "stat") if err != nil { return nil, err } - return fs.underlying.Stat(fullpath) + fi, err := fs.underlying.Stat(fullpath) + if err != nil { + return nil, err + } + return fileInfo{FileInfo: fi, name: filepath.Base(filename)}, nil } func (fs *ChrootHelper) Rename(from, to string) error { @@ -135,7 +314,7 @@ func (fs *ChrootHelper) TempFile(dir, prefix string) (billy.File, error) { } func (fs *ChrootHelper) ReadDir(path string) ([]os.FileInfo, error) { - fullpath, err := fs.underlyingPath(path) + fullpath, err := fs.followedPath(path, true, "readdir") if err != nil { return nil, err } @@ -241,6 +420,11 @@ type file struct { name string } +type fileInfo struct { + os.FileInfo + name string +} + func newFile(fs billy.Filesystem, f billy.File, filename string) billy.File { filename = fs.Join(fs.Root(), filename) filename, _ = filepath.Rel(fs.Root(), filename) @@ -254,3 +438,7 @@ func newFile(fs billy.Filesystem, f billy.File, filename string) billy.File { func (f *file) Name() string { return f.name } + +func (fi fileInfo) Name() string { + return fi.name +} diff --git a/vendor/github.com/go-git/go-billy/v5/osfs/os.go b/vendor/github.com/go-git/go-billy/v5/osfs/os.go index a7fe79f2f..0c240ef31 100644 --- a/vendor/github.com/go-git/go-billy/v5/osfs/os.go +++ b/vendor/github.com/go-git/go-billy/v5/osfs/os.go @@ -24,6 +24,9 @@ var Default = &ChrootOS{} // New returns a new OS filesystem. // By default paths are deduplicated, but still enforced // under baseDir. For more info refer to WithDeduplicatePath. +// +// New returns ChrootOS by default for v5 compatibility. Users should prefer +// New with WithBoundOS. func New(baseDir string, opts ...Option) billy.Filesystem { o := &options{ deduplicatePath: true, @@ -47,6 +50,8 @@ func WithBoundOS() Option { } // WithChrootOS returns the option of using a Chroot filesystem OS. +// +// Deprecated: use WithBoundOS instead. func WithChrootOS() Option { return func(o *options) { o.Type = ChrootOSFS diff --git a/vendor/github.com/go-git/go-billy/v5/osfs/os_bound.go b/vendor/github.com/go-git/go-billy/v5/osfs/os_bound.go index 92ebc3dc7..70e6a7232 100644 --- a/vendor/github.com/go-git/go-billy/v5/osfs/os_bound.go +++ b/vendor/github.com/go-git/go-billy/v5/osfs/os_bound.go @@ -20,6 +20,7 @@ package osfs import ( + "errors" "fmt" "os" "path/filepath" @@ -29,6 +30,31 @@ import ( "github.com/go-git/go-billy/v5" ) +var ( + // ErrBaseDirCannotBeRemoved is returned when removing the BoundOS base dir. + ErrBaseDirCannotBeRemoved = errors.New("base dir cannot be removed") + + // ErrBaseDirCannotBeRenamed is returned when renaming the BoundOS base dir. + ErrBaseDirCannotBeRenamed = errors.New("base dir cannot be renamed") + + dotPrefixes = dotPathPrefixes() + dotSeparators = dotPathSeparators() +) + +func dotPathPrefixes() []string { + if filepath.Separator == '\\' { + return []string{"./", ".\\"} + } + return []string{"./"} +} + +func dotPathSeparators() string { + if filepath.Separator == '\\' { + return `/\` + } + return `/` +} + // BoundOS is a fs implementation based on the OS filesystem which is bound to // a base dir. // Prefer this fs implementation over ChrootOS. @@ -54,6 +80,7 @@ func (fs *BoundOS) Create(filename string) (billy.File, error) { } func (fs *BoundOS) OpenFile(filename string, flag int, perm os.FileMode) (billy.File, error) { + filename = fs.expandDot(filename) fn, err := fs.abs(filename) if err != nil { return nil, err @@ -62,6 +89,7 @@ func (fs *BoundOS) OpenFile(filename string, flag int, perm os.FileMode) (billy. } func (fs *BoundOS) ReadDir(path string) ([]os.FileInfo, error) { + path = fs.expandDot(path) dir, err := fs.abs(path) if err != nil { return nil, err @@ -71,6 +99,12 @@ func (fs *BoundOS) ReadDir(path string) ([]os.FileInfo, error) { } func (fs *BoundOS) Rename(from, to string) error { + if fs.isBaseDir(from) { + return ErrBaseDirCannotBeRenamed + } + from = fs.expandDot(from) + to = fs.expandDot(to) + f, err := fs.abs(from) if err != nil { return err @@ -89,6 +123,7 @@ func (fs *BoundOS) Rename(from, to string) error { } func (fs *BoundOS) MkdirAll(path string, perm os.FileMode) error { + path = fs.expandDot(path) dir, err := fs.abs(path) if err != nil { return err @@ -101,6 +136,7 @@ func (fs *BoundOS) Open(filename string) (billy.File, error) { } func (fs *BoundOS) Stat(filename string) (os.FileInfo, error) { + filename = fs.expandDot(filename) filename, err := fs.abs(filename) if err != nil { return nil, err @@ -109,6 +145,11 @@ func (fs *BoundOS) Stat(filename string) (os.FileInfo, error) { } func (fs *BoundOS) Remove(filename string) error { + if fs.isBaseDir(filename) { + return ErrBaseDirCannotBeRemoved + } + filename = fs.expandDot(filename) + fn, err := fs.abs(filename) if err != nil { return err @@ -122,6 +163,7 @@ func (fs *BoundOS) Remove(filename string) error { func (fs *BoundOS) TempFile(dir, prefix string) (billy.File, error) { if dir != "" { var err error + dir = fs.expandDot(dir) dir, err = fs.abs(dir) if err != nil { return nil, err @@ -144,6 +186,11 @@ func (fs *BoundOS) Join(elem ...string) string { } func (fs *BoundOS) RemoveAll(path string) error { + if fs.isBaseDir(path) { + return ErrBaseDirCannotBeRemoved + } + path = fs.expandDot(path) + dir, err := fs.abs(path) if err != nil { return err @@ -152,6 +199,7 @@ func (fs *BoundOS) RemoveAll(path string) error { } func (fs *BoundOS) Symlink(target, link string) error { + link = fs.expandDot(link) ln, err := fs.abs(link) if err != nil { return err @@ -164,6 +212,7 @@ func (fs *BoundOS) Symlink(target, link string) error { } func (fs *BoundOS) Lstat(filename string) (os.FileInfo, error) { + filename = fs.expandDot(filename) filename = filepath.Clean(filename) if !filepath.IsAbs(filename) { filename = filepath.Join(fs.baseDir, filename) @@ -175,6 +224,7 @@ func (fs *BoundOS) Lstat(filename string) (os.FileInfo, error) { } func (fs *BoundOS) Readlink(link string) (string, error) { + link = fs.expandDot(link) if !filepath.IsAbs(link) { link = filepath.Clean(filepath.Join(fs.baseDir, link)) } @@ -185,6 +235,7 @@ func (fs *BoundOS) Readlink(link string) (string, error) { } func (fs *BoundOS) Chmod(path string, mode os.FileMode) error { + path = fs.expandDot(path) abspath, err := fs.abs(path) if err != nil { return err @@ -199,7 +250,7 @@ func (fs *BoundOS) Chroot(path string) (billy.Filesystem, error) { if err != nil { return nil, err } - return New(joined), nil + return New(joined, WithBoundOS()), nil } // Root returns the current base dir of the billy.Filesystem. @@ -220,6 +271,37 @@ func (fs *BoundOS) createDir(fullpath string) error { return nil } +func (fs *BoundOS) expandDot(path string) string { + if path == "." { + return fs.baseDir + } + for _, prefix := range dotPrefixes { + if strings.HasPrefix(path, prefix) { + path = strings.TrimLeft(strings.TrimPrefix(path, prefix), dotSeparators) + if path == "" { + return fs.baseDir + } + return path + } + } + return path +} + +func (fs *BoundOS) isBaseDir(path string) bool { + if path == "" || filepath.Clean(path) == "." { + return true + } + path = fs.expandDot(path) + if filepath.Clean(path) == filepath.Clean(fs.baseDir) { + return true + } + abspath, err := fs.abs(path) + if err != nil { + return false + } + return filepath.Clean(abspath) == filepath.Clean(fs.baseDir) +} + // abs transforms filename to an absolute path, taking into account the base dir. // Relative paths won't be allowed to ascend the base dir, so `../file` will become // `/working-dir/file`. @@ -233,7 +315,7 @@ func (fs *BoundOS) abs(filename string) (string, error) { path, err := securejoin.SecureJoin(fs.baseDir, filename) if err != nil { - return "", nil + return "", err } if fs.deduplicatePath { @@ -246,24 +328,12 @@ func (fs *BoundOS) abs(filename string) (string, error) { return path, nil } -// insideBaseDir checks whether filename is located within -// the fs.baseDir. -func (fs *BoundOS) insideBaseDir(filename string) (bool, error) { - if filename == fs.baseDir { - return true, nil - } - if !strings.HasPrefix(filename, fs.baseDir+string(filepath.Separator)) { - return false, fmt.Errorf("path outside base dir") - } - return true, nil -} - // insideBaseDirEval checks whether filename is contained within // a dir that is within the fs.baseDir, by first evaluating any symlinks // that either filename or fs.baseDir may contain. func (fs *BoundOS) insideBaseDirEval(filename string) (bool, error) { // "/" contains all others. - if fs.baseDir == "/" { + if fs.baseDir == "/" || fs.baseDir == filename { return true, nil } dir, err := filepath.EvalSymlinks(filepath.Dir(filename)) diff --git a/vendor/github.com/go-git/go-billy/v5/osfs/os_chroot.go b/vendor/github.com/go-git/go-billy/v5/osfs/os_chroot.go index 413b3b898..2fa9d8b53 100644 --- a/vendor/github.com/go-git/go-billy/v5/osfs/os_chroot.go +++ b/vendor/github.com/go-git/go-billy/v5/osfs/os_chroot.go @@ -14,6 +14,8 @@ import ( // ChrootOS is a legacy filesystem based on a "soft chroot" of the os filesystem. // Although this is still the default os filesystem, consider using BoundOS instead. // +// Deprecated: use New with WithBoundOS instead. +// // Behaviours of note: // 1. A "soft chroot" translates the base dir to "/" for the purposes of the // fs abstraction. @@ -24,6 +26,14 @@ import ( type ChrootOS struct{} func newChrootOS(baseDir string) billy.Filesystem { + if baseDir != "" { + resolved, err := filepath.EvalSymlinks(baseDir) + if err != nil { + return chroot.New(&ChrootOS{}, baseDir) + } + baseDir = resolved + } + return chroot.New(&ChrootOS{}, baseDir) } diff --git a/vendor/github.com/go-git/go-billy/v5/util/util.go b/vendor/github.com/go-git/go-billy/v5/util/util.go index 2cdd832c7..cd869d6e4 100644 --- a/vendor/github.com/go-git/go-billy/v5/util/util.go +++ b/vendor/github.com/go-git/go-billy/v5/util/util.go @@ -16,8 +16,6 @@ import ( // can but returns the first error it encounters. If the path does not exist, // RemoveAll returns nil (no error). func RemoveAll(fs billy.Basic, path string) error { - fs, path = getUnderlyingAndPath(fs, path) - if r, ok := fs.(removerAll); ok { return r.RemoveAll(path) } @@ -39,7 +37,7 @@ func removeAll(fs billy.Basic, path string) error { } // Otherwise, is this a directory we need to recurse into? - dir, serr := fs.Stat(path) + dir, serr := lstat(fs, path) if serr != nil { if errors.Is(serr, os.ErrNotExist) { return nil @@ -48,8 +46,8 @@ func removeAll(fs billy.Basic, path string) error { return serr } - if !dir.IsDir() { - // Not a directory; return the error from Remove. + if dir.Mode()&os.ModeSymlink != 0 || !dir.IsDir() { + // Not a directory we should recurse into; return the error from Remove. return err } @@ -62,7 +60,7 @@ func removeAll(fs billy.Basic, path string) error { fis, err := dirfs.ReadDir(path) if err != nil { if errors.Is(err, os.ErrNotExist) { - // Race. It was deleted between the Lstat and Open. + // Race. It was deleted between the Lstat and ReadDir. // Return nil per RemoveAll's docs. return nil } @@ -91,7 +89,18 @@ func removeAll(fs billy.Basic, path string) error { } return err +} +func lstat(filesystem billy.Basic, path string) (os.FileInfo, error) { + if sl, ok := filesystem.(billy.Symlink); ok { + // Avoid following a symlink substituted after the initial Remove fails. + fi, err := sl.Lstat(path) + if err == nil || !errors.Is(err, billy.ErrNotSupported) { + return fi, err + } + } + + return filesystem.Stat(path) } // WriteFile writes data to a file named by filename in the given filesystem. @@ -123,8 +132,10 @@ func WriteFile(fs billy.Basic, filename string, data []byte, perm os.FileMode) ( // We generate random temporary file names so that there's a good // chance the file doesn't exist yet - keeps the number of tries in // TempFile to a minimum. -var rand uint32 -var randmu sync.Mutex +var ( + rand uint32 + randmu sync.Mutex +) func reseed() uint32 { return uint32(time.Now().UnixNano() + int64(os.Getpid())) @@ -220,22 +231,6 @@ func getTempDir(fs billy.Basic) string { return ".tmp" } -type underlying interface { - Underlying() billy.Basic -} - -func getUnderlyingAndPath(fs billy.Basic, path string) (billy.Basic, string) { - u, ok := fs.(underlying) - if !ok { - return fs, path - } - if ch, ok := fs.(billy.Chroot); ok { - path = fs.Join(ch.Root(), path) - } - - return u.Underlying(), path -} - // ReadFile reads the named file and returns the contents from the given filesystem. // A successful call returns err == nil, not err == EOF. // Because ReadFile reads the whole file, it does not treat an EOF from Read diff --git a/vendor/github.com/go-git/go-git/v5/plumbing/object/commit.go b/vendor/github.com/go-git/go-git/v5/plumbing/object/commit.go index 78627b065..07034c10c 100644 --- a/vendor/github.com/go-git/go-git/v5/plumbing/object/commit.go +++ b/vendor/github.com/go-git/go-git/v5/plumbing/object/commit.go @@ -5,7 +5,7 @@ import ( "context" "errors" "fmt" - "io" + "slices" "strings" "github.com/ProtonMail/go-crypto/openpgp" @@ -20,6 +20,7 @@ const ( beginpgp string = "-----BEGIN PGP SIGNATURE-----" endpgp string = "-----END PGP SIGNATURE-----" headerpgp string = "gpgsig" + headerpgp256 string = "gpgsig-sha256" headerencoding string = "encoding" // https://github.com/git/git/blob/bcb6cae2966cc407ca1afc77413b3ef11103c175/Documentation/gitformat-signature.txt#L153 @@ -41,6 +42,11 @@ type MessageEncoding string // in time, such as a timestamp, the author of the changes since the last // commit, a pointer to the previous commit(s), etc. // http://shafiulazam.com/gitbook/1_the_git_object_model.html +// +// When a Commit is populated by Decode it retains a reference to the source +// plumbing.EncodedObject so that EncodeWithoutSignature can reproduce the +// exact bytes the signature was computed over. Refer to EncodeWithoutSignature +// for more information. type Commit struct { // Hash of the commit object. Hash plumbing.Hash @@ -66,6 +72,9 @@ type Commit struct { ExtraHeaders []ExtraHeader s storer.EncodedObjectStorer + // src holds the encoded object this Commit was decoded from, used by + // EncodeWithoutSignature to recover the canonical signed bytes. + src plumbing.EncodedObject } // ExtraHeader holds any non-standard header @@ -98,8 +107,8 @@ func (h ExtraHeader) Format(f fmt.State, verb rune) { func parseExtraHeader(line []byte) (ExtraHeader, bool) { split := bytes.SplitN(line, []byte{' '}, 2) - out := ExtraHeader { - Key: string(bytes.TrimRight(split[0], "\n")), + out := ExtraHeader{ + Key: string(bytes.TrimRight(split[0], "\n")), Value: "", } @@ -181,6 +190,11 @@ func (c *Commit) NumParents() int { var ErrParentNotFound = errors.New("commit parent not found") +// ErrMalformedCommit is returned when a commit object cannot be decoded +// because its standard headers (tree, parent, author, committer) are missing, +// duplicated, or out of order. +var ErrMalformedCommit = errors.New("malformed commit") + // Parent returns the ith parent of a commit. func (c *Commit) Parent(i int) (*Commit, error) { if len(c.ParentHashes) == 0 || i > len(c.ParentHashes)-1 { @@ -227,14 +241,23 @@ func (c *Commit) Type() plumbing.ObjectType { return plumbing.CommitObject } +func (c *Commit) reset() { + storer := c.s + *c = Commit{ + Encoding: defaultUtf8CommitMessageEncoding, + s: storer, + } +} + // Decode transforms a plumbing.EncodedObject into a Commit struct. func (c *Commit) Decode(o plumbing.EncodedObject) (err error) { if o.Type() != plumbing.CommitObject { return ErrUnsupportedObject } + c.reset() c.Hash = o.Hash() - c.Encoding = defaultUtf8CommitMessageEncoding + c.src = o reader, err := o.Reader() if err != nil { @@ -245,97 +268,17 @@ func (c *Commit) Decode(o plumbing.EncodedObject) (err error) { r := sync.GetBufioReader(reader) defer sync.PutBufioReader(r) - var message bool - var mergetag bool - var pgpsig bool - var msgbuf bytes.Buffer - var extraheader *ExtraHeader = nil - for { - line, err := r.ReadBytes('\n') - if err != nil && err != io.EOF { + s := &commitScanner{r: r, c: c} + for state := scanTree; state != nil; { + state, err = state(s) + if err != nil { return err } - - if mergetag { - if len(line) > 0 && line[0] == ' ' { - line = bytes.TrimLeft(line, " ") - c.MergeTag += string(line) - continue - } else { - mergetag = false - } - } - - if pgpsig { - if len(line) > 0 && line[0] == ' ' { - line = bytes.TrimLeft(line, " ") - c.PGPSignature += string(line) - continue - } else { - pgpsig = false - } - } - - if extraheader != nil { - if len(line) > 0 && line[0] == ' ' { - extraheader.Value += string(line[1:]) - continue - } else { - extraheader.Value = strings.TrimRight(extraheader.Value, "\n") - c.ExtraHeaders = append(c.ExtraHeaders, *extraheader) - extraheader = nil - } - } - - if !message { - original_line := line - line = bytes.TrimSpace(line) - if len(line) == 0 { - message = true - continue - } - - split := bytes.SplitN(line, []byte{' '}, 2) - - var data []byte - if len(split) == 2 { - data = split[1] - } - - switch string(split[0]) { - case "tree": - c.TreeHash = plumbing.NewHash(string(data)) - case "parent": - c.ParentHashes = append(c.ParentHashes, plumbing.NewHash(string(data))) - case "author": - c.Author.Decode(data) - case "committer": - c.Committer.Decode(data) - case headermergetag: - c.MergeTag += string(data) + "\n" - mergetag = true - case headerencoding: - c.Encoding = MessageEncoding(data) - case headerpgp: - c.PGPSignature += string(data) + "\n" - pgpsig = true - default: - h, maybecontinued := parseExtraHeader(original_line) - if maybecontinued { - extraheader = &h - } else { - c.ExtraHeaders = append(c.ExtraHeaders, h) - } - } - } else { - msgbuf.Write(line) - } - - if err == io.EOF { - break - } } - c.Message = msgbuf.String() + if !s.sawTree { + return fmt.Errorf("%w: missing tree header", ErrMalformedCommit) + } + c.Message = s.msgbuf.String() return nil } @@ -344,11 +287,73 @@ func (c *Commit) Encode(o plumbing.EncodedObject) error { return c.encode(o, true) } -// EncodeWithoutSignature export a Commit into a plumbing.EncodedObject without the signature (correspond to the payload of the PGP signature). +// EncodeWithoutSignature exports a Commit into a plumbing.EncodedObject +// without any signature headers, producing the payload that PGP/GPG +// signatures are computed over. +// +// Behaviour depends on how the Commit was created: +// +// - For Commits populated by Decode whose exported fields still match the +// source object, the payload is streamed from the raw source bytes with +// gpgsig and gpgsig-sha256 headers (and their continuation lines) +// stripped verbatim. This preserves the exact bytes the signature was +// computed over, regardless of any normalization performed by Decode. +// +// - For Commits constructed in memory, or for decoded Commits whose +// exported fields have been mutated, the payload is derived from the +// current struct fields. Mutation is detected by re-decoding the source +// object and comparing exported fields; if any differ, the in-memory +// representation prevails. func (c *Commit) EncodeWithoutSignature(o plumbing.EncodedObject) error { + if c.matchesSource() { + return stripObjectSignatures(o, c.src, plumbing.CommitObject) + } return c.encode(o, false) } +// matchesSource reports whether c.src is set and re-decoding it produces a +// Commit whose payload-affecting exported fields are identical to those of +// c. It is the auto-detection used by EncodeWithoutSignature to decide +// between the raw bytes and the struct-encoded payload. +// +// PGPSignature is intentionally excluded from the comparison: neither path +// emits it, so mutating it must not trigger a switch to struct-encode (which +// would change the byte layout the caller is trying to verify against). +func (c *Commit) matchesSource() bool { + if c.src == nil { + return false + } + fresh := &Commit{} + if err := fresh.Decode(c.src); err != nil { + return false + } + return c.Hash == fresh.Hash && + signatureEqual(c.Author, fresh.Author) && + signatureEqual(c.Committer, fresh.Committer) && + c.MergeTag == fresh.MergeTag && + c.Message == fresh.Message && + c.TreeHash == fresh.TreeHash && + c.Encoding == fresh.Encoding && + slices.Equal(c.ParentHashes, fresh.ParentHashes) && + slices.Equal(c.ExtraHeaders, fresh.ExtraHeaders) +} + +func signatureEqual(a, b Signature) bool { + return a.Name == b.Name && + a.Email == b.Email && + a.When.Unix() == b.When.Unix() && + a.When.Format("-0700") == b.When.Format("-0700") +} + +func isStandardHeader(key string) bool { + switch key { + case "tree", "parent", "author", "committer", + headerencoding, headermergetag, headerpgp, headerpgp256: + return true + } + return false +} + func (c *Commit) encode(o plumbing.EncodedObject, includeSig bool) (err error) { o.SetType(plumbing.CommitObject) w, err := o.Writer() @@ -407,7 +412,9 @@ func (c *Commit) encode(o plumbing.EncodedObject, includeSig bool) (err error) { } for _, header := range c.ExtraHeaders { - + if isStandardHeader(header.Key) { + continue + } if _, err = fmt.Fprintf(w, "\n%s", header); err != nil { return err } @@ -478,9 +485,21 @@ func (c *Commit) String() string { ) } +// ErrMultipleSignatures is returned by Verify when the commit carries more +// than one armored signature block. Mirrors upstream's parse_gpg_output +// rejection of GOODSIG/BADSIG status lines after the first +// (gpg-interface.c:257-269): multi-signature commits are intentionally +// unsupported because their provenance cannot be reduced to a single +// authoritative signer. +var ErrMultipleSignatures = errors.New("commit has multiple signatures") + // Verify performs PGP verification of the commit with a provided armored // keyring and returns openpgp.Entity associated with verifying key on success. func (c *Commit) Verify(armoredKeyRing string) (*openpgp.Entity, error) { + if countSignatureBlocks([]byte(c.PGPSignature)) > 1 { + return nil, ErrMultipleSignatures + } + keyRingReader := strings.NewReader(armoredKeyRing) keyring, err := openpgp.ReadArmoredKeyRing(keyRingReader) if err != nil { diff --git a/vendor/github.com/go-git/go-git/v5/plumbing/object/commit_scanner.go b/vendor/github.com/go-git/go-git/v5/plumbing/object/commit_scanner.go new file mode 100644 index 000000000..7e4cf5441 --- /dev/null +++ b/vendor/github.com/go-git/go-git/v5/plumbing/object/commit_scanner.go @@ -0,0 +1,377 @@ +package object + +import ( + "bufio" + "bytes" + "fmt" + "io" + "strings" + + "github.com/go-git/go-git/v5/plumbing" +) + +// commitScanner holds the working state of the commit decoder driven by the +// stateFn loop in (*Commit).Decode. Each commitState reads one or more lines +// from r, updates the in-progress *Commit and the scanner's bookkeeping, and +// returns the state that should run next (or nil to stop). +type commitScanner struct { + r *bufio.Reader + c *Commit + msgbuf bytes.Buffer + + // pending holds a line that was read but the current state decided to + // hand back to the next state, paired with the io.EOF flag that was + // returned when the line was originally read. + pending []byte + pendingErr error + + // First-occurrence tracking: once the corresponding field has been + // decoded, subsequent occurrences are silently dropped (matches + // upstream's find_commit_header / first-wins semantics). + // + // gpgsig is not tracked here: upstream's parse_buffer_signed_by_header + // (commit.c:1186) accumulates every occurrence into one signature buffer, + // so we do the same on the scanner side to keep verification payloads + // byte-aligned. gpgsig-sha256 is recognized and skipped without exposing a + // new field in v5. + sawTree, sawAuthor, sawCommitter bool + sawEncoding, sawMergetag bool + + // extra is the multi-line ExtraHeader currently being assembled. + extra *ExtraHeader +} + +// commitState is one step of the decoder state machine. Each function reads +// the lines it needs, mutates *Commit via s.c, and returns the next state to +// run (or nil to terminate the loop). +type commitState func(*commitScanner) (commitState, error) + +// readLine returns the next line from the buffer, transparently consuming any +// line that was previously pushed back by a state that decided not to handle +// it. +func (s *commitScanner) readLine() ([]byte, error) { + if s.pending != nil { + line, err := s.pending, s.pendingErr + s.pending, s.pendingErr = nil, nil + return line, err + } + line, err := s.r.ReadBytes('\n') + if err != nil && err != io.EOF { + return line, err + } + return line, err +} + +// pushBack stashes an unconsumed line so the next state's readLine call sees +// it. Only one line can be pushed back at a time. +func (s *commitScanner) pushBack(line []byte, err error) { + s.pending = line + s.pendingErr = err +} + +// scanTree expects the first non-empty header to be `tree HASH`. Anything +// else (or an empty buffer) is rejected with ErrMalformedCommit, matching +// upstream's `bogus commit object` check. +func scanTree(s *commitScanner) (commitState, error) { + line, err := s.readLine() + if err != nil && err != io.EOF { + return nil, err + } + if len(line) == 0 || isBlankLine(line) { + return nil, fmt.Errorf("%w: missing tree header", ErrMalformedCommit) + } + + key, data := splitHeader(line) + if key != "tree" { + return nil, fmt.Errorf("%w: tree header must be first", ErrMalformedCommit) + } + h, herr := parseObjectIDHex(data, ErrMalformedCommit, "tree") + if herr != nil { + return nil, herr + } + s.c.TreeHash = h + s.sawTree = true + if err == io.EOF { + return nil, nil + } + return scanParents, nil +} + +// scanParents consumes contiguous `parent HASH` lines. The first non-parent +// line ends the parent block and is handed off to scanAuthor; any later +// `parent` line is silently dropped (matches upstream's parse_commit_buffer +// exiting its parent loop at the first non-parent line and +// read_commit_extra_header_lines filtering `parent` out of extras). +func scanParents(s *commitScanner) (commitState, error) { + line, err := s.readLine() + if err != nil && err != io.EOF { + return nil, err + } + if len(line) == 0 { + return nil, nil + } + if isBlankLine(line) { + return scanMessage, nil + } + + key, data := splitHeader(line) + if key == "parent" { + h, herr := parseObjectIDHex(data, ErrMalformedCommit, "parent") + if herr != nil { + return nil, herr + } + s.c.ParentHashes = append(s.c.ParentHashes, h) + if err == io.EOF { + return nil, nil + } + return scanParents, nil + } + s.pushBack(line, err) + return scanAuthor, nil +} + +// scanAuthor accepts an `author` line at its canonical position immediately +// after the parent block. Any other header here is pushed back for +// scanCommitter; an out-of-place author is therefore silently dropped. +// Mirrors upstream's parse_commit_date func. +func scanAuthor(s *commitScanner) (commitState, error) { + line, err := s.readLine() + if err != nil && err != io.EOF { + return nil, err + } + if len(line) == 0 { + return nil, nil + } + if isBlankLine(line) { + return scanMessage, nil + } + + key, data := splitHeader(line) + if key == "author" { + s.c.Author.Decode(data) + s.sawAuthor = true + if err == io.EOF { + return nil, nil + } + return scanCommitter, nil + } + s.pushBack(line, err) + return scanCommitter, nil +} + +// scanCommitter accepts a `committer` line at its canonical position +// immediately after the author. Any other header is pushed back for +// scanHeaders. Same upstream rationale as scanAuthor. +func scanCommitter(s *commitScanner) (commitState, error) { + line, err := s.readLine() + if err != nil && err != io.EOF { + return nil, err + } + if len(line) == 0 { + return nil, nil + } + if isBlankLine(line) { + return scanMessage, nil + } + + key, data := splitHeader(line) + if key == "committer" { + s.c.Committer.Decode(data) + s.sawCommitter = true + if err == io.EOF { + return nil, nil + } + return scanHeaders, nil + } + s.pushBack(line, err) + return scanHeaders, nil +} + +// scanHeaders dispatches one header line. Continuation-bearing headers +// (mergetag, gpgsig, gpgsig-sha256, and unknown extras whose value is +// continued on subsequent lines) hand off to a dedicated continuation state +// that handles the `...` lines and then returns here. +func scanHeaders(s *commitScanner) (commitState, error) { + line, err := s.readLine() + if err != nil && err != io.EOF { + return nil, err + } + if len(line) == 0 { + return nil, nil + } + if isBlankLine(line) { + return scanMessage, nil + } + + originalLine := line + key, data := splitHeader(line) + + var next commitState = scanHeaders + switch key { + case "tree", "parent", "author", "committer": + // Anything reaching scanHeaders with one of these keys is out of + // canonical position: duplicate tree, parent past the contiguous + // block, or author/committer not at their expected slot. Drop them + // the same way upstream's standard_header_field filter excludes + // them from the extras list (read_commit_extra_header_lines, + // commit.c:1520-1522). + case headerencoding: + if !s.sawEncoding { + s.c.Encoding = MessageEncoding(data) + s.sawEncoding = true + } + case headermergetag: + if s.sawMergetag { + next = scanSkipCont + } else { + s.c.MergeTag += string(data) + "\n" + s.sawMergetag = true + next = scanMergetagCont + } + case headerpgp: + s.c.PGPSignature += string(data) + "\n" + next = scanPgpCont + case headerpgp256: + next = scanSkipCont + default: + h, multiline := parseExtraHeader(originalLine) + if multiline { + s.extra = &h + next = scanExtraCont + } else { + s.c.ExtraHeaders = append(s.c.ExtraHeaders, h) + } + } + + if err == io.EOF { + return nil, nil + } + return next, nil +} + +// scanMergetagCont accumulates continuation lines for the first mergetag +// header. Continuations strip exactly one leading space, mirroring upstream's +// `line + 1` (commit.c:1509). The first non-continuation line is pushed back +// so scanHeaders can dispatch it. +func scanMergetagCont(s *commitScanner) (commitState, error) { + return continuationCont(s, &s.c.MergeTag, scanMergetagCont) +} + +// scanPgpCont accumulates continuation lines for a signature header. +// Continuations strip exactly one leading space, mirroring upstream's +// `line + 1` (commit.c:1509). The first non-continuation line is pushed back +// so scanHeaders can dispatch it. Repeat occurrences of the same signature +// header land back here and concatenate, matching upstream's +// parse_buffer_signed_by_header (commit.c:1186). +func scanPgpCont(s *commitScanner) (commitState, error) { + return continuationCont(s, &s.c.PGPSignature, scanPgpCont) +} + +func continuationCont(s *commitScanner, dst *string, self commitState) (commitState, error) { + line, err := s.readLine() + if err != nil && err != io.EOF { + return nil, err + } + if len(line) > 0 && line[0] == ' ' { + *dst += string(line[1:]) + if err == io.EOF { + return nil, nil + } + return self, nil + } + if len(line) > 0 { + s.pushBack(line, err) + } + return scanHeaders, nil +} + +// scanSkipCont discards continuation lines that belong to a header scanHeaders +// chose to drop. +func scanSkipCont(s *commitScanner) (commitState, error) { + line, err := s.readLine() + if err != nil && err != io.EOF { + return nil, err + } + if len(line) > 0 && line[0] == ' ' { + if err == io.EOF { + return nil, nil + } + return scanSkipCont, nil + } + if len(line) > 0 { + s.pushBack(line, err) + } + return scanHeaders, nil +} + +// scanExtraCont accumulates continuation lines for an unknown ExtraHeader +// whose value spans multiple lines, then finalises the entry once the +// continuation block ends. +func scanExtraCont(s *commitScanner) (commitState, error) { + line, err := s.readLine() + if err != nil && err != io.EOF { + return nil, err + } + if len(line) > 0 && line[0] == ' ' { + s.extra.Value += string(line[1:]) + if err == io.EOF { + s.finaliseExtra() + return nil, nil + } + return scanExtraCont, nil + } + s.finaliseExtra() + if len(line) > 0 { + s.pushBack(line, err) + } + return scanHeaders, nil +} + +func (s *commitScanner) finaliseExtra() { + s.extra.Value = strings.TrimRight(s.extra.Value, "\n") + s.c.ExtraHeaders = append(s.c.ExtraHeaders, *s.extra) + s.extra = nil +} + +// scanMessage drains the remaining bytes into the message buffer. +func scanMessage(s *commitScanner) (commitState, error) { + for { + line, err := s.readLine() + if err != nil && err != io.EOF { + return nil, err + } + if len(line) > 0 { + s.msgbuf.Write(line) + } + if err == io.EOF { + return nil, nil + } + } +} + +// isBlankLine reports whether line is the canonical header/body separator: +// a single newline. Mirrors upstream's `*line == '\n'` test in +// read_commit_extra_header_lines (commit.c:1502). +func isBlankLine(line []byte) bool { + return len(line) == 1 && line[0] == '\n' +} + +// splitHeader returns the header keyword (everything before the first space) +// and the value (everything after, with the trailing newline stripped). If +// the header has no value the returned data is nil. +func splitHeader(line []byte) (string, []byte) { + trimmed := bytes.TrimRight(line, "\n") + key, value, ok := bytes.Cut(trimmed, []byte{' '}) + if !ok { + return string(trimmed), nil + } + return string(key), value +} + +func parseObjectIDHex(data []byte, malformedErr error, header string) (plumbing.Hash, error) { + id := string(data) + if !plumbing.IsHash(id) { + return plumbing.ZeroHash, fmt.Errorf("%w: bad %s hash", malformedErr, header) + } + return plumbing.NewHash(id), nil +} diff --git a/vendor/github.com/go-git/go-git/v5/plumbing/object/signature.go b/vendor/github.com/go-git/go-git/v5/plumbing/object/signature.go index f9c3d306b..3346e4fd1 100644 --- a/vendor/github.com/go-git/go-git/v5/plumbing/object/signature.go +++ b/vendor/github.com/go-git/go-git/v5/plumbing/object/signature.go @@ -1,6 +1,13 @@ package object -import "bytes" +import ( + "bytes" + "io" + + "github.com/go-git/go-git/v5/plumbing" + "github.com/go-git/go-git/v5/utils/ioutil" + "github.com/go-git/go-git/v5/utils/sync" +) const ( signatureTypeUnknown signatureType = iota @@ -100,3 +107,116 @@ func parseSignedBytes(b []byte) (int, signatureType) { } return match, t } + +// countSignatureBlocks reports how many distinct armored signature blocks +// start at a line boundary in b. Used by verification paths to reject +// multi-signature payloads, matching upstream's check in gpg-interface.c +// where parse_gpg_output bails out the first time it sees a second +// exclusive status line (a second GOODSIG/BADSIG/etc.). +func countSignatureBlocks(b []byte) int { + n, count := 0, 0 + for n < len(b) { + i := b[n:] + if typeForSignature(i) != signatureTypeUnknown { + count++ + } + if eol := bytes.IndexByte(i, '\n'); eol >= 0 { + n += eol + 1 + continue + } + break + } + return count +} + +// isSignatureHeader reports whether line is a canonical "gpgsig "/ +// "gpgsig-sha256 " header line. Other "gpgsig"-prefixed extra headers +// are intentionally not matched. +func isSignatureHeader(line []byte) bool { + return bytes.HasPrefix(line, []byte(headerpgp+" ")) || + bytes.HasPrefix(line, []byte(headerpgp256+" ")) +} + +// stripObjectSignatures streams src into dst, producing the byte sequence +// over which a PGP/GPG signature is computed: +// +// - Canonical "gpgsig" and "gpgsig-sha256" headers (and their +// continuation lines) are dropped, mirroring upstream's +// remove_signature in commit.c. +// - For tag objects, the inline trailing PGP signature is additionally +// truncated, mirroring upstream's parse_signature in gpg-interface.c +// used by gpg_verify_tag. +// +// The returned object's type is set to objType. Used by both +// Commit.EncodeWithoutSignature and Tag.EncodeWithoutSignature to +// reproduce the exact bytes the signature was computed over. +func stripObjectSignatures(dst, src plumbing.EncodedObject, objType plumbing.ObjectType) (err error) { + dst.SetType(objType) + + r, err := src.Reader() + if err != nil { + return err + } + defer ioutil.CheckClose(r, &err) + + var input io.Reader = r + if objType == plumbing.TagObject { + raw, err := io.ReadAll(r) + if err != nil { + return err + } + if sm, _ := parseSignedBytes(raw); sm >= 0 { + raw = raw[:sm] + } + input = bytes.NewReader(raw) + } + + w, err := dst.Writer() + if err != nil { + return err + } + defer ioutil.CheckClose(w, &err) + + return stripHeaderSignatures(w, input) +} + +// stripHeaderSignatures copies r to w, dropping canonical signature header +// lines (gpgsig and gpgsig-sha256) and their continuation lines. Lines +// past the blank line that closes the header block are copied verbatim. +func stripHeaderSignatures(w io.Writer, r io.Reader) error { + br := sync.GetBufioReader(r) + defer sync.PutBufioReader(br) + + var inBody, skipping bool + for { + line, rerr := br.ReadBytes('\n') + if rerr != nil && rerr != io.EOF { + return rerr + } + + write := true + if !inBody { + switch { + case skipping && len(line) > 0 && line[0] == ' ': + write = false + case isSignatureHeader(line): + skipping = true + write = false + case len(line) == 1 && line[0] == '\n': + skipping = false + inBody = true + default: + skipping = false + } + } + + if write && len(line) > 0 { + if _, werr := w.Write(line); werr != nil { + return werr + } + } + if rerr == io.EOF { + return nil + } + } +} diff --git a/vendor/github.com/go-git/go-git/v5/plumbing/object/tag.go b/vendor/github.com/go-git/go-git/v5/plumbing/object/tag.go index cf46c08e1..93e56a4a5 100644 --- a/vendor/github.com/go-git/go-git/v5/plumbing/object/tag.go +++ b/vendor/github.com/go-git/go-git/v5/plumbing/object/tag.go @@ -1,9 +1,8 @@ package object import ( - "bytes" + "errors" "fmt" - "io" "strings" "github.com/ProtonMail/go-crypto/openpgp" @@ -13,6 +12,10 @@ import ( "github.com/go-git/go-git/v5/utils/sync" ) +// ErrMalformedTag is returned when a tag object cannot be decoded because +// its required headers (object, type, tag) are missing or out of order. +var ErrMalformedTag = errors.New("malformed tag") + // Tag represents an annotated tag object. It points to a single git object of // any type, but tags typically are applied to commit or blob objects. It // provides a reference that associates the target with a tag name. It also @@ -39,6 +42,9 @@ type Tag struct { Target plumbing.Hash s storer.EncodedObjectStorer + // src holds the encoded object this Tag was decoded from, used by + // EncodeWithoutSignature to recover the canonical signed bytes. + src plumbing.EncodedObject } // GetTag gets a tag from an object storer and decodes it. @@ -77,13 +83,20 @@ func (t *Tag) Type() plumbing.ObjectType { return plumbing.TagObject } +func (t *Tag) reset() { + storer := t.s + *t = Tag{s: storer} +} + // Decode transforms a plumbing.EncodedObject into a Tag struct. func (t *Tag) Decode(o plumbing.EncodedObject) (err error) { if o.Type() != plumbing.TagObject { return ErrUnsupportedObject } + t.reset() t.Hash = o.Hash() + t.src = o reader, err := o.Reader() if err != nil { @@ -94,42 +107,15 @@ func (t *Tag) Decode(o plumbing.EncodedObject) (err error) { r := sync.GetBufioReader(reader) defer sync.PutBufioReader(r) - for { - var line []byte - line, err = r.ReadBytes('\n') - if err != nil && err != io.EOF { + scanner := &tagScanner{r: r, t: t} + for state := scanTagObject; state != nil; { + state, err = state(scanner) + if err != nil { return err } - - line = bytes.TrimSpace(line) - if len(line) == 0 { - break // Start of message - } - - split := bytes.SplitN(line, []byte{' '}, 2) - switch string(split[0]) { - case "object": - t.Target = plumbing.NewHash(string(split[1])) - case "type": - t.TargetType, err = plumbing.ParseObjectType(string(split[1])) - if err != nil { - return err - } - case "tag": - t.Name = string(split[1]) - case "tagger": - t.Tagger.Decode(split[1]) - } - - if err == io.EOF { - return nil - } } - data, err := io.ReadAll(r) - if err != nil { - return err - } + data := scanner.msgbuf.Bytes() if sm, _ := parseSignedBytes(data); sm >= 0 { t.PGPSignature = string(data[sm:]) data = data[:sm] @@ -144,11 +130,54 @@ func (t *Tag) Encode(o plumbing.EncodedObject) error { return t.encode(o, true) } -// EncodeWithoutSignature export a Tag into a plumbing.EncodedObject without the signature (correspond to the payload of the PGP signature). +// EncodeWithoutSignature exports a Tag into a plumbing.EncodedObject without +// any signature data, producing the payload that PGP/GPG signatures are +// computed over. +// +// Behaviour mirrors Commit.EncodeWithoutSignature: +// +// - For Tags populated by Decode whose exported fields still match the +// source object, the payload is streamed from the raw source bytes with +// the inline trailing signature truncated and gpgsig/gpgsig-sha256 +// headers (and their continuation lines) stripped verbatim. This +// preserves the exact bytes the signature was computed over, regardless +// of any normalization performed by Decode. +// +// - For Tags constructed in memory, or for decoded Tags whose exported +// fields have been mutated, the payload is derived from the current +// struct fields. Mutation is detected by re-decoding the source object +// and comparing exported fields; if any differ, the in-memory +// representation prevails. func (t *Tag) EncodeWithoutSignature(o plumbing.EncodedObject) error { + if t.matchesSource() { + return stripObjectSignatures(o, t.src, plumbing.TagObject) + } return t.encode(o, false) } +// matchesSource reports whether t.src is set and re-decoding it produces a +// Tag whose payload-affecting exported fields are identical to those of t. +// +// PGPSignature is intentionally excluded from the comparison: neither path +// emits it as part of the verification payload, so mutating it must not +// trigger a switch to struct-encode (which would change the byte layout the +// caller is trying to verify against). +func (t *Tag) matchesSource() bool { + if t.src == nil { + return false + } + fresh := &Tag{} + if err := fresh.Decode(t.src); err != nil { + return false + } + return t.Hash == fresh.Hash && + t.Name == fresh.Name && + signatureEqual(t.Tagger, fresh.Tagger) && + t.Message == fresh.Message && + t.TargetType == fresh.TargetType && + t.Target == fresh.Target +} + func (t *Tag) encode(o plumbing.EncodedObject, includeSig bool) (err error) { o.SetType(plumbing.TagObject) w, err := o.Writer() @@ -158,16 +187,26 @@ func (t *Tag) encode(o plumbing.EncodedObject, includeSig bool) (err error) { defer ioutil.CheckClose(w, &err) if _, err = fmt.Fprintf(w, - "object %s\ntype %s\ntag %s\ntagger ", + "object %s\ntype %s\ntag %s\n", t.Target.String(), t.TargetType.Bytes(), t.Name); err != nil { return err } - if err = t.Tagger.Encode(w); err != nil { - return err + if !isZeroSignature(t.Tagger) { + if _, err = fmt.Fprint(w, "tagger "); err != nil { + return err + } + + if err = t.Tagger.Encode(w); err != nil { + return err + } + + if _, err = fmt.Fprint(w, "\n"); err != nil { + return err + } } - if _, err = fmt.Fprint(w, "\n\n"); err != nil { + if _, err = fmt.Fprint(w, "\n"); err != nil { return err } @@ -175,11 +214,12 @@ func (t *Tag) encode(o plumbing.EncodedObject, includeSig bool) (err error) { return err } - // Note that this is highly sensitive to what it sent along in the message. - // Message *always* needs to end with a newline, or else the message and the - // signature will be concatenated into a corrupt object. Since this is a - // lower-level method, we assume you know what you are doing and have already - // done the needful on the message in the caller. + // Note that this is highly sensitive to what is sent along in the + // message. Message *always* needs to end with a newline, or else the + // message and the trailing signature will be concatenated into a + // corrupt object. Since this is a lower-level method, we assume you + // know what you are doing and have already done the needful on the + // message in the caller. if includeSig { if _, err = fmt.Fprint(w, t.PGPSignature); err != nil { return err @@ -189,6 +229,10 @@ func (t *Tag) encode(o plumbing.EncodedObject, includeSig bool) (err error) { return err } +func isZeroSignature(s Signature) bool { + return s.Name == "" && s.Email == "" && s.When.IsZero() +} + // Commit returns the commit pointed to by the tag. If the tag points to a // different type of object ErrUnsupportedObject will be returned. func (t *Tag) Commit() (*Commit, error) { @@ -256,7 +300,8 @@ func (t *Tag) String() string { } // Verify performs PGP verification of the tag with a provided armored -// keyring and returns openpgp.Entity associated with verifying key on success. +// keyring and returns openpgp.Entity associated with verifying key on +// success. func (t *Tag) Verify(armoredKeyRing string) (*openpgp.Entity, error) { keyRingReader := strings.NewReader(armoredKeyRing) keyring, err := openpgp.ReadArmoredKeyRing(keyRingReader) diff --git a/vendor/github.com/go-git/go-git/v5/plumbing/object/tag_scanner.go b/vendor/github.com/go-git/go-git/v5/plumbing/object/tag_scanner.go new file mode 100644 index 000000000..2bfb3a1d7 --- /dev/null +++ b/vendor/github.com/go-git/go-git/v5/plumbing/object/tag_scanner.go @@ -0,0 +1,237 @@ +package object + +import ( + "bufio" + "bytes" + "fmt" + "io" + + "github.com/go-git/go-git/v5/plumbing" +) + +// tagScanner holds the working state of the tag decoder driven by the +// stateFn loop in (*Tag).Decode. Each tagState reads one or more lines +// from r, updates the in-progress *Tag and the scanner's bookkeeping, +// and returns the state that should run next (or nil to stop). +type tagScanner struct { + r *bufio.Reader + t *Tag + msgbuf bytes.Buffer + + // pending holds a line that was read but the current state decided to + // hand back to the next state, paired with the io.EOF flag returned + // when the line was originally read. + pending []byte + pendingErr error + + // First-occurrence tracking: once the corresponding canonical + // header has been decoded at its expected position, subsequent + // occurrences (or out-of-position lines) are silently dropped, + // matching the strict layout enforced by upstream's + // parse_tag_buffer (tag.c:130). + // + // gpgsig-sha256 is recognized and skipped without exposing a new field + // in v5. + sawObject, sawType, sawName, sawTagger bool +} + +// tagState is one step of the decoder state machine. Each function reads +// the lines it needs, mutates *Tag via s.t, and returns the next state +// to run (or nil to terminate the loop). +type tagState func(*tagScanner) (tagState, error) + +// readLine returns the next line from the buffer, transparently +// consuming any line that was previously pushed back by a state that +// decided not to handle it. +func (s *tagScanner) readLine() ([]byte, error) { + if s.pending != nil { + line, err := s.pending, s.pendingErr + s.pending, s.pendingErr = nil, nil + return line, err + } + return s.r.ReadBytes('\n') +} + +// pushBack stashes an unconsumed line so the next state's readLine call +// sees it. Only one line can be pushed back at a time. +func (s *tagScanner) pushBack(line []byte, err error) { + s.pending = line + s.pendingErr = err +} + +// scanTagObject requires the first line to be `object HASH`, mirroring +// upstream's strict parse_tag_buffer (tag.c:151-156). Anything else +// returns ErrMalformedTag. +func scanTagObject(s *tagScanner) (tagState, error) { + line, err := s.readLine() + if err != nil && err != io.EOF { + return nil, err + } + if len(line) == 0 || isBlankLine(line) { + return nil, fmt.Errorf("%w: missing object header", ErrMalformedTag) + } + + key, data := splitHeader(line) + if key != "object" { + return nil, fmt.Errorf("%w: object header must be first", ErrMalformedTag) + } + h, herr := parseObjectIDHex(data, ErrMalformedTag, "object") + if herr != nil { + return nil, herr + } + s.t.Target = h + s.sawObject = true + if err == io.EOF { + return nil, nil + } + return scanTagType, nil +} + +// scanTagType requires a `type` line immediately after the object header, +// mirroring upstream's parse_tag_buffer (tag.c:158-166). +func scanTagType(s *tagScanner) (tagState, error) { + line, err := s.readLine() + if err != nil && err != io.EOF { + return nil, err + } + if len(line) == 0 || isBlankLine(line) { + return nil, fmt.Errorf("%w: missing type header", ErrMalformedTag) + } + + key, data := splitHeader(line) + if key != "type" { + return nil, fmt.Errorf("%w: type header must follow object", ErrMalformedTag) + } + ot, perr := plumbing.ParseObjectType(string(data)) + if perr != nil { + return nil, perr + } + s.t.TargetType = ot + s.sawType = true + if err == io.EOF { + return nil, nil + } + return scanTagName, nil +} + +// scanTagName requires a `tag` line immediately after the type header, +// mirroring upstream's parse_tag_buffer (tag.c:186-194). +func scanTagName(s *tagScanner) (tagState, error) { + line, err := s.readLine() + if err != nil && err != io.EOF { + return nil, err + } + if len(line) == 0 || isBlankLine(line) { + return nil, fmt.Errorf("%w: missing tag header", ErrMalformedTag) + } + + key, data := splitHeader(line) + if key != "tag" { + return nil, fmt.Errorf("%w: tag header must follow type", ErrMalformedTag) + } + s.t.Name = string(data) + s.sawName = true + if err == io.EOF { + return nil, nil + } + return scanTagTagger, nil +} + +// scanTagTagger accepts a `tagger` line at its canonical position. Any +// other header is pushed back for scanTagHeaders. +func scanTagTagger(s *tagScanner) (tagState, error) { + line, err := s.readLine() + if err != nil && err != io.EOF { + return nil, err + } + if len(line) == 0 { + return nil, nil + } + if isBlankLine(line) { + return scanTagMessage, nil + } + + key, data := splitHeader(line) + if key == "tagger" { + s.t.Tagger.Decode(data) + s.sawTagger = true + if err == io.EOF { + return nil, nil + } + return scanTagHeaders, nil + } + s.pushBack(line, err) + return scanTagHeaders, nil +} + +// scanTagHeaders dispatches one header line. gpgsig-sha256 hands off to +// scanTagSkipCont so the continuation block can be consumed; out-of-position +// canonical fields and unknown headers are silently dropped. +func scanTagHeaders(s *tagScanner) (tagState, error) { + line, err := s.readLine() + if err != nil && err != io.EOF { + return nil, err + } + if len(line) == 0 { + return nil, nil + } + if isBlankLine(line) { + return scanTagMessage, nil + } + + key, _ := splitHeader(line) + next := scanTagHeaders + switch key { + case "object", "type", "tag", "tagger": + // Out-of-canonical-position duplicates are dropped, mirroring the + // strict ordering of upstream's parse_tag_buffer. + case headerpgp256: + next = scanTagSkipCont + default: + // Unknown header: silently dropped (the Tag struct does not + // expose ExtraHeaders). + } + + if err == io.EOF { + return nil, nil + } + return next, nil +} + +// scanTagSkipCont discards continuation lines for a header scanTagHeaders chose +// to drop. The first non-continuation line is pushed back so scanTagHeaders can +// dispatch it. +func scanTagSkipCont(s *tagScanner) (tagState, error) { + line, err := s.readLine() + if err != nil && err != io.EOF { + return nil, err + } + if len(line) > 0 && line[0] == ' ' { + if err == io.EOF { + return nil, nil + } + return scanTagSkipCont, nil + } + if len(line) > 0 { + s.pushBack(line, err) + } + return scanTagHeaders, nil +} + +// scanTagMessage drains the remaining bytes into the message buffer. +// (*Tag).Decode then runs parseSignedBytes over those bytes to peel off +// the optional inline trailing PGP signature. +func scanTagMessage(s *tagScanner) (tagState, error) { + for { + line, err := s.readLine() + if err != nil && err != io.EOF { + return nil, err + } + if len(line) > 0 { + s.msgbuf.Write(line) + } + if err == io.EOF { + return nil, nil + } + } +} diff --git a/vendor/github.com/go-git/go-git/v5/plumbing/object/tree.go b/vendor/github.com/go-git/go-git/v5/plumbing/object/tree.go index 2e1b78915..d0d0036de 100644 --- a/vendor/github.com/go-git/go-git/v5/plumbing/object/tree.go +++ b/vendor/github.com/go-git/go-git/v5/plumbing/object/tree.go @@ -29,6 +29,7 @@ var ( ErrDirectoryNotFound = errors.New("directory not found") ErrEntryNotFound = errors.New("entry not found") ErrEntriesNotSorted = errors.New("entries in tree are not sorted") + ErrMalformedTree = errors.New("malformed tree") ) // Tree is basically like a directory - it references a bunch of other trees @@ -37,9 +38,9 @@ type Tree struct { Entries []TreeEntry Hash plumbing.Hash - s storer.EncodedObjectStorer - m map[string]*TreeEntry - t map[string]*Tree // tree path cache + s storer.EncodedObjectStorer + t map[string]*Tree // tree path cache + entriesSorted bool } // GetTree gets a tree from an object storer and decodes it. @@ -182,16 +183,43 @@ func (t *Tree) dir(baseName string) (*Tree, error) { } func (t *Tree) entry(baseName string) (*TreeEntry, error) { - if t.m == nil { - t.buildMap() - } - - entry, ok := t.m[baseName] - if !ok { + if t.entriesSorted { + if entry := t.searchEntry(baseName); entry != nil { + return entry, nil + } return nil, ErrEntryNotFound } - return entry, nil + pastName := baseName + "/" + for i := range t.Entries { + entry := &t.Entries[i] + if entry.Name == baseName { + return entry, nil + } + if treeEntrySortName(entry) > pastName { + break + } + } + + return nil, ErrEntryNotFound +} + +func (t *Tree) searchEntry(baseName string) *TreeEntry { + if i := t.searchEntryIndex(baseName); i < len(t.Entries) && t.Entries[i].Name == baseName { + return &t.Entries[i] + } + + if i := t.searchEntryIndex(baseName + "/"); i < len(t.Entries) && t.Entries[i].Name == baseName { + return &t.Entries[i] + } + + return nil +} + +func (t *Tree) searchEntryIndex(name string) int { + return sort.Search(len(t.Entries), func(i int) bool { + return treeEntrySortName(&t.Entries[i]) >= name + }) } // Files returns a FileIter allowing to iterate over the Tree @@ -212,20 +240,25 @@ func (t *Tree) Type() plumbing.ObjectType { return plumbing.TreeObject } +func (t *Tree) reset() { + storer := t.s + *t = Tree{s: storer} +} + // Decode transform an plumbing.EncodedObject into a Tree struct func (t *Tree) Decode(o plumbing.EncodedObject) (err error) { if o.Type() != plumbing.TreeObject { return ErrUnsupportedObject } + t.reset() t.Hash = o.Hash() + // assume tree is sorted as a valid tree should always be sorted. + t.entriesSorted = true if o.Size() == 0 { return nil } - t.Entries = nil - t.m = nil - reader, err := o.Reader() if err != nil { return err @@ -235,10 +268,14 @@ func (t *Tree) Decode(o plumbing.EncodedObject) (err error) { r := sync.GetBufioReader(reader) defer sync.PutBufioReader(r) + var prevSortName string for { str, err := r.ReadString(' ') if err != nil { if err == io.EOF { + if len(str) != 0 { + return fmt.Errorf("%w: missing mode terminator", ErrMalformedTree) + } break } @@ -248,25 +285,41 @@ func (t *Tree) Decode(o plumbing.EncodedObject) (err error) { mode, err := filemode.New(str) if err != nil { - return err + return fmt.Errorf("%w: malformed mode", ErrMalformedTree) } + mode = canonicalTreeMode(mode) name, err := r.ReadString(0) - if err != nil && err != io.EOF { + if err != nil { + if err == io.EOF { + return fmt.Errorf("%w: missing filename terminator", ErrMalformedTree) + } return err } + if len(name) == 1 { + return fmt.Errorf("%w: empty filename", ErrMalformedTree) + } var hash plumbing.Hash if _, err = io.ReadFull(r, hash[:]); err != nil { + if errors.Is(err, io.EOF) || errors.Is(err, io.ErrUnexpectedEOF) { + return fmt.Errorf("%w: truncated object id", ErrMalformedTree) + } return err } baseName := name[:len(name)-1] - t.Entries = append(t.Entries, TreeEntry{ + entry := TreeEntry{ Hash: hash, Mode: mode, Name: baseName, - }) + } + sortName := treeEntrySortName(&entry) + if len(t.Entries) != 0 && prevSortName > sortName { + t.entriesSorted = false + } + prevSortName = sortName + t.Entries = append(t.Entries, entry) } return nil @@ -279,21 +332,37 @@ func (s TreeEntrySorter) Len() int { } func (s TreeEntrySorter) Less(i, j int) bool { - name1 := s[i].Name - name2 := s[j].Name - if s[i].Mode == filemode.Dir { - name1 += "/" - } - if s[j].Mode == filemode.Dir { - name2 += "/" - } - return name1 < name2 + return treeEntrySortName(&s[i]) < treeEntrySortName(&s[j]) } func (s TreeEntrySorter) Swap(i, j int) { s[i], s[j] = s[j], s[i] } +// Git compares tree entries as if directory names had a trailing slash. +func treeEntrySortName(e *TreeEntry) string { + if e.Mode == filemode.Dir { + return e.Name + "/" + } + return e.Name +} + +func canonicalTreeMode(mode filemode.FileMode) filemode.FileMode { + switch mode & 0o170000 { + case 0o040000: + return filemode.Dir + case 0o100000: + if mode&0o111 != 0 { + return filemode.Executable + } + return filemode.Regular + case 0o120000: + return filemode.Symlink + default: + return filemode.Submodule + } +} + // Encode transforms a Tree into a plumbing.EncodedObject. // The tree entries must be sorted by name. func (t *Tree) Encode(o plumbing.EncodedObject) (err error) { @@ -329,13 +398,6 @@ func (t *Tree) Encode(o plumbing.EncodedObject) (err error) { return err } -func (t *Tree) buildMap() { - t.m = make(map[string]*TreeEntry) - for i := 0; i < len(t.Entries); i++ { - t.m[t.Entries[i].Name] = &t.Entries[i] - } -} - // Diff returns a list of changes between this tree and the provided one func (t *Tree) Diff(to *Tree) (Changes, error) { return t.DiffContext(context.Background(), to) diff --git a/vendor/github.com/klauspost/cpuid/v2/README.md b/vendor/github.com/klauspost/cpuid/v2/README.md index 7b1d59921..88d68d528 100644 --- a/vendor/github.com/klauspost/cpuid/v2/README.md +++ b/vendor/github.com/klauspost/cpuid/v2/README.md @@ -281,7 +281,7 @@ Exit Code 1 | AMXBF16 | Tile computational operations on BFLOAT16 numbers | | AMXINT8 | Tile computational operations on 8-bit integers | | AMXFP16 | Tile computational operations on FP16 numbers | -| AMXFP8 | Tile computational operations on FP8 numbers | +| AMXFP8 | Tile computational operations on FP8 numbers | | AMXCOMPLEX | Tile computational operations on complex numbers | | AMXTILE | Tile architecture | | AMXTF32 | Matrix Multiplication of TF32 Tiles into Packed Single Precision Tile | @@ -418,6 +418,7 @@ Exit Code 1 | SEV_SNP | AMD SEV Secure Nested Paging supported | | SGX | Software Guard Extensions | | SGXLC | Software Guard Extensions Launch Control | +| SGXPQC | Software Guard Extensions 256-bit Encryption | | SHA | Intel SHA Extensions | | SME | AMD Secure Memory Encryption supported | | SME_COHERENT | AMD Hardware cache coherency across encryption domains enforced | @@ -450,6 +451,9 @@ Exit Code 1 | TLB_FLUSH_NESTED | AMD: Flushing includes all the nested translations for guest translations | | TME | Intel Total Memory Encryption. The following MSRs are supported: IA32_TME_CAPABILITY, IA32_TME_ACTIVATE, IA32_TME_EXCLUDE_MASK, and IA32_TME_EXCLUDE_BASE. | | TOPEXT | TopologyExtensions: topology extensions support. Indicates support for CPUID Fn8000_001D_EAX_x[N:0]-CPUID Fn8000_001E_EDX. | +| TSA_L1_NO | AMD only: Not vulnerable to TSA-L1 | +| TSA_SQ_NO | AMD only: Not vulnerable to TSA-SQ | +| TSA_VERW_CLEAR | AMD: If set, the memory form of the VERW instruction may be used to help mitigate TSA | | TSCRATEMSR | MSR based TSC rate control. Indicates support for MSR TSC ratio MSRC000_0104 | | TSXLDTRK | Intel TSX Suspend Load Address Tracking | | VAES | Vector AES. AVX(512) versions requires additional checks. | diff --git a/vendor/github.com/klauspost/cpuid/v2/cpuid.go b/vendor/github.com/klauspost/cpuid/v2/cpuid.go index 248439a9a..9cf7738a9 100644 --- a/vendor/github.com/klauspost/cpuid/v2/cpuid.go +++ b/vendor/github.com/klauspost/cpuid/v2/cpuid.go @@ -220,6 +220,7 @@ const ( SEV_SNP // AMD SEV Secure Nested Paging supported SGX // Software Guard Extensions SGXLC // Software Guard Extensions Launch Control + SGXPQC // Software Guard Extensions 256-bit Encryption SHA // Intel SHA Extensions SME // AMD Secure Memory Encryption supported SME_COHERENT // AMD Hardware cache coherency across encryption domains enforced @@ -255,6 +256,9 @@ const ( TLB_FLUSH_NESTED // AMD: Flushing includes all the nested translations for guest translations TME // Intel Total Memory Encryption. The following MSRs are supported: IA32_TME_CAPABILITY, IA32_TME_ACTIVATE, IA32_TME_EXCLUDE_MASK, and IA32_TME_EXCLUDE_BASE. TOPEXT // TopologyExtensions: topology extensions support. Indicates support for CPUID Fn8000_001D_EAX_x[N:0]-CPUID Fn8000_001E_EDX. + TSA_L1_NO // AMD only: Not vulnerable to TSA-L1 + TSA_SQ_NO // AM onlyD: Not vulnerable to TSA-SQ + TSA_VERW_CLEAR // If set, the memory form of the VERW instruction may be used to help mitigate TSA TSCRATEMSR // MSR based TSC rate control. Indicates support for MSR TSC ratio MSRC000_0104 TSXLDTRK // Intel TSX Suspend Load Address Tracking VAES // Vector AES. AVX(512) versions requires additional checks. @@ -304,6 +308,13 @@ const ( SM3 // SM3 instructions SM4 // SM4 instructions SVE // Scalable Vector Extension + + // PMU + PMU_FIXEDCOUNTER_CYCLES + PMU_FIXEDCOUNTER_REFCYCLES + PMU_FIXEDCOUNTER_INSTRUCTIONS + PMU_FIXEDCOUNTER_TOPDOWN_SLOTS + // Keep it last. It automatically defines the size of []flagSet lastID @@ -336,11 +347,36 @@ type CPUInfo struct { SGX SGXSupport AMDMemEncryption AMDMemEncryptionSupport AVX10Level uint8 + PMU PerformanceMonitoringInfo // holds information about the PMU maxFunc uint32 maxExFunc uint32 } +// PerformanceMonitoringInfo holds information about CPU performance monitoring capabilities. +// This is primarily populated from CPUID leaf 0xAh on x86 +type PerformanceMonitoringInfo struct { + // VersionID (x86 only): Version ID of architectural performance monitoring. + // A value of 0 means architectural performance monitoring is not supported or information is unavailable. + VersionID uint8 + // NumGPPMC: Number of General-Purpose Performance Monitoring Counters per logical processor. + // On ARM, this is derived from PMCR_EL0.N (number of event counters). + NumGPCounters uint8 + // GPPMCWidth: Bit width of General-Purpose Performance Monitoring Counters. + // On ARM, typically 64 for PMU event counters. + GPPMCWidth uint8 + // NumFixedPMC: Number of Fixed-Function Performance Counters. + // Valid on x86 if VersionID > 1. On ARM, this typically includes at least the cycle counter (PMCCNTR_EL0). + NumFixedPMC uint8 + // FixedPMCWidth: Bit width of Fixed-Function Performance Counters. + // Valid on x86 if VersionID > 1. On ARM, the cycle counter (PMCCNTR_EL0) is 64-bit. + FixedPMCWidth uint8 + // Raw register output from CPUID leaf 0xAh. + RawEBX uint32 + RawEAX uint32 + RawEDX uint32 +} + var cpuid func(op uint32) (eax, ebx, ecx, edx uint32) var cpuidex func(op, op2 uint32) (eax, ebx, ecx, edx uint32) var xgetbv func(index uint32) (eax, edx uint32) @@ -1358,6 +1394,11 @@ func support() flagSet { fs.setIf(edx&(1<<4) != 0, BHI_CTRL) fs.setIf(edx&(1<<5) != 0, MCDT_NO) + if fs.inSet(SGX) { + eax, _, _, _ := cpuidex(0x12, 0) + fs.setIf(eax&(1<<12) != 0, SGXPQC) + } + // Add keylocker features. if fs.inSet(KEYLOCKER) && mfi >= 0x19 { _, ebx, _, _ := cpuidex(0x19, 0) @@ -1371,6 +1412,7 @@ func support() flagSet { fs.setIf(ebx&(1<<17) != 0, AVX10_256) fs.setIf(ebx&(1<<18) != 0, AVX10_512) } + } // Processor Extended State Enumeration Sub-leaf (EAX = 0DH, ECX = 1) @@ -1514,12 +1556,28 @@ func support() flagSet { } if maxExtendedFunction() >= 0x80000021 && vend == AMD { - a, _, _, _ := cpuid(0x80000021) + a, _, c, _ := cpuid(0x80000021) fs.setIf((a>>31)&1 == 1, SRSO_MSR_FIX) fs.setIf((a>>30)&1 == 1, SRSO_USER_KERNEL_NO) fs.setIf((a>>29)&1 == 1, SRSO_NO) fs.setIf((a>>28)&1 == 1, IBPB_BRTYPE) fs.setIf((a>>27)&1 == 1, SBPB) + fs.setIf((c>>1)&1 == 1, TSA_L1_NO) + fs.setIf((c>>2)&1 == 1, TSA_SQ_NO) + fs.setIf((a>>5)&1 == 1, TSA_VERW_CLEAR) + } + if vend == AMD { + if family < 0x19 { + // AMD CPUs that are older than Family 19h are not vulnerable to TSA but do not set TSA_L1_NO or TSA_SQ_NO. + // Source: https://www.amd.com/content/dam/amd/en/documents/resources/bulletin/technical-guidance-for-mitigating-transient-scheduler-attacks.pdf + fs.set(TSA_L1_NO) + fs.set(TSA_SQ_NO) + } else if family == 0x1a { + // AMD Family 1Ah models 00h-4Fh and 60h-7Fh are also not vulnerable to TSA but do not set TSA_L1_NO or TSA_SQ_NO. + // Future AMD CPUs will set these CPUID bits if appropriate. CPUs will be designed to set these CPUID bits if appropriate. + notVuln := model <= 0x4f || (model >= 0x60 && model <= 0x7f) + fs.setIf(notVuln, TSA_L1_NO, TSA_SQ_NO) + } } if mfi >= 0x20 { @@ -1575,3 +1633,47 @@ func valAsString(values ...uint32) []byte { } return r } + +func parseLeaf0AH(c *CPUInfo, eax, ebx, edx uint32) (info PerformanceMonitoringInfo) { + info.VersionID = uint8(eax & 0xFF) + info.NumGPCounters = uint8((eax >> 8) & 0xFF) + info.GPPMCWidth = uint8((eax >> 16) & 0xFF) + + info.RawEBX = ebx + info.RawEAX = eax + info.RawEDX = edx + + if info.VersionID > 1 { // This information is only valid if VersionID > 1 + info.NumFixedPMC = uint8(edx & 0x1F) // Bits 4:0 + info.FixedPMCWidth = uint8((edx >> 5) & 0xFF) // Bits 12:5 + } + if info.VersionID > 0 { + // first 4 fixed events are always instructions retired, cycles, ref cycles and topdown slots + if ebx == 0x0 && info.NumFixedPMC == 3 { + c.featureSet.set(PMU_FIXEDCOUNTER_INSTRUCTIONS) + c.featureSet.set(PMU_FIXEDCOUNTER_CYCLES) + c.featureSet.set(PMU_FIXEDCOUNTER_REFCYCLES) + } + if ebx == 0x0 && info.NumFixedPMC == 4 { + c.featureSet.set(PMU_FIXEDCOUNTER_INSTRUCTIONS) + c.featureSet.set(PMU_FIXEDCOUNTER_CYCLES) + c.featureSet.set(PMU_FIXEDCOUNTER_REFCYCLES) + c.featureSet.set(PMU_FIXEDCOUNTER_TOPDOWN_SLOTS) + } + if ebx != 0x0 { + if ((ebx >> 0) & 1) == 0 { + c.featureSet.set(PMU_FIXEDCOUNTER_INSTRUCTIONS) + } + if ((ebx >> 1) & 1) == 0 { + c.featureSet.set(PMU_FIXEDCOUNTER_CYCLES) + } + if ((ebx >> 2) & 1) == 0 { + c.featureSet.set(PMU_FIXEDCOUNTER_REFCYCLES) + } + if ((ebx >> 3) & 1) == 0 { + c.featureSet.set(PMU_FIXEDCOUNTER_TOPDOWN_SLOTS) + } + } + } + return info +} diff --git a/vendor/github.com/klauspost/cpuid/v2/detect_x86.go b/vendor/github.com/klauspost/cpuid/v2/detect_x86.go index f924c9d83..14a56b930 100644 --- a/vendor/github.com/klauspost/cpuid/v2/detect_x86.go +++ b/vendor/github.com/klauspost/cpuid/v2/detect_x86.go @@ -36,6 +36,10 @@ func addInfo(c *CPUInfo, safe bool) { c.AVX10Level = c.supportAVX10() c.cacheSize() c.frequencies() + if c.maxFunc >= 0x0A { + eax, ebx, _, edx := cpuid(0x0A) + c.PMU = parseLeaf0AH(c, eax, ebx, edx) + } } func getVectorLength() (vl, pl uint64) { return 0, 0 } diff --git a/vendor/github.com/klauspost/cpuid/v2/featureid_string.go b/vendor/github.com/klauspost/cpuid/v2/featureid_string.go index 07704351f..2888bae8f 100644 --- a/vendor/github.com/klauspost/cpuid/v2/featureid_string.go +++ b/vendor/github.com/klauspost/cpuid/v2/featureid_string.go @@ -154,95 +154,103 @@ func _() { _ = x[SEV_SNP-144] _ = x[SGX-145] _ = x[SGXLC-146] - _ = x[SHA-147] - _ = x[SME-148] - _ = x[SME_COHERENT-149] - _ = x[SM3_X86-150] - _ = x[SM4_X86-151] - _ = x[SPEC_CTRL_SSBD-152] - _ = x[SRBDS_CTRL-153] - _ = x[SRSO_MSR_FIX-154] - _ = x[SRSO_NO-155] - _ = x[SRSO_USER_KERNEL_NO-156] - _ = x[SSE-157] - _ = x[SSE2-158] - _ = x[SSE3-159] - _ = x[SSE4-160] - _ = x[SSE42-161] - _ = x[SSE4A-162] - _ = x[SSSE3-163] - _ = x[STIBP-164] - _ = x[STIBP_ALWAYSON-165] - _ = x[STOSB_SHORT-166] - _ = x[SUCCOR-167] - _ = x[SVM-168] - _ = x[SVMDA-169] - _ = x[SVMFBASID-170] - _ = x[SVML-171] - _ = x[SVMNP-172] - _ = x[SVMPF-173] - _ = x[SVMPFT-174] - _ = x[SYSCALL-175] - _ = x[SYSEE-176] - _ = x[TBM-177] - _ = x[TDX_GUEST-178] - _ = x[TLB_FLUSH_NESTED-179] - _ = x[TME-180] - _ = x[TOPEXT-181] - _ = x[TSCRATEMSR-182] - _ = x[TSXLDTRK-183] - _ = x[VAES-184] - _ = x[VMCBCLEAN-185] - _ = x[VMPL-186] - _ = x[VMSA_REGPROT-187] - _ = x[VMX-188] - _ = x[VPCLMULQDQ-189] - _ = x[VTE-190] - _ = x[WAITPKG-191] - _ = x[WBNOINVD-192] - _ = x[WRMSRNS-193] - _ = x[X87-194] - _ = x[XGETBV1-195] - _ = x[XOP-196] - _ = x[XSAVE-197] - _ = x[XSAVEC-198] - _ = x[XSAVEOPT-199] - _ = x[XSAVES-200] - _ = x[AESARM-201] - _ = x[ARMCPUID-202] - _ = x[ASIMD-203] - _ = x[ASIMDDP-204] - _ = x[ASIMDHP-205] - _ = x[ASIMDRDM-206] - _ = x[ATOMICS-207] - _ = x[CRC32-208] - _ = x[DCPOP-209] - _ = x[EVTSTRM-210] - _ = x[FCMA-211] - _ = x[FHM-212] - _ = x[FP-213] - _ = x[FPHP-214] - _ = x[GPA-215] - _ = x[JSCVT-216] - _ = x[LRCPC-217] - _ = x[PMULL-218] - _ = x[RNDR-219] - _ = x[TLB-220] - _ = x[TS-221] - _ = x[SHA1-222] - _ = x[SHA2-223] - _ = x[SHA3-224] - _ = x[SHA512-225] - _ = x[SM3-226] - _ = x[SM4-227] - _ = x[SVE-228] - _ = x[lastID-229] + _ = x[SGXPQC-147] + _ = x[SHA-148] + _ = x[SME-149] + _ = x[SME_COHERENT-150] + _ = x[SM3_X86-151] + _ = x[SM4_X86-152] + _ = x[SPEC_CTRL_SSBD-153] + _ = x[SRBDS_CTRL-154] + _ = x[SRSO_MSR_FIX-155] + _ = x[SRSO_NO-156] + _ = x[SRSO_USER_KERNEL_NO-157] + _ = x[SSE-158] + _ = x[SSE2-159] + _ = x[SSE3-160] + _ = x[SSE4-161] + _ = x[SSE42-162] + _ = x[SSE4A-163] + _ = x[SSSE3-164] + _ = x[STIBP-165] + _ = x[STIBP_ALWAYSON-166] + _ = x[STOSB_SHORT-167] + _ = x[SUCCOR-168] + _ = x[SVM-169] + _ = x[SVMDA-170] + _ = x[SVMFBASID-171] + _ = x[SVML-172] + _ = x[SVMNP-173] + _ = x[SVMPF-174] + _ = x[SVMPFT-175] + _ = x[SYSCALL-176] + _ = x[SYSEE-177] + _ = x[TBM-178] + _ = x[TDX_GUEST-179] + _ = x[TLB_FLUSH_NESTED-180] + _ = x[TME-181] + _ = x[TOPEXT-182] + _ = x[TSA_L1_NO-183] + _ = x[TSA_SQ_NO-184] + _ = x[TSA_VERW_CLEAR-185] + _ = x[TSCRATEMSR-186] + _ = x[TSXLDTRK-187] + _ = x[VAES-188] + _ = x[VMCBCLEAN-189] + _ = x[VMPL-190] + _ = x[VMSA_REGPROT-191] + _ = x[VMX-192] + _ = x[VPCLMULQDQ-193] + _ = x[VTE-194] + _ = x[WAITPKG-195] + _ = x[WBNOINVD-196] + _ = x[WRMSRNS-197] + _ = x[X87-198] + _ = x[XGETBV1-199] + _ = x[XOP-200] + _ = x[XSAVE-201] + _ = x[XSAVEC-202] + _ = x[XSAVEOPT-203] + _ = x[XSAVES-204] + _ = x[AESARM-205] + _ = x[ARMCPUID-206] + _ = x[ASIMD-207] + _ = x[ASIMDDP-208] + _ = x[ASIMDHP-209] + _ = x[ASIMDRDM-210] + _ = x[ATOMICS-211] + _ = x[CRC32-212] + _ = x[DCPOP-213] + _ = x[EVTSTRM-214] + _ = x[FCMA-215] + _ = x[FHM-216] + _ = x[FP-217] + _ = x[FPHP-218] + _ = x[GPA-219] + _ = x[JSCVT-220] + _ = x[LRCPC-221] + _ = x[PMULL-222] + _ = x[RNDR-223] + _ = x[TLB-224] + _ = x[TS-225] + _ = x[SHA1-226] + _ = x[SHA2-227] + _ = x[SHA3-228] + _ = x[SHA512-229] + _ = x[SM3-230] + _ = x[SM4-231] + _ = x[SVE-232] + _ = x[PMU_FIXEDCOUNTER_CYCLES-233] + _ = x[PMU_FIXEDCOUNTER_REFCYCLES-234] + _ = x[PMU_FIXEDCOUNTER_INSTRUCTIONS-235] + _ = x[PMU_FIXEDCOUNTER_TOPDOWN_SLOTS-236] + _ = x[lastID-237] _ = x[firstID-0] } -const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXFP8AMXTILEAMXTF32AMXCOMPLEXAMXTRANSPOSEAPX_FAVXAVX10AVX10_128AVX10_256AVX10_512AVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8AVXVNNIINT16BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBPB_BRTYPEIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBKEYLOCKERKEYLOCKERWLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSBPBSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSM3_X86SM4_X86SPEC_CTRL_SSBDSRBDS_CTRLSRSO_MSR_FIXSRSO_NOSRSO_USER_KERNEL_NOSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFHMFPFPHPGPAJSCVTLRCPCPMULLRNDRTLBTSSHA1SHA2SHA3SHA512SM3SM4SVElastID" +const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXFP8AMXTILEAMXTF32AMXCOMPLEXAMXTRANSPOSEAPX_FAVXAVX10AVX10_128AVX10_256AVX10_512AVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8AVXVNNIINT16BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBPB_BRTYPEIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBKEYLOCKERKEYLOCKERWLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSBPBSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSGXPQCSHASMESME_COHERENTSM3_X86SM4_X86SPEC_CTRL_SSBDSRBDS_CTRLSRSO_MSR_FIXSRSO_NOSRSO_USER_KERNEL_NOSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSA_L1_NOTSA_SQ_NOTSA_VERW_CLEARTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFHMFPFPHPGPAJSCVTLRCPCPMULLRNDRTLBTSSHA1SHA2SHA3SHA512SM3SM4SVEPMU_FIXEDCOUNTER_CYCLESPMU_FIXEDCOUNTER_REFCYCLESPMU_FIXEDCOUNTER_INSTRUCTIONSPMU_FIXEDCOUNTER_TOPDOWN_SLOTSlastID" -var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 61, 68, 75, 85, 97, 102, 105, 110, 119, 128, 137, 141, 151, 163, 171, 179, 187, 195, 202, 212, 222, 230, 240, 251, 259, 269, 287, 302, 309, 321, 328, 335, 346, 358, 366, 370, 374, 380, 385, 393, 398, 404, 408, 417, 435, 443, 450, 454, 458, 472, 478, 482, 486, 495, 499, 503, 508, 513, 517, 521, 528, 532, 535, 541, 544, 547, 557, 567, 580, 593, 597, 608, 612, 626, 643, 646, 656, 667, 673, 681, 692, 700, 712, 728, 742, 753, 763, 778, 786, 797, 807, 814, 823, 833, 837, 840, 847, 852, 863, 870, 877, 885, 888, 894, 899, 908, 915, 923, 927, 930, 936, 943, 956, 961, 963, 970, 977, 983, 987, 996, 1000, 1005, 1011, 1017, 1023, 1033, 1036, 1052, 1056, 1065, 1068, 1077, 1092, 1105, 1111, 1125, 1132, 1135, 1140, 1143, 1146, 1158, 1165, 1172, 1186, 1196, 1208, 1215, 1234, 1237, 1241, 1245, 1249, 1254, 1259, 1264, 1269, 1283, 1294, 1300, 1303, 1308, 1317, 1321, 1326, 1331, 1337, 1344, 1349, 1352, 1361, 1377, 1380, 1386, 1396, 1404, 1408, 1417, 1421, 1433, 1436, 1446, 1449, 1456, 1464, 1471, 1474, 1481, 1484, 1489, 1495, 1503, 1509, 1515, 1523, 1528, 1535, 1542, 1550, 1557, 1562, 1567, 1574, 1578, 1581, 1583, 1587, 1590, 1595, 1600, 1605, 1609, 1612, 1614, 1618, 1622, 1626, 1632, 1635, 1638, 1641, 1647} +var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 61, 68, 75, 85, 97, 102, 105, 110, 119, 128, 137, 141, 151, 163, 171, 179, 187, 195, 202, 212, 222, 230, 240, 251, 259, 269, 287, 302, 309, 321, 328, 335, 346, 358, 366, 370, 374, 380, 385, 393, 398, 404, 408, 417, 435, 443, 450, 454, 458, 472, 478, 482, 486, 495, 499, 503, 508, 513, 517, 521, 528, 532, 535, 541, 544, 547, 557, 567, 580, 593, 597, 608, 612, 626, 643, 646, 656, 667, 673, 681, 692, 700, 712, 728, 742, 753, 763, 778, 786, 797, 807, 814, 823, 833, 837, 840, 847, 852, 863, 870, 877, 885, 888, 894, 899, 908, 915, 923, 927, 930, 936, 943, 956, 961, 963, 970, 977, 983, 987, 996, 1000, 1005, 1011, 1017, 1023, 1033, 1036, 1052, 1056, 1065, 1068, 1077, 1092, 1105, 1111, 1125, 1132, 1135, 1140, 1146, 1149, 1152, 1164, 1171, 1178, 1192, 1202, 1214, 1221, 1240, 1243, 1247, 1251, 1255, 1260, 1265, 1270, 1275, 1289, 1300, 1306, 1309, 1314, 1323, 1327, 1332, 1337, 1343, 1350, 1355, 1358, 1367, 1383, 1386, 1392, 1401, 1410, 1424, 1434, 1442, 1446, 1455, 1459, 1471, 1474, 1484, 1487, 1494, 1502, 1509, 1512, 1519, 1522, 1527, 1533, 1541, 1547, 1553, 1561, 1566, 1573, 1580, 1588, 1595, 1600, 1605, 1612, 1616, 1619, 1621, 1625, 1628, 1633, 1638, 1643, 1647, 1650, 1652, 1656, 1660, 1664, 1670, 1673, 1676, 1679, 1702, 1728, 1757, 1787, 1793} func (i FeatureID) String() string { if i < 0 || i >= FeatureID(len(_FeatureID_index)-1) { diff --git a/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/interceptors/eventsmiddleware/conversion.go b/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/interceptors/eventsmiddleware/conversion.go index 6f7df8ca2..d0fd30d92 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/interceptors/eventsmiddleware/conversion.go +++ b/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/interceptors/eventsmiddleware/conversion.go @@ -414,38 +414,45 @@ func SpaceEnabled(r *provider.UpdateStorageSpaceResponse, req *provider.UpdateSt } // SpaceShared converts the response to an event -// func SpaceShared(req *provider.AddGrantRequest, executant, sharer *user.UserId, grantee *provider.Grantee) events.SpaceShared { -func SpaceShared(r *provider.AddGrantResponse, req *provider.AddGrantRequest, executant *user.User) events.SpaceShared { - id := storagespace.FormatStorageID(req.Ref.ResourceId.StorageId, req.Ref.ResourceId.SpaceId) +func SpaceShared(r *collaboration.CreateShareResponse, executant *user.User) events.SpaceShared { + id := storagespace.FormatStorageID(r.GetShare().GetResourceId().GetStorageId(), r.GetShare().GetResourceId().GetSpaceId()) return events.SpaceShared{ Executant: executant.GetId(), - Creator: req.Grant.Creator, - GranteeUserID: req.Grant.GetGrantee().GetUserId(), - GranteeGroupID: req.Grant.GetGrantee().GetGroupId(), + Creator: r.Share.GetCreator(), + GranteeUserID: r.Share.GetGrantee().GetUserId(), + GranteeGroupID: r.Share.GetGrantee().GetGroupId(), ID: &provider.StorageSpaceId{OpaqueId: id}, Timestamp: time.Now(), } } // SpaceShareUpdated converts the response to an events -func SpaceShareUpdated(r *provider.UpdateGrantResponse, req *provider.UpdateGrantRequest, executant *user.User) events.SpaceShareUpdated { - id := storagespace.FormatStorageID(req.Ref.ResourceId.StorageId, req.Ref.ResourceId.SpaceId) +func SpaceShareUpdated(r *collaboration.UpdateShareResponse, executant *user.User) events.SpaceShareUpdated { + id := storagespace.FormatStorageID(r.GetShare().GetResourceId().GetStorageId(), r.GetShare().GetResourceId().GetSpaceId()) return events.SpaceShareUpdated{ Executant: executant.GetId(), - GranteeUserID: req.Grant.GetGrantee().GetUserId(), - GranteeGroupID: req.Grant.GetGrantee().GetGroupId(), + GranteeUserID: r.GetShare().GetGrantee().GetUserId(), + GranteeGroupID: r.GetShare().GetGrantee().GetGroupId(), ID: &provider.StorageSpaceId{OpaqueId: id}, Timestamp: time.Now(), } } // SpaceUnshared converts the response to an event -func SpaceUnshared(r *provider.RemoveGrantResponse, req *provider.RemoveGrantRequest, executant *user.User) events.SpaceUnshared { - id := storagespace.FormatStorageID(req.Ref.ResourceId.StorageId, req.Ref.ResourceId.SpaceId) +func SpaceUnshared(r *collaboration.RemoveShareResponse, req *collaboration.RemoveShareRequest, executant *user.User) events.SpaceUnshared { + var ( + userid *user.UserId + groupid *group.GroupId + rid *provider.ResourceId + ) + _ = utils.ReadJSONFromOpaque(r.Opaque, "granteeuserid", &userid) + _ = utils.ReadJSONFromOpaque(r.Opaque, "granteegroupid", &groupid) + _ = utils.ReadJSONFromOpaque(r.Opaque, "resourceid", &rid) + id := storagespace.FormatStorageID(rid.StorageId, rid.SpaceId) return events.SpaceUnshared{ Executant: executant.GetId(), - GranteeUserID: req.Grant.GetGrantee().GetUserId(), - GranteeGroupID: req.Grant.GetGrantee().GetGroupId(), + GranteeUserID: userid, + GranteeGroupID: groupid, ID: &provider.StorageSpaceId{OpaqueId: id}, Timestamp: time.Now(), } diff --git a/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/interceptors/eventsmiddleware/events.go b/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/interceptors/eventsmiddleware/events.go index 7cd409d34..4b376c2d5 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/interceptors/eventsmiddleware/events.go +++ b/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/interceptors/eventsmiddleware/events.go @@ -81,15 +81,30 @@ func NewUnary(m map[string]interface{}) (grpc.UnaryServerInterceptor, int, error switch v := res.(type) { case *collaboration.CreateShareResponse: if isSuccess(v) { - ev = ShareCreated(v, executant) + if utils.ExistsInOpaque(v.Opaque, "noevent") { + break + } + if utils.ExistsInOpaque(v.Opaque, "spacegrant") { + ev = SpaceShared(v, executant) + } else { + ev = ShareCreated(v, executant) + } } case *collaboration.RemoveShareResponse: if isSuccess(v) { - ev = ShareRemoved(v, req.(*collaboration.RemoveShareRequest), executant) + if utils.ExistsInOpaque(v.Opaque, "spacegrant") { + ev = SpaceUnshared(v, req.(*collaboration.RemoveShareRequest), executant) + } else { + ev = ShareRemoved(v, req.(*collaboration.RemoveShareRequest), executant) + } } case *collaboration.UpdateShareResponse: if isSuccess(v) { - ev = ShareUpdated(v, req.(*collaboration.UpdateShareRequest), executant) + if utils.ExistsInOpaque(v.Opaque, "spacegrant") { + ev = SpaceShareUpdated(v, executant) + } else { + ev = ShareUpdated(v, req.(*collaboration.UpdateShareRequest), executant) + } } case *collaboration.UpdateReceivedShareResponse: if isSuccess(v) { @@ -117,24 +132,6 @@ func NewUnary(m map[string]interface{}) (grpc.UnaryServerInterceptor, int, error if isSuccess(v) { ev = OCMCoreShareCreated(v, req.(*ocmcore.CreateOCMCoreShareRequest), executant) } - case *provider.AddGrantResponse: - // TODO: update CS3 APIs - // FIXME these should be part of the RemoveGrantRequest object - // https://github.com/owncloud/ocis/issues/4312 - r := req.(*provider.AddGrantRequest) - if isSuccess(v) && utils.ExistsInOpaque(r.Opaque, "spacegrant") { - ev = SpaceShared(v, r, executant) - } - case *provider.UpdateGrantResponse: - r := req.(*provider.UpdateGrantRequest) - if isSuccess(v) && utils.ExistsInOpaque(r.Opaque, "spacegrant") { - ev = SpaceShareUpdated(v, r, executant) - } - case *provider.RemoveGrantResponse: - r := req.(*provider.RemoveGrantRequest) - if isSuccess(v) && utils.ExistsInOpaque(r.Opaque, "spacegrant") { - ev = SpaceUnshared(v, req.(*provider.RemoveGrantRequest), executant) - } case *provider.CreateContainerResponse: if isSuccess(v) { ev = ContainerCreated(v, req.(*provider.CreateContainerRequest), ownerID, executant) diff --git a/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/services/gateway/gateway.go b/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/services/gateway/gateway.go index ab0e67851..c9958c199 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/services/gateway/gateway.go +++ b/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/services/gateway/gateway.go @@ -36,12 +36,6 @@ import ( "google.golang.org/grpc" ) -const ( - _spaceTypePersonal = "personal" - _spaceTypeProject = "project" - _spaceTypeVirtual = "virtual" -) - func init() { rgrpc.Register("gateway", New) } @@ -77,7 +71,6 @@ type config struct { AllowedUserAgents map[string][]string `mapstructure:"allowed_user_agents"` // map[path][]user-agent CreatePersonalSpaceCacheConfig cache.Config `mapstructure:"create_personal_space_cache_config"` ProviderCacheConfig cache.Config `mapstructure:"provider_cache_config"` - UseCommonSpaceRootShareLogic bool `mapstructure:"use_common_space_root_share_logic"` } // sets defaults diff --git a/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/services/gateway/storageprovider.go b/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/services/gateway/storageprovider.go index 710b0bcbe..158808ce0 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/services/gateway/storageprovider.go +++ b/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/services/gateway/storageprovider.go @@ -36,6 +36,8 @@ import ( provider "github.com/cs3org/go-cs3apis/cs3/storage/provider/v1beta1" registry "github.com/cs3org/go-cs3apis/cs3/storage/registry/v1beta1" typesv1beta1 "github.com/cs3org/go-cs3apis/cs3/types/v1beta1" + "github.com/opencloud-eu/reva/v2/pkg/conversions" + "github.com/rs/zerolog/log" "google.golang.org/grpc/codes" "github.com/golang-jwt/jwt/v5" @@ -226,6 +228,52 @@ func (s *svc) CreateStorageSpace(ctx context.Context, req *provider.CreateStorag }, nil } + // If the create space is not a "personal" space, we add a Share to the ShareProvider to give the creator + // of the space "manager" access to it. + // Note: the DecomposedFS storagadriver already adds a grant to the space root giving that access, the "CreateShare" + // here is happeing so that that grant is also visible when listing permission (shares) on the spaceroot. + if req.GetType() != "personal" && createRes.GetStatus().GetCode() == rpc.Code_CODE_OK { + rollbackFn := func() { + dsRes, dsErr := s.DeleteStorageSpace(ctx, &provider.DeleteStorageSpaceRequest{ + Id: createRes.GetStorageSpace().GetId(), + }) + if dsErr != nil || dsRes.GetStatus().GetCode() != rpc.Code_CODE_OK { + log.Error().Err(dsErr).Interface("status", dsRes.GetStatus()).Interface("space_id", createRes.GetStorageSpace().GetId()).Msg("failed to delete space during rollback") + } + } + + u := ctxpkg.ContextMustGetUser(ctx) + shareReq := &collaborationv1beta1.CreateShareRequest{ + ResourceInfo: &provider.ResourceInfo{ + Id: createRes.GetStorageSpace().GetRoot(), + }, + Grant: &collaborationv1beta1.ShareGrant{ + Grantee: &provider.Grantee{ + Type: provider.GranteeType_GRANTEE_TYPE_USER, + Id: &provider.Grantee_UserId{ + UserId: u.GetId(), + }, + }, + Permissions: &collaborationv1beta1.SharePermissions{ + Permissions: conversions.NewManagerRole().CS3ResourcePermissions(), + }, + }, + } + csResp, err := s.CreateShare(ctx, shareReq) + if err != nil || csResp.GetStatus().GetCode() != rpc.Code_CODE_OK { + log.Error().Err(err).Interface("status", csResp.GetStatus()).Interface("space_id", createRes.GetStorageSpace().GetId()).Msg("failed to create initial share for space creator, rolling back space creation") + rollbackFn() + + shareErrMsg := "failed to create initial share for space creator" + if err == nil { + shareErrMsg = csResp.GetStatus().GetMessage() + } + return &provider.CreateStorageSpaceResponse{ + Status: status.NewInternal(ctx, shareErrMsg), + }, nil + } + } + return createRes, nil } diff --git a/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/services/gateway/usershareprovider.go b/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/services/gateway/usershareprovider.go index 738faa826..422752fac 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/services/gateway/usershareprovider.go +++ b/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/services/gateway/usershareprovider.go @@ -20,7 +20,6 @@ package gateway import ( "context" - "slices" gateway "github.com/cs3org/go-cs3apis/cs3/gateway/v1beta1" rpc "github.com/cs3org/go-cs3apis/cs3/rpc/v1beta1" @@ -39,25 +38,14 @@ import ( // TODO(labkode): add multi-phase commit logic when commit share or commit ref is enabled. func (s *svc) CreateShare(ctx context.Context, req *collaboration.CreateShareRequest) (*collaboration.CreateShareResponse, error) { - // Don't use the share manager when sharing a space root - if !s.c.UseCommonSpaceRootShareLogic && refIsSpaceRoot(req.ResourceInfo.Id) { - return s.addSpaceShare(ctx, req) - } return s.addShare(ctx, req) } func (s *svc) RemoveShare(ctx context.Context, req *collaboration.RemoveShareRequest) (*collaboration.RemoveShareResponse, error) { - key := req.GetRef().GetKey() - if !s.c.UseCommonSpaceRootShareLogic && shareIsSpaceRoot(key) { - return s.removeSpaceShare(ctx, key.GetResourceId(), key.GetGrantee()) - } return s.removeShare(ctx, req) } func (s *svc) UpdateShare(ctx context.Context, req *collaboration.UpdateShareRequest) (*collaboration.UpdateShareResponse, error) { - if !s.c.UseCommonSpaceRootShareLogic && refIsSpaceRoot(req.GetShare().GetResourceId()) { - return s.updateSpaceShare(ctx, req) - } return s.updateShare(ctx, req) } @@ -150,7 +138,12 @@ func (s *svc) updateShare(ctx context.Context, req *collaboration.UpdateShareReq Expiration: res.GetShare().GetExpiration(), Creator: creator.GetId(), } - updateGrantStatus, err := s.updateGrant(ctx, res.GetShare().GetResourceId(), grant, nil) + var opaque *typesv1beta1.Opaque + if refIsSpaceRoot(res.GetShare().GetResourceId()) { + opaque = utils.SpaceGrantOpaque() + utils.AppendPlainToOpaque(opaque, "spacetype", utils.ReadPlainFromOpaque(req.GetOpaque(), "spacetype")) + } + updateGrantStatus, err := s.updateGrant(ctx, res.GetShare().GetResourceId(), grant, opaque) if err != nil { return nil, errors.Wrap(err, "gateway: error calling updateGrant") @@ -167,87 +160,6 @@ func (s *svc) updateShare(ctx context.Context, req *collaboration.UpdateShareReq return res, nil } -func (s *svc) updateSpaceShare(ctx context.Context, req *collaboration.UpdateShareRequest) (*collaboration.UpdateShareResponse, error) { - if req.GetShare().GetGrantee() == nil { - return &collaboration.UpdateShareResponse{Status: status.NewInvalid(ctx, "updating requires a received grantee object")}, nil - } - // If the share is a denial we call denyGrant instead. - var st *rpc.Status - var err error - // TODO: change CS3 APIs - opaque := &typesv1beta1.Opaque{ - Map: map[string]*typesv1beta1.OpaqueEntry{ - "spacegrant": {}, - }, - } - utils.AppendPlainToOpaque(opaque, "spacetype", utils.ReadPlainFromOpaque(req.Opaque, "spacetype")) - - if grants.PermissionsEqual(req.Share.GetPermissions().GetPermissions(), &provider.ResourcePermissions{}) { - st, err = s.denyGrant(ctx, req.GetShare().GetResourceId(), req.GetShare().GetGrantee(), opaque) - if err != nil { - return nil, errors.Wrap(err, "gateway: error denying grant in storage") - } - } else { - listGrantRes, err := s.listGrants(ctx, req.GetShare().GetResourceId()) - if err != nil { - return nil, errors.Wrap(err, "gateway: error getting grant to remove from storage") - } - existsGrant := s.getGranteeGrant(listGrantRes.GetGrants(), req.GetShare().GetGrantee()) - - if !slices.Contains(req.GetUpdateMask().GetPaths(), "permissions") { - req.Share.Permissions = &collaboration.SharePermissions{Permissions: existsGrant.GetPermissions()} - } - - if !slices.Contains(req.GetUpdateMask().GetPaths(), "expiration") { - req.Share.Expiration = existsGrant.GetExpiration() - } - - u, ok := ctxpkg.ContextGetUser(ctx) - if !ok { - return nil, errors.New("user not found in context") - } - - grant := &provider.Grant{ - Grantee: req.GetShare().GetGrantee(), - Permissions: req.GetShare().GetPermissions().GetPermissions(), - Expiration: req.GetShare().GetExpiration(), - Creator: u.GetId(), - } - - if grant.GetPermissions() == nil { - return &collaboration.UpdateShareResponse{Status: status.NewInvalid(ctx, "updating requires a received permission object")}, nil - } - - if !grant.GetPermissions().GetRemoveGrant() { - // this request might remove Manager Permissions so we need to - // check if there is at least one manager remaining of the - // resource. - if !isSpaceManagerRemaining(listGrantRes.GetGrants(), grant.GetGrantee()) { - return &collaboration.UpdateShareResponse{ - Status: status.NewPermissionDenied(ctx, errtypes.PermissionDenied(""), "can't remove the last manager"), - }, nil - } - - } - st, err = s.updateGrant(ctx, req.GetShare().GetResourceId(), grant, opaque) - if err != nil { - return nil, errors.Wrap(err, "gateway: error adding grant to storage") - } - } - - res := &collaboration.UpdateShareResponse{ - Status: st, - Share: req.Share, - } - - if st.Code != rpc.Code_CODE_OK { - return res, nil - } - - s.providerCache.RemoveListStorageProviders(req.GetShare().GetResourceId()) - return res, nil -} - // TODO(labkode): listing received shares just goes to the user share manager and gets the list of // received shares. The display name of the shares should be the a friendly name, like the basename // of the original file. @@ -526,53 +438,6 @@ func (s *svc) removeGrant(ctx context.Context, id *provider.ResourceId, g *provi return status.NewOK(ctx), nil } -func (s *svc) listGrants(ctx context.Context, id *provider.ResourceId) (*provider.ListGrantsResponse, error) { - ref := &provider.Reference{ - ResourceId: id, - } - - grantReq := &provider.ListGrantsRequest{ - Ref: ref, - } - - c, _, err := s.find(ctx, ref) - if err != nil { - appctx.GetLogger(ctx). - Err(err). - Interface("reference", ref). - Msg("listGrants: failed to get storage provider") - if _, ok := err.(errtypes.IsNotFound); ok { - return &provider.ListGrantsResponse{ - Status: status.NewNotFound(ctx, "storage provider not found"), - }, nil - } - return &provider.ListGrantsResponse{ - Status: status.NewInternal(ctx, "error finding storage provider"), - }, nil - } - - grantRes, err := c.ListGrants(ctx, grantReq) - if err != nil { - return nil, errors.Wrap(err, "gateway: error calling ListGrants") - } - if grantRes.Status.Code != rpc.Code_CODE_OK { - return &provider.ListGrantsResponse{Status: status.NewInternal(ctx, - "error listing storage grants"), - }, - nil - } - return grantRes, nil -} - -func (s *svc) getGranteeGrant(grants []*provider.Grant, grantee *provider.Grantee) *provider.Grant { - for _, g := range grants { - if isEqualGrantee(g.Grantee, grantee) { - return g - } - } - return nil -} - func (s *svc) addShare(ctx context.Context, req *collaboration.CreateShareRequest) (*collaboration.CreateShareResponse, error) { c, err := pool.GetUserShareProviderClient(s.c.UserShareProviderEndpoint) if err != nil { @@ -613,13 +478,18 @@ func (s *svc) addShare(ctx context.Context, req *collaboration.CreateShareReques if s.c.CommitShareToStorageGrant { // If the share is a denial we call denyGrant instead. var status *rpc.Status + var opaque *typesv1beta1.Opaque + if refIsSpaceRoot(req.ResourceInfo.Id) { + opaque = utils.SpaceGrantOpaque() + utils.AppendPlainToOpaque(opaque, "spacetype", req.ResourceInfo.GetSpace().GetSpaceType()) + } if grants.PermissionsEqual(req.Grant.Permissions.Permissions, &provider.ResourcePermissions{}) { - status, err = s.denyGrant(ctx, req.ResourceInfo.Id, req.Grant.Grantee, nil) + status, err = s.denyGrant(ctx, req.ResourceInfo.Id, req.Grant.Grantee, opaque) if err != nil { return nil, errors.Wrap(err, "gateway: error denying grant in storage") } } else { - status, err = s.addGrant(ctx, req.ResourceInfo.Id, req.Grant.Grantee, req.Grant.Permissions.Permissions, req.Grant.Expiration, nil) + status, err = s.addGrant(ctx, req.ResourceInfo.Id, req.Grant.Grantee, req.Grant.Permissions.Permissions, req.Grant.Expiration, opaque) if err != nil { appctx.GetLogger(ctx).Debug().Interface("status", status).Interface("req", req).Msg(err.Error()) rollBackFn(status) @@ -628,7 +498,7 @@ func (s *svc) addShare(ctx context.Context, req *collaboration.CreateShareReques } switch status.Code { - case rpc.Code_CODE_OK: + case rpc.Code_CODE_OK, rpc.Code_CODE_ALREADY_EXISTS: // ok case rpc.Code_CODE_UNIMPLEMENTED: appctx.GetLogger(ctx).Debug().Interface("status", status).Interface("req", req).Msg("storing grants not supported, ignoring") @@ -644,58 +514,6 @@ func (s *svc) addShare(ctx context.Context, req *collaboration.CreateShareReques return res, nil } -func (s *svc) addSpaceShare(ctx context.Context, req *collaboration.CreateShareRequest) (*collaboration.CreateShareResponse, error) { - if refIsSpaceRoot(req.GetResourceInfo().GetId()) && - (req.GetResourceInfo().GetSpace().GetSpaceType() == _spaceTypePersonal || req.GetResourceInfo().GetSpace().GetSpaceType() == _spaceTypeVirtual) { - return &collaboration.CreateShareResponse{Status: status.NewInvalid(ctx, "space type is not eligible for sharing")}, nil - } - // If the share is a denial we call denyGrant instead. - var st *rpc.Status - var err error - // TODO: change CS3 APIs - opaque := &typesv1beta1.Opaque{ - Map: map[string]*typesv1beta1.OpaqueEntry{ - "spacegrant": {}, - }, - } - utils.AppendPlainToOpaque( - opaque, - "spacetype", - req.ResourceInfo.GetSpace().GetSpaceType(), - ) - if grants.PermissionsEqual(req.Grant.Permissions.Permissions, &provider.ResourcePermissions{}) { - st, err = s.denyGrant(ctx, req.ResourceInfo.Id, req.Grant.Grantee, opaque) - if err != nil { - return nil, errors.Wrap(err, "gateway: error denying grant in storage") - } - } else { - st, err = s.addGrant(ctx, req.ResourceInfo.Id, req.Grant.Grantee, req.Grant.Permissions.Permissions, req.Grant.Expiration, opaque) - if err != nil { - return nil, errors.Wrap(err, "gateway: error adding grant to storage") - } - } - - switch st.Code { - case rpc.Code_CODE_OK: - s.providerCache.RemoveListStorageProviders(req.ResourceInfo.Id) - case rpc.Code_CODE_UNIMPLEMENTED: - appctx.GetLogger(ctx).Debug().Interface("status", st).Interface("req", req).Msg("storing grants not supported, ignoring") - default: - return &collaboration.CreateShareResponse{ - Status: st, - }, err - } - - return &collaboration.CreateShareResponse{ - Status: status.NewOK(ctx), - Share: &collaboration.Share{ - ResourceId: req.ResourceInfo.Id, - Permissions: &collaboration.SharePermissions{Permissions: req.Grant.Permissions.GetPermissions()}, - Grantee: req.Grant.Grantee, - }, - }, nil -} - func (s *svc) removeShare(ctx context.Context, req *collaboration.RemoveShareRequest) (*collaboration.RemoveShareResponse, error) { c, err := pool.GetUserShareProviderClient(s.c.UserShareProviderEndpoint) if err != nil { @@ -742,9 +560,16 @@ func (s *svc) removeShare(ctx context.Context, req *collaboration.RemoveShareReq if err != nil { return nil, errors.Wrap(err, "gateway: error calling RemoveShare") } + if res.Status.Code != rpc.Code_CODE_OK { + return res, nil + } if s.c.CommitShareToStorageGrant { - removeGrantStatus, err := s.removeGrant(ctx, share.ResourceId, share.Grantee, share.Permissions.Permissions, nil) + var opaque *typesv1beta1.Opaque + if refIsSpaceRoot(share.ResourceId) { + opaque = utils.SpaceGrantOpaque() + } + removeGrantStatus, err := s.removeGrant(ctx, share.ResourceId, share.Grantee, share.Permissions.Permissions, opaque) if err != nil { return nil, errors.Wrap(err, "gateway: error removing grant from storage") } @@ -758,58 +583,6 @@ func (s *svc) removeShare(ctx context.Context, req *collaboration.RemoveShareReq return res, nil } -func (s *svc) removeSpaceShare(ctx context.Context, ref *provider.ResourceId, grantee *provider.Grantee) (*collaboration.RemoveShareResponse, error) { - listGrantRes, err := s.listGrants(ctx, ref) - if err != nil { - return nil, errors.Wrap(err, "gateway: error getting grant to remove from storage") - } - var permissions *provider.ResourcePermissions - for _, g := range listGrantRes.Grants { - if isEqualGrantee(g.Grantee, grantee) { - permissions = g.Permissions - } - } - if permissions == nil { - return nil, errors.New("gateway: error getting grant to remove from storage") - } - - if len(listGrantRes.Grants) == 1 || !isSpaceManagerRemaining(listGrantRes.Grants, grantee) { - return &collaboration.RemoveShareResponse{ - Status: status.NewPermissionDenied(ctx, errtypes.PermissionDenied(""), "can't remove the last manager"), - }, nil - } - - // TODO: change CS3 APIs - opaque := &typesv1beta1.Opaque{ - Map: map[string]*typesv1beta1.OpaqueEntry{ - "spacegrant": {}, - }, - } - removeGrantStatus, err := s.removeGrant(ctx, ref, grantee, permissions, opaque) - if err != nil { - return nil, errors.Wrap(err, "gateway: error removing grant from storage") - } - if removeGrantStatus.Code != rpc.Code_CODE_OK { - return &collaboration.RemoveShareResponse{ - Status: removeGrantStatus, - }, err - } - s.providerCache.RemoveListStorageProviders(ref) - return &collaboration.RemoveShareResponse{Status: status.NewOK(ctx)}, nil -} - -func isSpaceManagerRemaining(grants []*provider.Grant, grantee *provider.Grantee) bool { - for _, g := range grants { - // RemoveGrant is currently the way to check for the manager role - // If it is not set than the current grant is not for a manager and - // we can just continue with the next one. - if g.Permissions.RemoveGrant && !isEqualGrantee(g.Grantee, grantee) { - return true - } - } - return false -} - func (s *svc) checkLock(ctx context.Context, shareId *collaboration.ShareId) (*rpc.Status, error) { logger := appctx.GetLogger(ctx) getShareRes, err := s.GetShare(ctx, &collaboration.GetShareRequest{ @@ -869,30 +642,3 @@ func refIsSpaceRoot(ref *provider.ResourceId) bool { return ref.SpaceId == ref.OpaqueId } - -func shareIsSpaceRoot(key *collaboration.ShareKey) bool { - if key == nil { - return false - } - return refIsSpaceRoot(key.ResourceId) -} - -func isEqualGrantee(a, b *provider.Grantee) bool { - // Ideally we would want to use utils.GranteeEqual() - // but the grants stored in the decomposedfs aren't complete (missing usertype and idp) - // because of that the check would fail so we can only check the ... for now. - if a.Type != b.Type { - return false - } - - var aID, bID string - switch a.Type { - case provider.GranteeType_GRANTEE_TYPE_GROUP: - aID = a.GetGroupId().GetOpaqueId() - bID = b.GetGroupId().GetOpaqueId() - case provider.GranteeType_GRANTEE_TYPE_USER: - aID = a.GetUserId().GetOpaqueId() - bID = b.GetUserId().GetOpaqueId() - } - return aID == bID -} diff --git a/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/services/sharesstorageprovider/sharesstorageprovider.go b/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/services/sharesstorageprovider/sharesstorageprovider.go index 2fa97da07..6c6ffb4e9 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/services/sharesstorageprovider/sharesstorageprovider.go +++ b/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/services/sharesstorageprovider/sharesstorageprovider.go @@ -46,6 +46,7 @@ import ( "github.com/opencloud-eu/reva/v2/pkg/rgrpc" "github.com/opencloud-eu/reva/v2/pkg/rgrpc/status" "github.com/opencloud-eu/reva/v2/pkg/rgrpc/todo/pool" + "github.com/opencloud-eu/reva/v2/pkg/share" "github.com/opencloud-eu/reva/v2/pkg/sharedconf" "github.com/opencloud-eu/reva/v2/pkg/utils" "github.com/pkg/errors" @@ -1093,12 +1094,8 @@ func (s *service) resolveAcceptedShare(ctx context.Context, ref *provider.Refere if ref.ResourceId.OpaqueId == utils.ShareStorageProviderID && ref.Path != "." { lsRes, err := sharingCollaborationClient.ListReceivedShares(ctx, &collaboration.ListReceivedSharesRequest{ Filters: []*collaboration.Filter{ - { - Type: collaboration.Filter_TYPE_STATE, - Term: &collaboration.Filter_State{ - State: collaboration.ShareState_SHARE_STATE_ACCEPTED, - }, - }, + share.StateFilter(collaboration.ShareState_SHARE_STATE_ACCEPTED), + share.SpaceRootFilter(false), // TODO filter by mountpoint? }, }) @@ -1179,12 +1176,8 @@ func (s *service) fetchAcceptedShares(ctx context.Context, opaque *typesv1beta1. lsRes, err := sharingCollaborationClient.ListReceivedShares(ctx, &collaboration.ListReceivedSharesRequest{ Filters: []*collaboration.Filter{ - { - Type: collaboration.Filter_TYPE_STATE, - Term: &collaboration.Filter_State{ - State: collaboration.ShareState_SHARE_STATE_ACCEPTED, - }, - }, + share.StateFilter(collaboration.ShareState_SHARE_STATE_ACCEPTED), + share.SpaceRootFilter(false), }, }) if err != nil { diff --git a/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/services/usershareprovider/usershareprovider.go b/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/services/usershareprovider/usershareprovider.go index ac3629334..1b801f581 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/services/usershareprovider/usershareprovider.go +++ b/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/services/usershareprovider/usershareprovider.go @@ -27,10 +27,12 @@ import ( "strings" gateway "github.com/cs3org/go-cs3apis/cs3/gateway/v1beta1" + grouppb "github.com/cs3org/go-cs3apis/cs3/identity/group/v1beta1" userpb "github.com/cs3org/go-cs3apis/cs3/identity/user/v1beta1" rpc "github.com/cs3org/go-cs3apis/cs3/rpc/v1beta1" collaboration "github.com/cs3org/go-cs3apis/cs3/sharing/collaboration/v1beta1" provider "github.com/cs3org/go-cs3apis/cs3/storage/provider/v1beta1" + typesv1beta1 "github.com/cs3org/go-cs3apis/cs3/types/v1beta1" "github.com/mitchellh/mapstructure" "github.com/pkg/errors" "github.com/rs/zerolog" @@ -54,6 +56,9 @@ const ( _fieldMaskPathMountPoint = "mount_point" _fieldMaskPathPermissions = "permissions" _fieldMaskPathState = "state" + _spaceTypePersonal = "personal" + _spaceTypeProject = "project" + _spaceTypeVirtual = "virtual" ) func init() { @@ -79,9 +84,9 @@ type service struct { allowedPathsForShares []*regexp.Regexp } -func getShareManager(c *config) (share.Manager, error) { +func getShareManager(c *config, logger *zerolog.Logger) (share.Manager, error) { if f, ok := registry.NewFuncs[c.Driver]; ok { - return f(c.Drivers[c.Driver]) + return f(c.Drivers[c.Driver], logger) } return nil, errtypes.NotFound("driver not found: " + c.Driver) } @@ -109,7 +114,7 @@ func parseConfig(m map[string]interface{}) (*config, error) { } // New creates a new user share provider svc initialized from defaults -func NewDefault(m map[string]interface{}, ss *grpc.Server, _ *zerolog.Logger) (rgrpc.Service, error) { +func NewDefault(m map[string]any, ss *grpc.Server, logger *zerolog.Logger) (rgrpc.Service, error) { c, err := parseConfig(m) if err != nil { @@ -118,7 +123,7 @@ func NewDefault(m map[string]interface{}, ss *grpc.Server, _ *zerolog.Logger) (r c.init() - sm, err := getShareManager(c) + sm, err := getShareManager(c, logger) if err != nil { return nil, err } @@ -166,13 +171,6 @@ func (s *service) isPathAllowed(path string) bool { func (s *service) CreateShare(ctx context.Context, req *collaboration.CreateShareRequest) (*collaboration.CreateShareResponse, error) { log := appctx.GetLogger(ctx) user := ctxpkg.ContextMustGetUser(ctx) - // Grants must not allow grant permissions - if HasGrantPermissions(req.GetGrant().GetPermissions().GetPermissions()) { - return &collaboration.CreateShareResponse{ - Status: status.NewInvalidArg(ctx, "resharing not supported"), - }, nil - } - // check if the grantee is a user or group if req.GetGrant().GetGrantee().GetType() == provider.GranteeType_GRANTEE_TYPE_USER { // check if the tenantId of the user matches the tenantId of the target user @@ -202,8 +200,8 @@ func (s *service) CreateShare(ctx context.Context, req *collaboration.CreateShar }, nil } + // use logged in user Idp as default, if the Grantee does not have an IDP set. if req.GetGrant().GetGrantee().GetType() == provider.GranteeType_GRANTEE_TYPE_USER && req.GetGrant().GetGrantee().GetUserId().GetIdp() == "" { - // use logged in user Idp as default. req.GetGrant().GetGrantee().Id = &provider.Grantee_UserId{ UserId: &userpb.UserId{ OpaqueId: req.GetGrant().GetGrantee().GetUserId().GetOpaqueId(), @@ -211,6 +209,16 @@ func (s *service) CreateShare(ctx context.Context, req *collaboration.CreateShar Type: userpb.UserType_USER_TYPE_PRIMARY}, } } + // some for group grantees + if req.GetGrant().GetGrantee().GetType() == provider.GranteeType_GRANTEE_TYPE_GROUP && req.GetGrant().GetGrantee().GetGroupId().GetIdp() == "" { + // use logged in user Idp as default. + req.GetGrant().GetGrantee().Id = &provider.Grantee_GroupId{ + GroupId: &grouppb.GroupId{ + OpaqueId: req.GetGrant().GetGrantee().GetGroupId().GetOpaqueId(), + Idp: user.GetId().GetIdp(), + Type: grouppb.GroupType_GROUP_TYPE_REGULAR}, + } + } sRes, err := gatewayClient.Stat(ctx, &provider.StatRequest{Ref: &provider.Reference{ResourceId: req.GetResourceInfo().GetId()}}) if err != nil { @@ -225,6 +233,55 @@ func (s *service) CreateShare(ctx context.Context, req *collaboration.CreateShar Status: status.NewPermissionDenied(ctx, nil, "no permission to add grants on shared resource"), }, err } + + isSpaceRoot := utils.IsSpaceRoot(sRes.GetInfo()) + var noEvent bool + + if isSpaceRoot { + if sRes.GetInfo().GetSpace().GetSpaceType() == _spaceTypePersonal || sRes.GetInfo().GetSpace().GetSpaceType() == _spaceTypeVirtual { + return &collaboration.CreateShareResponse{Status: status.NewInvalid(ctx, "space type is not eligible for sharing")}, nil + } + } + + // do not allow share to myself or the owner if share is for a user + if req.GetGrant().GetGrantee().GetType() == provider.GranteeType_GRANTEE_TYPE_USER && + (utils.UserEqual(req.GetGrant().GetGrantee().GetUserId(), user.Id) || utils.UserEqual(req.GetGrant().GetGrantee().GetUserId(), sRes.GetInfo().GetOwner())) { + + denySelfShare := true + // To allow adding the initial "mananger" share for the creator of a space when need to make an exception here + // if the shared resource is a space root, that does not have any Share existin yet. Note, that we have already + // verified that the user adding the share does really have "AddGrant" permissions on the affected resource, so + // this "hack" should be ok. + if isSpaceRoot { + shares, err := s.sm.ListShares( + ctx, + []*collaboration.Filter{share.ResourceIDFilter(req.GetResourceInfo().GetId())}, + ) + if err != nil { + return &collaboration.CreateShareResponse{ + Status: status.NewInternal(ctx, "failed to list existing shares"), + }, nil + } + if len(shares) == 0 { + denySelfShare = false + noEvent = true + } + } + if denySelfShare { + err := errtypes.BadRequest("jsoncs3: owner/creator and grantee are the same") + return nil, err + } + } + + // resharing is forbidden for not space roots + if !isSpaceRoot { + // Resharing of Files/Directories is forbidden. So the grants must not allow the "grant" permissions + if HasGrantPermissions(req.GetGrant().GetPermissions().GetPermissions()) { + return &collaboration.CreateShareResponse{ + Status: status.NewInvalidArg(ctx, "resharing not supported"), + }, nil + } + } // check if the share creator has sufficient permissions to do so. if shareCreationAllowed := conversions.SufficientCS3Permissions( sRes.GetInfo().GetPermissionSet(), @@ -256,10 +313,22 @@ func (s *service) CreateShare(ctx context.Context, req *collaboration.CreateShar }, nil } + var opaque *typesv1beta1.Opaque + if isSpaceRoot { + opaque = utils.SpaceGrantOpaque() + } + + if noEvent { + opaque = &typesv1beta1.Opaque{ + Map: map[string]*typesv1beta1.OpaqueEntry{ + "noevent": {}, + }, + } + } return &collaboration.CreateShareResponse{ Status: status.NewOK(ctx), Share: createdShare, - Opaque: utils.AppendPlainToOpaque(nil, "resourcename", sRes.GetInfo().GetName()), + Opaque: utils.AppendPlainToOpaque(opaque, "resourcename", sRes.GetInfo().GetName()), }, nil } @@ -267,6 +336,30 @@ func HasGrantPermissions(p *provider.ResourcePermissions) bool { return p.GetAddGrant() || p.GetUpdateGrant() || p.GetRemoveGrant() || p.GetDenyGrant() } +// spaceRootHasRemainingManager returns true if the given resource has at least one share +// (excluding the share with excludeShareOpaqueID) that grants both AddGrant and RemoveGrant. +func (s *service) spaceRootHasRemainingManager(ctx context.Context, resourceID *provider.ResourceId, excludeShareOpaqueID string) (bool, error) { + shares, err := s.sm.ListShares(ctx, []*collaboration.Filter{ + { + Type: collaboration.Filter_TYPE_RESOURCE_ID, + Term: &collaboration.Filter_ResourceId{ResourceId: resourceID}, + }, + }) + if err != nil { + return false, err + } + for _, s := range shares { + if s.GetId().GetOpaqueId() == excludeShareOpaqueID { + continue + } + perms := s.GetPermissions().GetPermissions() + if perms.GetAddGrant() && perms.GetRemoveGrant() { + return true, nil + } + } + return false, nil +} + func (s *service) RemoveShare(ctx context.Context, req *collaboration.RemoveShareRequest) (*collaboration.RemoveShareResponse, error) { log := appctx.GetLogger(ctx) user := ctxpkg.ContextMustGetUser(ctx) @@ -300,6 +393,20 @@ func (s *service) RemoveShare(ctx context.Context, req *collaboration.RemoveShar }, err } + // For space root shares, ensure at least one share with both AddGrant and RemoveGrant will remain + // so the space always has a manager who can administer grants. + if utils.IsSpaceRoot(sRes.GetInfo()) { + if ok, err := s.spaceRootHasRemainingManager(ctx, share.GetResourceId(), share.GetId().GetOpaqueId()); err != nil { + return &collaboration.RemoveShareResponse{ + Status: status.NewInternal(ctx, "failed to list shares for space root"), + }, nil + } else if !ok { + return &collaboration.RemoveShareResponse{ + Status: status.NewPermissionDenied(ctx, nil, "cannot remove the last share with manager permissions on a space root"), + }, nil + } + } + err = s.sm.Unshare(ctx, req.Ref) if err != nil { return &collaboration.RemoveShareResponse{ @@ -307,16 +414,20 @@ func (s *service) RemoveShare(ctx context.Context, req *collaboration.RemoveShar }, nil } - o := utils.AppendJSONToOpaque(nil, "resourceid", share.GetResourceId()) - o = utils.AppendPlainToOpaque(o, "resourcename", sRes.GetInfo().GetName()) + var opaque *typesv1beta1.Opaque + if utils.IsSpaceRoot(sRes.GetInfo()) { + opaque = utils.SpaceGrantOpaque() + } + opaque = utils.AppendJSONToOpaque(opaque, "resourceid", share.GetResourceId()) + opaque = utils.AppendPlainToOpaque(opaque, "resourcename", sRes.GetInfo().GetName()) if user := share.GetGrantee().GetUserId(); user != nil { - o = utils.AppendJSONToOpaque(o, "granteeuserid", user) + opaque = utils.AppendJSONToOpaque(opaque, "granteeuserid", user) } else { - o = utils.AppendJSONToOpaque(o, "granteegroupid", share.GetGrantee().GetGroupId()) + opaque = utils.AppendJSONToOpaque(opaque, "granteegroupid", share.GetGrantee().GetGroupId()) } return &collaboration.RemoveShareResponse{ - Opaque: o, + Opaque: opaque, Status: status.NewOK(ctx), }, nil } @@ -361,13 +472,6 @@ func (s *service) UpdateShare(ctx context.Context, req *collaboration.UpdateShar log := appctx.GetLogger(ctx) user := ctxpkg.ContextMustGetUser(ctx) - // Grants must not allow grant permissions - if HasGrantPermissions(req.GetShare().GetPermissions().GetPermissions()) { - return &collaboration.UpdateShareResponse{ - Status: status.NewInvalidArg(ctx, "resharing not supported"), - }, nil - } - gatewayClient, err := s.gatewaySelector.Next() if err != nil { return nil, err @@ -427,6 +531,15 @@ func (s *service) UpdateShare(ctx context.Context, req *collaboration.UpdateShar }, err } + // resharing is forbidden for not space roots + if !utils.IsSpaceRoot(sRes.GetInfo()) { + // Resharing of Files/Directories is forbidden. So the grants must not allow the "grant" permissions + if HasGrantPermissions(req.GetShare().GetPermissions().GetPermissions()) { + return &collaboration.UpdateShareResponse{ + Status: status.NewInvalidArg(ctx, "resharing not supported"), + }, nil + } + } // If this is a permissions update, check if user's permissions on the resource are sufficient to set the desired permissions var newPermissions *provider.ResourcePermissions if slices.Contains(req.GetUpdateMask().GetPaths(), _fieldMaskPathPermissions) { @@ -440,6 +553,20 @@ func (s *service) UpdateShare(ctx context.Context, req *collaboration.UpdateShar }, nil } + // For space root shares, if the new permissions would strip AddGrant or RemoveGrant from this share, + // ensure at least one other share still has both so the space retains a manager. + if utils.IsSpaceRoot(sRes.GetInfo()) && newPermissions != nil && (!newPermissions.GetAddGrant() || !newPermissions.GetRemoveGrant()) { + if ok, err := s.spaceRootHasRemainingManager(ctx, currentShare.GetResourceId(), currentShare.GetId().GetOpaqueId()); err != nil { + return &collaboration.UpdateShareResponse{ + Status: status.NewInternal(ctx, "failed to list shares for space root"), + }, nil + } else if !ok { + return &collaboration.UpdateShareResponse{ + Status: status.NewPermissionDenied(ctx, nil, "cannot remove the last share with manager permissions on a space root"), + }, nil + } + } + // check if the requested permission are plausible for the Resource // do we need more here? if sRes.GetInfo().GetType() == provider.ResourceType_RESOURCE_TYPE_FILE { @@ -457,10 +584,15 @@ func (s *service) UpdateShare(ctx context.Context, req *collaboration.UpdateShar }, nil } + var opaque *typesv1beta1.Opaque + if utils.IsSpaceRoot(sRes.GetInfo()) { + opaque = utils.SpaceGrantOpaque() + } + res := &collaboration.UpdateShareResponse{ Status: status.NewOK(ctx), Share: share, - Opaque: utils.AppendPlainToOpaque(nil, "resourcename", sRes.GetInfo().GetName()), + Opaque: utils.AppendPlainToOpaque(opaque, "resourcename", sRes.GetInfo().GetName()), } return res, nil } diff --git a/vendor/github.com/opencloud-eu/reva/v2/internal/http/services/owncloud/ocs/handlers/apps/sharing/shares/pending.go b/vendor/github.com/opencloud-eu/reva/v2/internal/http/services/owncloud/ocs/handlers/apps/sharing/shares/pending.go index 7e6ac28d3..8b263d10c 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/internal/http/services/owncloud/ocs/handlers/apps/sharing/shares/pending.go +++ b/vendor/github.com/opencloud-eu/reva/v2/internal/http/services/owncloud/ocs/handlers/apps/sharing/shares/pending.go @@ -179,6 +179,10 @@ func (h *Handler) UpdateReceivedShare(w http.ResponseWriter, r *http.Request) { response.WriteOCSSuccess(w, r, []*conversions.ShareData{data}) } +func (h *Handler) ReceivedShareNotFound(w http.ResponseWriter, r *http.Request) { + response.WriteOCSError(w, r, response.MetaNotFound.StatusCode, "cannot find share", nil) +} + func (h *Handler) updateReceivedShare(ctx context.Context, receivedShare *collaboration.ReceivedShare, fieldMask *fieldmaskpb.FieldMask) (*conversions.ShareData, response.Meta, error) { logger := appctx.GetLogger(ctx) diff --git a/vendor/github.com/opencloud-eu/reva/v2/internal/http/services/owncloud/ocs/handlers/apps/sharing/shares/shares.go b/vendor/github.com/opencloud-eu/reva/v2/internal/http/services/owncloud/ocs/handlers/apps/sharing/shares/shares.go index d44c3316c..753e1c862 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/internal/http/services/owncloud/ocs/handlers/apps/sharing/shares/shares.go +++ b/vendor/github.com/opencloud-eu/reva/v2/internal/http/services/owncloud/ocs/handlers/apps/sharing/shares/shares.go @@ -78,7 +78,6 @@ var ( type Handler struct { gatewayAddr string machineAuthAPIKey string - storageRegistryAddr string publicURL string sharePrefix string homeNamespace string @@ -129,7 +128,6 @@ type GatewayClientGetter func() (gateway.GatewayAPIClient, error) func (h *Handler) Init(c *config.Config) error { h.gatewayAddr = c.GatewaySvc h.machineAuthAPIKey = c.MachineAuthAPIKey - h.storageRegistryAddr = c.StorageregistrySvc h.publicURL = c.Config.Host h.sharePrefix = c.SharePrefix h.homeNamespace = c.HomeNamespace @@ -941,12 +939,11 @@ func (h *Handler) RemoveShare(w http.ResponseWriter, r *http.Request) { h.removeFederatedShare(w, r, shareID) return } - - if prov, ok := h.isSpaceShare(r, shareID); ok { - // The request is a remove space member request. - h.removeSpaceMember(w, r, shareID, prov) + if h.isSpaceShare(r, shareID) { + h.removeSpaceMember(w, r, shareID) return } + response.WriteOCSError(w, r, response.MetaNotFound.StatusCode, "cannot find share", nil) } diff --git a/vendor/github.com/opencloud-eu/reva/v2/internal/http/services/owncloud/ocs/handlers/apps/sharing/shares/spaces.go b/vendor/github.com/opencloud-eu/reva/v2/internal/http/services/owncloud/ocs/handlers/apps/sharing/shares/spaces.go index 3a1a2f595..94d0a0501 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/internal/http/services/owncloud/ocs/handlers/apps/sharing/shares/spaces.go +++ b/vendor/github.com/opencloud-eu/reva/v2/internal/http/services/owncloud/ocs/handlers/apps/sharing/shares/spaces.go @@ -29,18 +29,12 @@ import ( rpc "github.com/cs3org/go-cs3apis/cs3/rpc/v1beta1" collaborationv1beta1 "github.com/cs3org/go-cs3apis/cs3/sharing/collaboration/v1beta1" provider "github.com/cs3org/go-cs3apis/cs3/storage/provider/v1beta1" - registry "github.com/cs3org/go-cs3apis/cs3/storage/registry/v1beta1" types "github.com/cs3org/go-cs3apis/cs3/types/v1beta1" "github.com/opencloud-eu/reva/v2/internal/http/services/owncloud/ocs/response" "github.com/opencloud-eu/reva/v2/pkg/appctx" "github.com/opencloud-eu/reva/v2/pkg/conversions" - "github.com/opencloud-eu/reva/v2/pkg/errtypes" - "github.com/opencloud-eu/reva/v2/pkg/rgrpc/status" - "github.com/opencloud-eu/reva/v2/pkg/rgrpc/todo/pool" - sdk "github.com/opencloud-eu/reva/v2/pkg/sdk/common" "github.com/opencloud-eu/reva/v2/pkg/storagespace" "github.com/opencloud-eu/reva/v2/pkg/utils" - "github.com/pkg/errors" "google.golang.org/protobuf/types/known/fieldmaskpb" ) @@ -131,45 +125,34 @@ func (h *Handler) addSpaceMember(w http.ResponseWriter, r *http.Request, info *p fieldmask = append(fieldmask, "expiration") } - ref := provider.Reference{ResourceId: info.GetId()} - p, err := h.findProvider(ctx, &ref) - if err != nil { - response.WriteOCSError(w, r, response.MetaNotFound.StatusCode, "error getting storage provider", err) + lsRes, err := client.ListShares(ctx, &collaborationv1beta1.ListSharesRequest{ + Filters: []*collaborationv1beta1.Filter{ + { + Type: collaborationv1beta1.Filter_TYPE_RESOURCE_ID, + Term: &collaborationv1beta1.Filter_ResourceId{ + ResourceId: info.GetId(), + }, + }, + }, + }) + if err != nil || lsRes.Status.Code != rpc.Code_CODE_OK { + response.WriteOCSError(w, r, response.MetaServerError.StatusCode, "error listing space members", err) return } - providerClient, err := h.getStorageProviderClient(p) - if err != nil { - response.WriteOCSError(w, r, response.MetaNotFound.StatusCode, "error getting storage provider client", err) - return - } - - lgRes, err := providerClient.ListGrants(ctx, &provider.ListGrantsRequest{Ref: &ref}) - if err != nil || lgRes.Status.Code != rpc.Code_CODE_OK { - response.WriteOCSError(w, r, response.MetaServerError.StatusCode, "error listing space grants", err) - return - } - - if !isSpaceManagerRemaining(lgRes.Grants, &grantee) { + if !isSpaceManagerRemainingInShares(lsRes.Shares, &grantee) { response.WriteOCSError(w, r, http.StatusForbidden, "the space must have at least one manager", nil) return } - // we have to send the update request to the gateway to give it a chance to invalidate its cache - // TODO the gateway no longer should cache stuff because invalidation is to expensive. The decomposedfs already has a better cache. - if granteeExists(lgRes.Grants, &grantee) { + if existingShare := findShareByGrantee(lsRes.Shares, &grantee); existingShare != nil { if permissions != nil { fieldmask = append(fieldmask, "permissions") } updateShareReq := &collaborationv1beta1.UpdateShareRequest{ - // TODO: change CS3 APIs - Opaque: &types.Opaque{ - Map: map[string]*types.OpaqueEntry{ - "spacegrant": {}, - }, - }, + Opaque: utils.AppendPlainToOpaque(nil, "spacetype", info.GetSpace().GetSpaceType()), Share: &collaborationv1beta1.Share{ - ResourceId: ref.GetResourceId(), + Id: existingShare.Id, Permissions: &collaborationv1beta1.SharePermissions{ Permissions: permissions, }, @@ -180,10 +163,9 @@ func (h *Handler) addSpaceMember(w http.ResponseWriter, r *http.Request, info *p Paths: fieldmask, }, } - updateShareReq.Opaque = utils.AppendPlainToOpaque(updateShareReq.Opaque, "spacetype", info.GetSpace().GetSpaceType()) updateShareRes, err := client.UpdateShare(ctx, updateShareReq) if err != nil || updateShareRes.Status.Code != rpc.Code_CODE_OK { - response.WriteOCSError(w, r, response.MetaServerError.StatusCode, "could not update space member grant", err) + response.WriteOCSError(w, r, response.MetaServerError.StatusCode, "could not update space member", err) return } } else { @@ -198,7 +180,7 @@ func (h *Handler) addSpaceMember(w http.ResponseWriter, r *http.Request, info *p }, }) if err != nil || createShareRes.Status.Code != rpc.Code_CODE_OK { - response.WriteOCSError(w, r, response.MetaServerError.StatusCode, "could not add space member grant", err) + response.WriteOCSError(w, r, response.MetaServerError.StatusCode, "could not add space member", err) return } } @@ -206,21 +188,22 @@ func (h *Handler) addSpaceMember(w http.ResponseWriter, r *http.Request, info *p response.WriteOCSSuccess(w, r, nil) } -func (h *Handler) isSpaceShare(r *http.Request, spaceID string) (*registry.ProviderInfo, bool) { - ref, err := storagespace.ParseReference(spaceID) - if err != nil { - return nil, false +func (h *Handler) isSpaceShare(r *http.Request, shareID string) bool { + ref, err := storagespace.ParseReference(shareID) + // NOTE: we ignore the 'Path' part of the reference here as we're just interested in the space root + switch { + case err != nil: + return false + case ref.GetResourceId().GetSpaceId() == "": + return false + case ref.GetResourceId().GetOpaqueId() == "" || ref.GetResourceId().GetSpaceId() == ref.GetResourceId().GetOpaqueId(): + return true + default: + return false } - - if ref.ResourceId.OpaqueId == "" { - ref.ResourceId.OpaqueId = ref.ResourceId.SpaceId - } - - p, err := h.findProvider(r.Context(), &ref) - return p, err == nil } -func (h *Handler) removeSpaceMember(w http.ResponseWriter, r *http.Request, spaceID string, prov *registry.ProviderInfo) { +func (h *Handler) removeSpaceMember(w http.ResponseWriter, r *http.Request, spaceID string) { ctx := r.Context() shareWith := r.URL.Query().Get("shareWith") @@ -245,129 +228,73 @@ func (h *Handler) removeSpaceMember(w http.ResponseWriter, r *http.Request, spac ref.ResourceId.OpaqueId = ref.ResourceId.SpaceId } - providerClient, err := h.getStorageProviderClient(prov) - if err != nil { - response.WriteOCSError(w, r, response.MetaNotFound.StatusCode, "error getting storage provider client", err) - return - } - - lgRes, err := providerClient.ListGrants(ctx, &provider.ListGrantsRequest{Ref: &ref}) - if err != nil || lgRes.Status.Code != rpc.Code_CODE_OK { - response.WriteOCSError(w, r, response.MetaServerError.StatusCode, "error listing space grants", err) - return - } - - if len(lgRes.Grants) == 1 || !isSpaceManagerRemaining(lgRes.Grants, &grantee) { - response.WriteOCSError(w, r, http.StatusForbidden, "can't remove the last manager", nil) - return - } - - gatewayClient, err := h.getClient() + client, err := h.getClient() if err != nil { response.WriteOCSError(w, r, response.MetaNotFound.StatusCode, "error getting gateway client", err) return } - removeShareRes, err := gatewayClient.RemoveShare(ctx, &collaborationv1beta1.RemoveShareRequest{ - Ref: &collaborationv1beta1.ShareReference{ - Spec: &collaborationv1beta1.ShareReference_Key{ - Key: &collaborationv1beta1.ShareKey{ + lsRes, err := client.ListShares(ctx, &collaborationv1beta1.ListSharesRequest{ + Filters: []*collaborationv1beta1.Filter{ + { + Type: collaborationv1beta1.Filter_TYPE_RESOURCE_ID, + Term: &collaborationv1beta1.Filter_ResourceId{ ResourceId: ref.ResourceId, - Grantee: &grantee, }, }, }, }) + if err != nil || lsRes.Status.Code != rpc.Code_CODE_OK { + response.WriteOCSError(w, r, response.MetaServerError.StatusCode, "error listing space members", err) + return + } + + if len(lsRes.Shares) == 1 || !isSpaceManagerRemainingInShares(lsRes.Shares, &grantee) { + response.WriteOCSError(w, r, http.StatusForbidden, "can't remove the last manager", nil) + return + } + + s := findShareByGrantee(lsRes.Shares, &grantee) + if s == nil { + response.WriteOCSError(w, r, response.MetaNotFound.StatusCode, "cannot find share", nil) + return + } + + removeShareRes, err := client.RemoveShare(ctx, &collaborationv1beta1.RemoveShareRequest{ + Ref: &collaborationv1beta1.ShareReference{ + Spec: &collaborationv1beta1.ShareReference_Id{ + Id: s.Id, + }, + }, + }) if err != nil { - response.WriteOCSError(w, r, response.MetaServerError.StatusCode, "error removing grant", err) + response.WriteOCSError(w, r, response.MetaServerError.StatusCode, "error removing space member", err) return } if removeShareRes.Status.Code != rpc.Code_CODE_OK { - response.WriteOCSError(w, r, response.MetaServerError.StatusCode, "error removing grant", err) + response.WriteOCSError(w, r, response.MetaServerError.StatusCode, "error removing space member", nil) return } response.WriteOCSSuccess(w, r, nil) } -func (h *Handler) getStorageProviderClient(p *registry.ProviderInfo) (provider.ProviderAPIClient, error) { - c, err := pool.GetStorageProviderServiceClient(p.Address) - if err != nil { - err = errors.Wrap(err, "shares spaces: error getting a storage provider client") - return nil, err - } - - return c, nil -} - -func (h *Handler) findProvider(ctx context.Context, ref *provider.Reference) (*registry.ProviderInfo, error) { - c, err := pool.GetStorageRegistryClient(h.storageRegistryAddr) - if err != nil { - return nil, errors.Wrap(err, "shares spaces: error getting storage registry client") - } - - filters := map[string]string{} - if ref.Path != "" { - filters["path"] = ref.Path - } - if ref.ResourceId != nil { - filters["storage_id"] = ref.ResourceId.StorageId - filters["space_id"] = ref.ResourceId.SpaceId - filters["opaque_id"] = ref.ResourceId.OpaqueId - } - - listReq := ®istry.ListStorageProvidersRequest{ - Opaque: &types.Opaque{}, - } - sdk.EncodeOpaqueMap(listReq.Opaque, filters) - - res, err := c.ListStorageProviders(ctx, listReq) - - if err != nil { - return nil, errors.Wrap(err, "shares spaces: error calling ListStorageProviders") - } - - if res.Status.Code != rpc.Code_CODE_OK { - switch res.Status.Code { - case rpc.Code_CODE_NOT_FOUND: - return nil, errtypes.NotFound("shares spaces: storage provider not found for reference:" + ref.String()) - case rpc.Code_CODE_PERMISSION_DENIED: - return nil, errtypes.PermissionDenied("shares spaces: " + res.Status.Message + " for " + ref.String() + " with code " + res.Status.Code.String()) - case rpc.Code_CODE_INVALID_ARGUMENT, rpc.Code_CODE_FAILED_PRECONDITION, rpc.Code_CODE_OUT_OF_RANGE: - return nil, errtypes.BadRequest("shares spaces: " + res.Status.Message + " for " + ref.String() + " with code " + res.Status.Code.String()) - case rpc.Code_CODE_UNIMPLEMENTED: - return nil, errtypes.NotSupported("shares spaces: " + res.Status.Message + " for " + ref.String() + " with code " + res.Status.Code.String()) - default: - return nil, status.NewErrorFromCode(res.Status.Code, "shares spaces") - } - } - - if len(res.Providers) < 1 { - return nil, errtypes.NotFound("shares spaces: no provider found") - } - - return res.Providers[0], nil -} - -func isSpaceManagerRemaining(grants []*provider.Grant, grantee *provider.Grantee) bool { - for _, g := range grants { - // RemoveGrant is currently the way to check for the manager role - // If it is not set than the current grant is not for a manager and - // we can just continue with the next one. - if g.Permissions.RemoveGrant && !isEqualGrantee(g.Grantee, grantee) { +func isSpaceManagerRemainingInShares(shares []*collaborationv1beta1.Share, grantee *provider.Grantee) bool { + for _, s := range shares { + if s.GetPermissions().GetPermissions().GetRemoveGrant() && !isEqualGrantee(s.Grantee, grantee) { return true } } return false } -func granteeExists(grants []*provider.Grant, grantee *provider.Grantee) bool { - for _, g := range grants { - if isEqualGrantee(g.Grantee, grantee) { - return true +func findShareByGrantee(shares []*collaborationv1beta1.Share, grantee *provider.Grantee) *collaborationv1beta1.Share { + for _, s := range shares { + if isEqualGrantee(s.Grantee, grantee) { + return s } } - return false + return nil } func isEqualGrantee(a, b *provider.Grantee) bool { diff --git a/vendor/github.com/opencloud-eu/reva/v2/internal/http/services/owncloud/ocs/handlers/apps/sharing/shares/user.go b/vendor/github.com/opencloud-eu/reva/v2/internal/http/services/owncloud/ocs/handlers/apps/sharing/shares/user.go index fbea09a26..ce45c6002 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/internal/http/services/owncloud/ocs/handlers/apps/sharing/shares/user.go +++ b/vendor/github.com/opencloud-eu/reva/v2/internal/http/services/owncloud/ocs/handlers/apps/sharing/shares/user.go @@ -34,6 +34,7 @@ import ( ctxpkg "github.com/opencloud-eu/reva/v2/pkg/ctx" "github.com/opencloud-eu/reva/v2/pkg/permission" "github.com/opencloud-eu/reva/v2/pkg/rgrpc/todo/pool" + "github.com/opencloud-eu/reva/v2/pkg/share" "github.com/opencloud-eu/reva/v2/pkg/utils" ) @@ -330,7 +331,7 @@ func (h *Handler) listUserShares(r *http.Request, filters []*collaboration.Filte log := appctx.GetLogger(ctx) lsUserSharesRequest := collaboration.ListSharesRequest{ - Filters: filters, + Filters: append(filters, share.SpaceRootFilter(false)), } ocsDataPayload := make([]*conversions.ShareData, 0) diff --git a/vendor/github.com/opencloud-eu/reva/v2/internal/http/services/owncloud/ocs/ocs.go b/vendor/github.com/opencloud-eu/reva/v2/internal/http/services/owncloud/ocs/ocs.go index 40113a73f..795827b30 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/internal/http/services/owncloud/ocs/ocs.go +++ b/vendor/github.com/opencloud-eu/reva/v2/internal/http/services/owncloud/ocs/ocs.go @@ -123,6 +123,13 @@ func (s *svc) routerInit(log *zerolog.Logger) error { r.Delete("/", sharesHandler.RejectReceivedShare) r.Put("/", sharesHandler.UpdateReceivedShare) }) + r.Route("/pending", func(r chi.Router) { + r.Post("/", func(w http.ResponseWriter, r *http.Request) { + w.WriteHeader(http.StatusMethodNotAllowed) + }) + r.Delete("/", sharesHandler.ReceivedShareNotFound) + r.Put("/", sharesHandler.ReceivedShareNotFound) + }) r.Route("/remote_shares", func(r chi.Router) { r.Get("/", sharesHandler.ListFederatedShares) r.Get("/{shareid}", sharesHandler.GetFederatedShare) diff --git a/vendor/github.com/opencloud-eu/reva/v2/pkg/share/manager/jsoncs3/jsoncs3.go b/vendor/github.com/opencloud-eu/reva/v2/pkg/share/manager/jsoncs3/jsoncs3.go index eac37873f..cf336ecb0 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/pkg/share/manager/jsoncs3/jsoncs3.go +++ b/vendor/github.com/opencloud-eu/reva/v2/pkg/share/manager/jsoncs3/jsoncs3.go @@ -36,9 +36,9 @@ import ( "github.com/opencloud-eu/reva/v2/pkg/errtypes" "github.com/opencloud-eu/reva/v2/pkg/events" "github.com/opencloud-eu/reva/v2/pkg/events/stream" - "github.com/opencloud-eu/reva/v2/pkg/logger" "github.com/opencloud-eu/reva/v2/pkg/rgrpc/todo/pool" "github.com/opencloud-eu/reva/v2/pkg/share" + migration "github.com/opencloud-eu/reva/v2/pkg/share/manager/jsoncs3/migrations" "github.com/opencloud-eu/reva/v2/pkg/share/manager/jsoncs3/providercache" "github.com/opencloud-eu/reva/v2/pkg/share/manager/jsoncs3/receivedsharecache" "github.com/opencloud-eu/reva/v2/pkg/share/manager/jsoncs3/sharecache" @@ -48,6 +48,7 @@ import ( "github.com/opencloud-eu/reva/v2/pkg/storagespace" "github.com/opencloud-eu/reva/v2/pkg/utils" "github.com/pkg/errors" + "github.com/rs/zerolog" "go.opentelemetry.io/otel/codes" "golang.org/x/sync/errgroup" "google.golang.org/genproto/protobuf/field_mask" @@ -122,14 +123,20 @@ var ( ) type config struct { - GatewayAddr string `mapstructure:"gateway_addr"` - MaxConcurrency int `mapstructure:"max_concurrency"` - ProviderAddr string `mapstructure:"provider_addr"` - ServiceUserID string `mapstructure:"service_user_id"` - ServiceUserIdp string `mapstructure:"service_user_idp"` - MachineAuthAPIKey string `mapstructure:"machine_auth_apikey"` - CacheTTL int `mapstructure:"ttl"` - Events EventOptions `mapstructure:"events"` + GatewayAddr string `mapstructure:"gateway_addr"` + MaxConcurrency int `mapstructure:"max_concurrency"` + ProviderAddr string `mapstructure:"provider_addr"` + SystemUserID string `mapstructure:"system_user_id"` + SystemUserIdp string `mapstructure:"system_user_idp"` + MachineAuthAPIKey string `mapstructure:"machine_auth_apikey"` + ServiceAccountID string `mapstructure:"service_account_id"` + ServiceAccountSecret string `mapstructure:"service_account_secret"` + // ProviderRegistryAddr is the address of the storage registry used during + // migrations. Defaults to GatewayAddr when empty, because in the default + // OpenCloud deployment the registry is co-located with the gateway. + ProviderRegistryAddr string `mapstructure:"provider_registry_addr"` + CacheTTL int `mapstructure:"ttl"` + Events EventOptions `mapstructure:"events"` } // EventOptions are the configurable options for events @@ -145,8 +152,6 @@ type EventOptions struct { // Manager implements a share manager using a cs3 storage backend with local caching type Manager struct { - sync.RWMutex - Cache providercache.Cache // holds all shares, sharded by provider id and space id CreatedCache sharecache.Cache // holds the list of shares a user has created, sharded by user id GroupReceivedCache sharecache.Cache // holds the list of shares a group has access to, sharded by group id @@ -155,23 +160,25 @@ type Manager struct { storage metadata.Storage SpaceRoot *provider.ResourceId - initialized bool + ready chan struct{} // closed once initialize() has completed successfully + migrationsDone chan struct{} // closed once doMigrations() has returned on this instance MaxConcurrency int gatewaySelector pool.Selectable[gatewayv1beta1.GatewayAPIClient] eventStream events.Stream + logger *zerolog.Logger } // NewDefault returns a new manager instance with default dependencies -func NewDefault(m map[string]interface{}) (share.Manager, error) { +func NewDefault(m map[string]interface{}, logger *zerolog.Logger) (share.Manager, error) { c := &config{} if err := mapstructure.Decode(m, c); err != nil { err = errors.Wrap(err, "error creating a new manager") return nil, err } - s, err := metadata.NewCS3Storage(c.ProviderAddr, c.ProviderAddr, c.ServiceUserID, c.ServiceUserIdp, c.MachineAuthAPIKey) + s, err := metadata.NewCS3Storage(c.ProviderAddr, c.ProviderAddr, c.SystemUserID, c.SystemUserIdp, c.MachineAuthAPIKey) if err != nil { return nil, err } @@ -189,11 +196,34 @@ func NewDefault(m map[string]interface{}) (share.Manager, error) { } } - return New(s, gatewaySelector, c.CacheTTL, es, c.MaxConcurrency) + mgr, err := New(s, logger, gatewaySelector, c.CacheTTL, es, c.MaxConcurrency) + if err != nil { + return nil, err + } + providerRegistryAddr := c.ProviderRegistryAddr + if providerRegistryAddr == "" { + providerRegistryAddr = c.GatewayAddr + } + mgr.RunMigrations(migration.MigrationConfig{ + ServiceAccountID: c.ServiceAccountID, + ServiceAccountSecret: c.ServiceAccountSecret, + ProviderRegistryAddr: providerRegistryAddr, + }) + return mgr, nil } // New returns a new manager instance. -func New(s metadata.Storage, gatewaySelector pool.Selectable[gatewayv1beta1.GatewayAPIClient], ttlSeconds int, es events.Stream, maxconcurrency int) (*Manager, error) { +func New(s metadata.Storage, + logger *zerolog.Logger, + gatewaySelector pool.Selectable[gatewayv1beta1.GatewayAPIClient], + ttlSeconds int, + es events.Stream, + maxconcurrency int, +) (*Manager, error) { + if logger == nil { + nop := zerolog.Nop() + logger = &nop + } ttl := time.Duration(ttlSeconds) * time.Second m := &Manager{ @@ -205,13 +235,38 @@ func New(s metadata.Storage, gatewaySelector pool.Selectable[gatewayv1beta1.Gate gatewaySelector: gatewaySelector, eventStream: es, MaxConcurrency: maxconcurrency, + logger: logger, + ready: make(chan struct{}), + // migrationsDone is open (blocking) by default. It is closed by + // doMigrations when all migrations complete, or by SkipMigrations for + // callers (e.g. tests) that do not run migrations at all. + migrationsDone: make(chan struct{}), } + // Initialize the metadata storage connection in the background, retrying + // with exponential backoff if the backend is not yet available. + go func() { + backoff := time.Second + for { + if err := m.initialize(context.Background()); err != nil { + logger.Info().Err(err).Dur("backoff", backoff).Msg("share manager: metadata storage initialization failed, retrying") + time.Sleep(backoff) + if backoff < 30*time.Second { + backoff *= 2 + } + continue + } + logger.Debug().Msg("share manager: initialization succeeded") + close(m.ready) + return + } + }() + // listen for events if m.eventStream != nil { ch, err := events.Consume(m.eventStream, "jsoncs3sharemanager", _registeredEvents...) if err != nil { - appctx.GetLogger(context.Background()).Error().Err(err).Msg("error consuming events") + logger.Error().Err(err).Msg("error consuming events") } go m.ProcessEvents(ch) } @@ -219,23 +274,13 @@ func New(s metadata.Storage, gatewaySelector pool.Selectable[gatewayv1beta1.Gate return m, nil } +// initialize connects to the metadata storage backend and ensures the required +// directory structure exists. It is called once at startup from a background +// goroutine (see New) and must not be called concurrently. func (m *Manager) initialize(ctx context.Context) error { _, span := appctx.GetTracerProvider(ctx).Tracer(tracerName).Start(ctx, "initialize") defer span.End() - if m.initialized { - span.SetStatus(codes.Ok, "already initialized") - return nil - } - m.Lock() - defer m.Unlock() - - if m.initialized { // check if initialization happened while grabbing the lock - span.SetStatus(codes.Ok, "initialized while grabbing lock") - return nil - } - - ctx = context.Background() err := m.storage.Init(ctx, "jsoncs3-share-manager-metadata") if err != nil { span.RecordError(err) @@ -261,21 +306,85 @@ func (m *Manager) initialize(ctx context.Context) error { span.SetStatus(codes.Error, err.Error()) return err } + err = m.storage.MakeDirIfNotExist(ctx, "migrations") + if err != nil { + span.RecordError(err) + span.SetStatus(codes.Error, err.Error()) + return err + } - m.initialized = true span.SetStatus(codes.Ok, "initialized") return nil } +// waitForInit blocks until the background initialization goroutine has +// successfully completed, or until ctx is cancelled. +func (m *Manager) waitForInit(ctx context.Context) error { + select { + case <-m.ready: + return nil + case <-ctx.Done(): + return errors.Wrap(ctx.Err(), "share manager not yet initialized") + } +} + +// waitForMigrations blocks until both storage initialization and all data +// migrations have completed on this instance, or until ctx is cancelled. +// It is a strict superset of waitForInit and should be used by write operations +// to ensure no writes race with an in-progress migration. +func (m *Manager) waitForMigrations(ctx context.Context) error { + select { + case <-m.ready: + case <-ctx.Done(): + return errors.Wrap(ctx.Err(), "share manager not yet initialized") + } + select { + case <-m.migrationsDone: + return nil + case <-ctx.Done(): + return errors.Wrap(ctx.Err(), "share manager migrations not yet complete") + } +} + +// RunMigrations starts data migrations in a background goroutine. It should be +// called once after New() in production server startup. Callers that do not +// need migrations should call SkipMigrations instead to unblock write operations. +func (m *Manager) RunMigrations(cfg migration.MigrationConfig) { + go m.doMigrations(cfg) +} + +// SkipMigrations unblocks write operations on this instance without running +// any migrations. It must be called when RunMigrations will not be called, +// for example in tests. +func (m *Manager) SkipMigrations() { + close(m.migrationsDone) +} + +func (m *Manager) doMigrations(cfg migration.MigrationConfig) { + // Always close migrationsDone when this goroutine exits, whether migrations + // ran, were skipped, or failed. This unblocks write operations on this + // instance. Non-winning instances are held here by acquireLock until the + // winning instance finishes, so the close happens only after the storage + // state is fully migrated. + defer close(m.migrationsDone) + if err := m.waitForInit(context.Background()); err != nil { + m.logger.Error().Err(err).Msg("share manager: aborting migrations, manager did not initialize") + return + } + m.logger.Debug().Msg("migrations start") + migrations := migration.New(*m.logger, m.gatewaySelector, m.storage, cfg, m, m) + migrations.RunMigrations() +} + func (m *Manager) ProcessEvents(ch <-chan events.Event) { - log := logger.New() + log := m.logger + ctx := context.Background() + if err := m.waitForInit(ctx); err != nil { + log.Error().Err(err).Msg("share manager: error waiting for initialization") + return + } for event := range ch { ctx := context.Background() - - if err := m.initialize(ctx); err != nil { - log.Error().Err(err).Msg("error initializing manager") - } - if ev, ok := event.Event.(events.SpaceDeleted); ok { log.Debug().Msgf("space deleted event: %v", ev) go func() { m.purgeSpace(ctx, ev.ID) }() @@ -287,7 +396,7 @@ func (m *Manager) ProcessEvents(ch <-chan events.Event) { func (m *Manager) Share(ctx context.Context, md *provider.ResourceInfo, g *collaboration.ShareGrant) (*collaboration.Share, error) { ctx, span := appctx.GetTracerProvider(ctx).Tracer(tracerName).Start(ctx, "Share") defer span.End() - if err := m.initialize(ctx); err != nil { + if err := m.waitForMigrations(ctx); err != nil { span.RecordError(err) span.SetStatus(codes.Error, err.Error()) return nil, err @@ -296,16 +405,6 @@ func (m *Manager) Share(ctx context.Context, md *provider.ResourceInfo, g *colla user := ctxpkg.ContextMustGetUser(ctx) ts := utils.TSNow() - // do not allow share to myself or the owner if share is for a user - // TODO: should this not already be caught at the gw level? - if g.Grantee.Type == provider.GranteeType_GRANTEE_TYPE_USER && - (utils.UserEqual(g.Grantee.GetUserId(), user.Id) || utils.UserEqual(g.Grantee.GetUserId(), md.Owner)) { - err := errtypes.BadRequest("jsoncs3: owner/creator and grantee are the same") - span.RecordError(err) - span.SetStatus(codes.Error, err.Error()) - return nil, err - } - // check if share already exists. key := &collaboration.ShareKey{ // Owner: md.Owner, owner no longer matters as it belongs to the space @@ -446,7 +545,7 @@ func (m *Manager) GetShare(ctx context.Context, ref *collaboration.ShareReferenc ctx, span := appctx.GetTracerProvider(ctx).Tracer(tracerName).Start(ctx, "GetShare") defer span.End() sublog := appctx.GetLogger(ctx).With().Str("id", ref.GetId().GetOpaqueId()).Str("key", ref.GetKey().String()).Str("driver", "jsoncs3").Str("handler", "GetShare").Logger() - if err := m.initialize(ctx); err != nil { + if err := m.waitForInit(ctx); err != nil { return nil, err } @@ -504,21 +603,14 @@ func (m *Manager) Unshare(ctx context.Context, ref *collaboration.ShareReference ctx, span := appctx.GetTracerProvider(ctx).Tracer(tracerName).Start(ctx, "Unshare") defer span.End() - if err := m.initialize(ctx); err != nil { + if err := m.waitForMigrations(ctx); err != nil { return err } - user := ctxpkg.ContextMustGetUser(ctx) - s, err := m.get(ctx, ref) if err != nil { return err } - // TODO allow manager to unshare shares in a space created by other users - if !share.IsCreatedByUser(s, user) { - // TODO why not permission denied? - return errtypes.NotFound(ref.String()) - } return m.removeShare(ctx, s, false) } @@ -528,7 +620,7 @@ func (m *Manager) UpdateShare(ctx context.Context, ref *collaboration.ShareRefer ctx, span := appctx.GetTracerProvider(ctx).Tracer(tracerName).Start(ctx, "UpdateShare") defer span.End() - if err := m.initialize(ctx); err != nil { + if err := m.waitForMigrations(ctx); err != nil { return nil, err } @@ -616,7 +708,7 @@ func (m *Manager) ListShares(ctx context.Context, filters []*collaboration.Filte ctx, span := appctx.GetTracerProvider(ctx).Tracer(tracerName).Start(ctx, "ListShares") defer span.End() - if err := m.initialize(ctx); err != nil { + if err := m.waitForInit(ctx); err != nil { return nil, err } @@ -833,7 +925,7 @@ func (m *Manager) ListReceivedShares(ctx context.Context, filters []*collaborati defer span.End() sublog := appctx.GetLogger(ctx).With().Str("driver", "jsoncs3").Str("handler", "ListReceivedShares").Logger() - if err := m.initialize(ctx); err != nil { + if err := m.waitForInit(ctx); err != nil { return nil, err } @@ -1029,7 +1121,7 @@ func (m *Manager) convert(ctx context.Context, userID string, s *collaboration.S // GetReceivedShare returns the information for a received share. func (m *Manager) GetReceivedShare(ctx context.Context, ref *collaboration.ShareReference) (*collaboration.ReceivedShare, error) { - if err := m.initialize(ctx); err != nil { + if err := m.waitForInit(ctx); err != nil { return nil, err } @@ -1073,7 +1165,7 @@ func (m *Manager) UpdateReceivedShare(ctx context.Context, receivedShare *collab ctx, span := appctx.GetTracerProvider(ctx).Tracer(tracerName).Start(ctx, "UpdateReceivedShare") defer span.End() - if err := m.initialize(ctx); err != nil { + if err := m.waitForMigrations(ctx); err != nil { return nil, err } @@ -1120,8 +1212,8 @@ func updateShareID(share *collaboration.Share) { // Load imports shares and received shares from channels (e.g. during migration) func (m *Manager) Load(ctx context.Context, shareChan <-chan *collaboration.Share, receivedShareChan <-chan share.ReceivedShareWithUser) error { - log := appctx.GetLogger(ctx) - if err := m.initialize(ctx); err != nil { + l := m.logger + if err := m.waitForInit(ctx); err != nil { return err } @@ -1136,14 +1228,14 @@ func (m *Manager) Load(ctx context.Context, shareChan <-chan *collaboration.Shar updateShareID(s) } if err := m.Cache.Add(context.Background(), s.GetResourceId().GetStorageId(), s.GetResourceId().GetSpaceId(), s.Id.OpaqueId, s); err != nil { - log.Error().Err(err).Interface("share", s).Msg("error persisting share") + l.Error().Err(err).Interface("share", s).Msg("error persisting share") } else { - log.Debug().Str("storageid", s.GetResourceId().GetStorageId()).Str("spaceid", s.GetResourceId().GetSpaceId()).Str("shareid", s.Id.OpaqueId).Msg("imported share") + l.Debug().Str("storageid", s.GetResourceId().GetStorageId()).Str("spaceid", s.GetResourceId().GetSpaceId()).Str("shareid", s.Id.OpaqueId).Msg("imported share") } if err := m.CreatedCache.Add(ctx, s.GetCreator().GetOpaqueId(), s.Id.OpaqueId); err != nil { - log.Error().Err(err).Interface("share", s).Msg("error persisting created cache") + l.Error().Err(err).Interface("share", s).Msg("error persisting created cache") } else { - log.Debug().Str("creatorid", s.GetCreator().GetOpaqueId()).Str("shareid", s.Id.OpaqueId).Msg("updated created cache") + l.Debug().Str("creatorid", s.GetCreator().GetOpaqueId()).Str("shareid", s.Id.OpaqueId).Msg("updated created cache") } } wg.Done() @@ -1154,18 +1246,19 @@ func (m *Manager) Load(ctx context.Context, shareChan <-chan *collaboration.Shar if !shareIsRoutable(s.ReceivedShare.GetShare()) { updateShareID(s.ReceivedShare.GetShare()) } - switch s.ReceivedShare.Share.Grantee.Type { - case provider.GranteeType_GRANTEE_TYPE_USER: - if err := m.UserReceivedStates.Add(context.Background(), s.ReceivedShare.GetShare().GetGrantee().GetUserId().GetOpaqueId(), s.ReceivedShare.GetShare().GetResourceId().GetSpaceId(), s.ReceivedShare); err != nil { - log.Error().Err(err).Interface("received share", s).Msg("error persisting received share for user") + if s.UserID != nil { + spaceid := s.ReceivedShare.GetShare().GetResourceId().GetStorageId() + shareid.IDDelimiter + s.ReceivedShare.GetShare().GetResourceId().GetSpaceId() + if err := m.UserReceivedStates.Add(context.Background(), s.UserID.GetOpaqueId(), spaceid, s.ReceivedShare); err != nil { + l.Error().Err(err).Interface("received share", s).Msg("error persisting received share for user") } else { - log.Debug().Str("userid", s.ReceivedShare.GetShare().GetGrantee().GetUserId().GetOpaqueId()).Str("spaceid", s.ReceivedShare.GetShare().GetResourceId().GetSpaceId()).Str("shareid", s.ReceivedShare.GetShare().Id.OpaqueId).Msg("updated received share userdata") + l.Debug().Str("userid", s.UserID.GetOpaqueId()).Str("spaceid", spaceid).Str("shareid", s.ReceivedShare.GetShare().Id.OpaqueId).Msg("updated received share userdata") } - case provider.GranteeType_GRANTEE_TYPE_GROUP: + } + if s.ReceivedShare.Share.Grantee.Type == provider.GranteeType_GRANTEE_TYPE_GROUP && s.UserID == nil { if err := m.GroupReceivedCache.Add(context.Background(), s.ReceivedShare.GetShare().GetGrantee().GetGroupId().GetOpaqueId(), s.ReceivedShare.GetShare().GetId().GetOpaqueId()); err != nil { - log.Error().Err(err).Interface("received share", s).Msg("error persisting received share to group cache") + l.Error().Err(err).Interface("received share", s).Msg("error persisting received share to group cache") } else { - log.Debug().Str("groupid", s.ReceivedShare.GetShare().GetGrantee().GetGroupId().GetOpaqueId()).Str("shareid", s.ReceivedShare.GetShare().Id.OpaqueId).Msg("updated received share group cache") + l.Debug().Str("groupid", s.ReceivedShare.GetShare().GetGrantee().GetGroupId().GetOpaqueId()).Str("shareid", s.ReceivedShare.GetShare().Id.OpaqueId).Msg("updated received share group cache") } } } @@ -1237,7 +1330,7 @@ func (m *Manager) removeShare(ctx context.Context, s *collaboration.Share, skipS func (m *Manager) CleanupStaleShares(ctx context.Context) { log := appctx.GetLogger(ctx) - if err := m.initialize(ctx); err != nil { + if err := m.waitForMigrations(ctx); err != nil { return } diff --git a/vendor/github.com/opencloud-eu/reva/v2/pkg/share/manager/jsoncs3/migrations/0001_import_spacemembers.go b/vendor/github.com/opencloud-eu/reva/v2/pkg/share/manager/jsoncs3/migrations/0001_import_spacemembers.go new file mode 100644 index 000000000..8f15a563e --- /dev/null +++ b/vendor/github.com/opencloud-eu/reva/v2/pkg/share/manager/jsoncs3/migrations/0001_import_spacemembers.go @@ -0,0 +1,435 @@ +// Copyright 2026 OpenCloud GmbH +// +// Licensed under the Apache License, Version 2.0 (the "License"); +// you may not use this file except in compliance with the License. +// You may obtain a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, +// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +// See the License for the specific language governing permissions and +// limitations under the License. +// +// In applying this license, CERN does not waive the privileges and immunities +// granted to it by virtue of its status as an Intergovernmental Organization +// or submit itself to any jurisdiction. + +package migration + +import ( + "context" + "encoding/json" + "fmt" + "sync" + "time" + + "github.com/cenkalti/backoff" + grouppb "github.com/cs3org/go-cs3apis/cs3/identity/group/v1beta1" + userpb "github.com/cs3org/go-cs3apis/cs3/identity/user/v1beta1" + rpc "github.com/cs3org/go-cs3apis/cs3/rpc/v1beta1" + collaboration "github.com/cs3org/go-cs3apis/cs3/sharing/collaboration/v1beta1" + provider "github.com/cs3org/go-cs3apis/cs3/storage/provider/v1beta1" + registry "github.com/cs3org/go-cs3apis/cs3/storage/registry/v1beta1" + typesv1beta1 "github.com/cs3org/go-cs3apis/cs3/types/v1beta1" + "github.com/google/uuid" + ctxpkg "github.com/opencloud-eu/reva/v2/pkg/ctx" + "github.com/opencloud-eu/reva/v2/pkg/errtypes" + "github.com/opencloud-eu/reva/v2/pkg/rgrpc/todo/pool" + "github.com/opencloud-eu/reva/v2/pkg/share" + "github.com/opencloud-eu/reva/v2/pkg/share/manager/jsoncs3/shareid" + "github.com/opencloud-eu/reva/v2/pkg/utils" + "github.com/rs/zerolog" + "google.golang.org/grpc" +) + +// storageProvider is the narrow subset of provider.ProviderAPIClient that the +// migration actually uses. Keeping it narrow makes test stubs trivial to write. +type storageProvider interface { + ListGrants(ctx context.Context, in *provider.ListGrantsRequest, opts ...grpc.CallOption) (*provider.ListGrantsResponse, error) +} + +type ImportSpaceMembersMigration struct { + cfg config + sharesChan chan *collaboration.Share + receivedChan chan share.ReceivedShareWithUser + userCache map[string]*userpb.UserId + groupCache map[string]*grouppb.GroupId + providerResolver func(context.Context, *provider.StorageSpace) (storageProvider, error) +} + +func init() { + registerMigration(&ImportSpaceMembersMigration{}) +} + +func (m *ImportSpaceMembersMigration) Initialize(cfg config) { + m.cfg = cfg + m.sharesChan = make(chan *collaboration.Share) + m.receivedChan = make(chan share.ReceivedShareWithUser) + m.userCache = make(map[string]*userpb.UserId) + m.groupCache = make(map[string]*grouppb.GroupId) + m.providerResolver = func(ctx context.Context, space *provider.StorageSpace) (storageProvider, error) { + return m.storageProviderForSpace(ctx, space) + } +} + +func (m *ImportSpaceMembersMigration) Name() string { + return "import_space_members" +} + +func (m *ImportSpaceMembersMigration) Version() int { + return 1 +} + +func (m *ImportSpaceMembersMigration) Migrate() error { + gwc, err := m.cfg.gatewaySelector.Next() + if err != nil { + return err + } + + svcCtx, err := utils.GetServiceUserContextWithContext(context.Background(), gwc, m.cfg.serviceAccountID, m.cfg.serviceAccountSecret) + if err != nil { + m.cfg.logger.Error().Err(err).Msg("failed to get service user context for migration") + return err + } + // List all project spaces. + listRes, err := gwc.ListStorageSpaces(svcCtx, &provider.ListStorageSpacesRequest{ + Opaque: utils.AppendPlainToOpaque(nil, "unrestricted", "true"), + Filters: []*provider.ListStorageSpacesRequest_Filter{ + { + Type: provider.ListStorageSpacesRequest_Filter_TYPE_SPACE_TYPE, + Term: &provider.ListStorageSpacesRequest_Filter_SpaceType{SpaceType: "project"}, + }, + }, + }) + if err != nil { + m.cfg.logger.Error().Err(err).Msg("space-membership migration: failed to list storage spaces") + return err + } + + if listRes.GetStatus().GetCode() != rpc.Code_CODE_OK { + m.cfg.logger.Error().Str("status", listRes.GetStatus().GetMessage()).Msg("space-membership migration: ListStorageSpaces returned non-OK status") + return errtypes.InternalError("ListStorageSpaces") + } + + spaces := listRes.GetStorageSpaces() + m.cfg.logger.Info().Int("spaces", len(spaces)).Msg("Starting migration") + + // loadCtx is cancelled when the producer finishes (or fails) so that the + // Load goroutine — which blocks reading from the channels — is not left + // waiting forever if we return early from an error. + loadCtx, cancelLoad := context.WithCancel(svcCtx) + defer cancelLoad() + + var wg sync.WaitGroup + var loaderError error + wg.Go(func() { + loaderError = m.cfg.loader.Load(loadCtx, m.sharesChan, m.receivedChan) + }) + + migrated := 0 + for _, space := range spaces { + sharesCreated, err := m.migrateSpace(loadCtx, space) + if err != nil { + m.cfg.logger.Error().Err(err).Str("space", space.GetId().GetOpaqueId()).Msg("failed to migrate space; continuing with remaining spaces") + continue + } + migrated++ + m.cfg.logger.Debug(). + Str("space", space.GetId().GetOpaqueId()). + Int("shares_created", sharesCreated). + Msg("space migrated") + if migrated%10 == 0 { + m.cfg.logger.Info(). + Int("migrated", migrated). + Int("total", len(spaces)). + Msg("migration progress") + } + } + close(m.receivedChan) + close(m.sharesChan) + + wg.Wait() + m.cfg.logger.Info().Err(loaderError).Int("migrated", migrated).Int("total", len(spaces)).Msg("Migration finished") + return loaderError +} + +func (m *ImportSpaceMembersMigration) migrateSpace(ctx context.Context, space *provider.StorageSpace) (int, error) { + spClient, err := m.providerResolver(ctx, space) + if err != nil { + return 0, err + } + + ref := &provider.Reference{ResourceId: space.GetRoot()} + grantsRes, err := spClient.ListGrants(ctx, &provider.ListGrantsRequest{Ref: ref}) + if err != nil { + return 0, err + } + if grantsRes.GetStatus().GetCode() != rpc.Code_CODE_OK { + return 0, errtypes.NewErrtypeFromStatus(grantsRes.GetStatus()) + } + + sharesCreated := 0 + for _, grant := range grantsRes.GetGrants() { + share, receivedShares, err := m.spaceGrantToShares(ctx, grant, space) + if err != nil { + m.cfg.logger.Error().Err(err). + Interface("grant", grant). + Msg("Failed to convert grant to shares") + continue + } + if share == nil { + // share already existed; nothing to import for this grant + continue + } + + select { + case m.sharesChan <- share: + case <-ctx.Done(): + return sharesCreated, ctx.Err() + } + for _, rs := range receivedShares { + select { + case m.receivedChan <- rs: + case <-ctx.Done(): + return sharesCreated, ctx.Err() + } + } + sharesCreated++ + } + return sharesCreated, nil +} + +// resolveRetries is the maximum number of times resolveUserID / resolveGroupID +// will retry after receiving an errtypes.Unavailable response (LDAP down). +const resolveRetries = 10 + +// retryOnUnavailable calls op, retrying with exponential backoff whenever op +// returns errtypes.Unavailable. Any other error (including context +// cancellation) stops the loop immediately and is returned as-is. +// Retries are capped at resolveRetries attempts and respect ctx cancellation. +func retryOnUnavailable(ctx context.Context, log zerolog.Logger, op func() error) error { + b := backoff.WithContext( + backoff.WithMaxRetries(backoff.NewExponentialBackOff(), resolveRetries), + ctx, + ) + notify := func(err error, d time.Duration) { + log.Warn().Err(err).Dur("retry_in", d).Msg("identity provider temporarily unavailable, retrying") + } + return backoff.RetryNotify(func() error { + err := op() + if err == nil { + return nil + } + if _, ok := err.(errtypes.Unavailable); ok { + return err // transient — keep retrying + } + return backoff.Permanent(err) // permanent — stop immediately + }, b, notify) +} + +func (m *ImportSpaceMembersMigration) resolveUserID(ctx context.Context, opaqueID string) (*userpb.UserId, error) { + if id, ok := m.userCache[opaqueID]; ok { + return id, nil + } + var id *userpb.UserId + err := retryOnUnavailable(ctx, m.cfg.logger, func() error { + gwc, err := m.cfg.gatewaySelector.Next() + if err != nil { + return err + } + res, err := gwc.GetUser(ctx, &userpb.GetUserRequest{ + UserId: &userpb.UserId{OpaqueId: opaqueID}, + SkipFetchingUserGroups: true, + }) + if err != nil { + return err + } + if res.GetStatus().GetCode() != rpc.Code_CODE_OK { + // errtypes.NewErrtypeFromStatus maps CODE_UNAVAILABLE → errtypes.Unavailable, + // which retryOnUnavailable will retry; all other codes are treated as permanent. + return errtypes.NewErrtypeFromStatus(res.GetStatus()) + } + id = res.GetUser().GetId() + return nil + }) + if err != nil { + return nil, err + } + m.userCache[opaqueID] = id + return id, nil +} + +func (m *ImportSpaceMembersMigration) resolveGroupID(ctx context.Context, opaqueID string) (*grouppb.GroupId, error) { + if id, ok := m.groupCache[opaqueID]; ok { + return id, nil + } + var id *grouppb.GroupId + err := retryOnUnavailable(ctx, m.cfg.logger, func() error { + gwc, err := m.cfg.gatewaySelector.Next() + if err != nil { + return err + } + res, err := gwc.GetGroup(ctx, &grouppb.GetGroupRequest{ + GroupId: &grouppb.GroupId{OpaqueId: opaqueID}, + SkipFetchingMembers: true, + }) + if err != nil { + return err + } + if res.GetStatus().GetCode() != rpc.Code_CODE_OK { + return errtypes.NewErrtypeFromStatus(res.GetStatus()) + } + id = res.GetGroup().GetId() + return nil + }) + if err != nil { + return nil, err + } + m.groupCache[opaqueID] = id + return id, nil +} + +func (m *ImportSpaceMembersMigration) spaceGrantToShares(ctx context.Context, grant *provider.Grant, space *provider.StorageSpace) (*collaboration.Share, []share.ReceivedShareWithUser, error) { + // The grantee ids as persisted on disk do not have an IDP or type stored as + // part of the userid/groupid. Resolve them via the gateway so we get the + // full userid + switch grant.GetGrantee().GetType() { + case provider.GranteeType_GRANTEE_TYPE_GROUP: + groupID, err := m.resolveGroupID(ctx, grant.GetGrantee().GetGroupId().GetOpaqueId()) + if err != nil { + return nil, nil, fmt.Errorf("resolve group %s: %w", grant.GetGrantee().GetGroupId().GetOpaqueId(), err) + } + grant.Grantee.Id = &provider.Grantee_GroupId{GroupId: groupID} + case provider.GranteeType_GRANTEE_TYPE_USER: + userID, err := m.resolveUserID(ctx, grant.GetGrantee().GetUserId().GetOpaqueId()) + if err != nil { + return nil, nil, fmt.Errorf("resolve user %s: %w", grant.GetGrantee().GetUserId().GetOpaqueId(), err) + } + grant.Grantee.Id = &provider.Grantee_UserId{UserId: userID} + } + + ref := &collaboration.ShareReference{ + Spec: &collaboration.ShareReference_Key{ + Key: &collaboration.ShareKey{ + ResourceId: space.GetRoot(), + Grantee: grant.GetGrantee(), + }, + }, + } + + ctx = ctxpkg.ContextSetUser(ctx, &userpb.User{Id: grant.Creator}) + if s, err := m.cfg.manager.GetShare(ctx, ref); err == nil { + // FIXME: Verify the actual grants? + m.cfg.logger.Debug().Interface("share", s).Msg("share already exists") + return nil, nil, nil + } + + ts := utils.TSNow() + shareID := shareid.Encode(space.GetRoot().GetStorageId(), space.GetRoot().GetSpaceId(), uuid.NewString()) + + creator := grant.GetCreator() + if creator.Type == userpb.UserType_USER_TYPE_INVALID { + creator = nil + } + newShare := &collaboration.Share{ + Id: &collaboration.ShareId{OpaqueId: shareID}, + ResourceId: space.GetRoot(), + Permissions: &collaboration.SharePermissions{Permissions: grant.GetPermissions()}, + Grantee: grant.GetGrantee(), + Expiration: grant.GetExpiration(), + Owner: creator, + Creator: creator, + Ctime: ts, + Mtime: ts, + } + + var newReceivedShares []share.ReceivedShareWithUser + switch grant.GetGrantee().GetType() { + case provider.GranteeType_GRANTEE_TYPE_GROUP: + gwc, err := m.cfg.gatewaySelector.Next() + if err != nil { + m.cfg.logger.Error().Err(err).Msg("Failed to get gateway client") + return nil, nil, err + } + + gr, err := gwc.GetMembers(ctx, &grouppb.GetMembersRequest{ + GroupId: grant.GetGrantee().GetGroupId(), + }) + if err != nil { + m.cfg.logger.Error().Err(err).Msg("Failed to expand group membership") + return nil, nil, err + } + if gr.GetStatus().GetCode() != rpc.Code_CODE_OK { + m.cfg.logger.Error().Str("Status", gr.GetStatus().GetMessage()).Msg("Failed to expand group membership") + return nil, nil, errtypes.NewErrtypeFromStatus(gr.GetStatus()) + } + for _, u := range gr.GetMembers() { + newReceivedShares = append(newReceivedShares, share.ReceivedShareWithUser{ + UserID: u, + ReceivedShare: &collaboration.ReceivedShare{ + Share: newShare, + State: collaboration.ShareState_SHARE_STATE_ACCEPTED, + }, + }) + } + // Also add a group-level entry (UserID == nil) so the group cache is populated. + newReceivedShares = append(newReceivedShares, share.ReceivedShareWithUser{ + UserID: nil, + ReceivedShare: &collaboration.ReceivedShare{ + Share: newShare, + State: collaboration.ShareState_SHARE_STATE_ACCEPTED, + }, + }) + case provider.GranteeType_GRANTEE_TYPE_USER: + newReceivedShares = append(newReceivedShares, share.ReceivedShareWithUser{ + UserID: grant.GetGrantee().GetUserId(), + ReceivedShare: &collaboration.ReceivedShare{ + Share: newShare, + State: collaboration.ShareState_SHARE_STATE_ACCEPTED, + }, + }) + } + return newShare, newReceivedShares, nil +} + +// storageProviderForSpace resolves the storageprovider responsible for the +// given storage space and returns a dialled client. In the default opencloud +// deployment the storage registry is co-located with the gateway, so +// the GatewayAddr is used as the registry address. +func (m *ImportSpaceMembersMigration) storageProviderForSpace(ctx context.Context, space *provider.StorageSpace) (provider.ProviderAPIClient, error) { + + srClient, err := pool.GetStorageRegistryClient(m.cfg.providerRegistryAddr) + if err != nil { + return nil, fmt.Errorf("get storage registry client: %w", err) + } + + spaceJSON, err := json.Marshal(space) + if err != nil { + return nil, fmt.Errorf("marshal space: %w", err) + } + + res, err := srClient.GetStorageProviders(ctx, ®istry.GetStorageProvidersRequest{ + Opaque: &typesv1beta1.Opaque{ + Map: map[string]*typesv1beta1.OpaqueEntry{ + "space": { + Decoder: "json", + Value: spaceJSON, + }, + }, + }, + }) + if err != nil { + return nil, fmt.Errorf("GetStorageProviders: %w", err) + } + if len(res.GetProviders()) == 0 { + return nil, fmt.Errorf("no storage provider found for space %s", space.GetId().GetOpaqueId()) + } + + c, err := pool.GetStorageProviderServiceClient(res.GetProviders()[0].GetAddress()) + if err != nil { + return nil, fmt.Errorf("dial storage provider: %w", err) + } + return c, nil +} diff --git a/vendor/github.com/opencloud-eu/reva/v2/pkg/share/manager/jsoncs3/migrations/migration.go b/vendor/github.com/opencloud-eu/reva/v2/pkg/share/manager/jsoncs3/migrations/migration.go new file mode 100644 index 000000000..94fd7af49 --- /dev/null +++ b/vendor/github.com/opencloud-eu/reva/v2/pkg/share/manager/jsoncs3/migrations/migration.go @@ -0,0 +1,353 @@ +// Copyright 2026 OpenCloud GmbH +// +// Licensed under the Apache License, Version 2.0 (the "License"); +// you may not use this file except in compliance with the License. +// You may obtain a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, +// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +// See the License for the specific language governing permissions and +// limitations under the License. +// +// In applying this license, CERN does not waive the privileges and immunities +// granted to it by virtue of its status as an Intergovernmental Organization +// or submit itself to any jurisdiction. + +package migration + +import ( + "cmp" + "context" + "crypto/rand" + "encoding/json" + "fmt" + "os" + "os/signal" + "slices" + "syscall" + "time" + + gatewayv1beta1 "github.com/cs3org/go-cs3apis/cs3/gateway/v1beta1" + "github.com/opencloud-eu/reva/v2/pkg/errtypes" + "github.com/opencloud-eu/reva/v2/pkg/rgrpc/todo/pool" + "github.com/opencloud-eu/reva/v2/pkg/share" + "github.com/opencloud-eu/reva/v2/pkg/storage/utils/metadata" + "github.com/rs/zerolog" +) + +const stateFile = "migrations/state.json" + +const ( + lockFile = "migrations/lock.json" + lockTTL = time.Minute + lockHeartbeatInterval = 20 * time.Second +) + +// lockPollInterval is how long acquireLock sleeps between retries when the +// lock is held by another instance. Declared as a variable so tests can +// shorten it without rebuilding. +var lockPollInterval = 5 * time.Second + +// lockData is the content written to the lock file. +type lockData struct { + Timestamp time.Time `json:"timestamp"` + InstanceID string `json:"instance_id"` +} + +type migration interface { + Name() string + Version() int + Initialize(config) + Migrate() error +} + +// persistedState is the on-disk representation of the migration state. +type persistedState struct { + Version int `json:"version"` +} + +type state struct { + version int +} + +// MigrationConfig holds all caller-supplied options for a migration run. +// It is intentionally a plain struct so that new fields can be added without +// changing function signatures throughout the call chain. +type MigrationConfig struct { + ServiceAccountID string + ServiceAccountSecret string + ProviderRegistryAddr string +} + +type config struct { + logger zerolog.Logger + gatewaySelector pool.Selectable[gatewayv1beta1.GatewayAPIClient] + storage metadata.Storage + serviceAccountID string + serviceAccountSecret string + providerRegistryAddr string + manager share.Manager + loader share.LoadableManager +} + +type Migrations struct { + config + state state + instanceID string +} + +var migrations []migration + +// registerMigration is only supposed to be call from init(), which runs sequentially +// so we don't need ot protect migrations with a lock +func registerMigration(m migration) { + migrations = append(migrations, m) +} + +func New(logger zerolog.Logger, + gatewaySelector pool.Selectable[gatewayv1beta1.GatewayAPIClient], + storage metadata.Storage, + cfg MigrationConfig, + manager share.Manager, + loader share.LoadableManager, +) Migrations { + + slices.SortFunc(migrations, func(a, b migration) int { + return cmp.Compare(a.Version(), b.Version()) + }) + + b := make([]byte, 8) + _, _ = rand.Read(b) + instanceID := fmt.Sprintf("%x", b) + + return Migrations{ + config{ + logger: logger.With().Str("jsoncs3", "migrations").Logger(), + gatewaySelector: gatewaySelector, + storage: storage, + serviceAccountID: cfg.ServiceAccountID, + serviceAccountSecret: cfg.ServiceAccountSecret, + providerRegistryAddr: cfg.ProviderRegistryAddr, + manager: manager, + loader: loader, + }, + state{}, + instanceID, + } +} + +// acquireLock tries to atomically create the lock file, blocking until the lock +// is obtained. It returns the etag of the lock file on success. It retries +// indefinitely until ctx is cancelled. A lock whose timestamp is older than +// lockTTL is considered stale and will be taken over. +func (m *Migrations) acquireLock(ctx context.Context) (string, error) { + m.logger.Debug().Str("instance", m.instanceID).Msg("acquiring migration lock") + for { + // Fast path: create the lock file only if it does not exist yet. + data, err := json.Marshal(lockData{Timestamp: time.Now(), InstanceID: m.instanceID}) + if err != nil { + return "", err + } + res, err := m.storage.Upload(ctx, metadata.UploadRequest{ + Path: lockFile, + Content: data, + IfNoneMatch: []string{"*"}, + }) + if err == nil { + m.logger.Debug().Str("instance", m.instanceID).Msg("migration lock acquired") + return res.Etag, nil + } + + // Propagate context cancellation immediately. + select { + case <-ctx.Done(): + return "", ctx.Err() + default: + } + + // Any error other than a conflict means something unexpected happened. + if !isConflict(err) { + return "", err + } + + // Lock file already exists — read it to decide whether it is stale. + dl, err := m.storage.Download(ctx, metadata.DownloadRequest{Path: lockFile}) + if err != nil { + if _, ok := err.(errtypes.IsNotFound); ok { + // Lock was released between our upload attempt and the download; + // retry acquiring it immediately. + m.logger.Debug().Str("instance", m.instanceID).Msg("migration lock vanished during read; retrying") + continue + } + return "", err + } + + var existing lockData + stale := true + if err := json.Unmarshal(dl.Content, &existing); err == nil { + stale = time.Since(existing.Timestamp) > lockTTL + } + + if stale { + m.logger.Debug(). + Str("instance", m.instanceID). + Str("held_by", existing.InstanceID). + Time("lock_timestamp", existing.Timestamp). + Msg("migration lock is stale; attempting takeover") + + // Atomically take over the stale lock using the etag we just read. + newData, err := json.Marshal(lockData{Timestamp: time.Now(), InstanceID: m.instanceID}) + if err != nil { + return "", err + } + res, err := m.storage.Upload(ctx, metadata.UploadRequest{ + Path: lockFile, + Content: newData, + IfMatchEtag: dl.Etag, + }) + if err == nil { + m.logger.Debug().Str("instance", m.instanceID).Msg("migration lock acquired via stale takeover") + return res.Etag, nil + } + // Another instance took the stale lock before us; loop and retry. + m.logger.Debug().Str("instance", m.instanceID).Err(err).Msg("stale lock takeover lost race; retrying") + continue + } + + m.logger.Debug(). + Str("instance", m.instanceID). + Str("held_by", existing.InstanceID). + Time("lock_timestamp", existing.Timestamp). + Dur("poll_interval", lockPollInterval). + Msg("migration lock held by another instance; waiting") + + // Lock is fresh and held by another instance; wait before retrying. + select { + case <-ctx.Done(): + return "", ctx.Err() + case <-time.After(lockPollInterval): + } + } +} + +// startHeartbeat spawns a goroutine that periodically renews the lock file so +// that it is not considered stale while a long migration is running. Call the +// returned cancel function to stop the heartbeat. +func (m *Migrations) startHeartbeat(ctx context.Context, etag string) context.CancelFunc { + hbCtx, cancel := context.WithCancel(ctx) + go func() { + ticker := time.NewTicker(lockHeartbeatInterval) + defer ticker.Stop() + for { + select { + case <-hbCtx.Done(): + return + case <-ticker.C: + data, err := json.Marshal(lockData{Timestamp: time.Now(), InstanceID: m.instanceID}) + if err != nil { + m.logger.Warn().Err(err).Msg("failed to marshal heartbeat data for migration lock") + return + } + res, err := m.storage.Upload(hbCtx, metadata.UploadRequest{ + Path: lockFile, + Content: data, + IfMatchEtag: etag, + }) + if err != nil { + m.logger.Warn().Err(err).Msg("failed to renew migration lock; another instance may take over") + return + } + etag = res.Etag + } + } + }() + return cancel +} + +// releaseLock deletes the lock file unconditionally. +func (m *Migrations) releaseLock(ctx context.Context) { + if err := m.storage.Delete(ctx, lockFile); err != nil { + m.logger.Warn().Err(err).Msg("failed to release migration lock") + } +} + +// isConflict returns true for errors that signal a conditional-upload conflict, +// i.e. the lock file already exists or the etag did not match. +func isConflict(err error) bool { + switch err.(type) { + case errtypes.IsAlreadyExists, errtypes.IsAborted, errtypes.IsPreconditionFailed: + return true + } + return false +} + +// loadState reads the persisted migration version from storage. If no state +// file exists yet (fresh deployment) it returns version 0 without error. +func (m *Migrations) loadState(ctx context.Context) error { + data, err := m.storage.SimpleDownload(ctx, stateFile) + if err != nil { + if _, ok := err.(errtypes.IsNotFound); ok { + m.state = state{version: 0} + return nil + } + return err + } + var ps persistedState + if err := json.Unmarshal(data, &ps); err != nil { + return err + } + m.state = state{version: ps.Version} + return nil +} + +// saveState writes the current migration version to storage so that already- +// applied migrations are not re-run on the next server start. +func (m *Migrations) saveState(ctx context.Context) error { + data, err := json.Marshal(persistedState{Version: m.state.version}) + if err != nil { + return err + } + return m.storage.SimpleUpload(ctx, stateFile, data) +} + +func (m *Migrations) RunMigrations() { + ctx, stop := signal.NotifyContext(context.Background(), os.Interrupt, syscall.SIGTERM) + defer stop() + + etag, err := m.acquireLock(ctx) + if err != nil { + m.logger.Error().Err(err).Msg("failed to acquire migration lock; skipping migrations") + return + } + cancelHB := m.startHeartbeat(ctx, etag) + defer cancelHB() + defer m.releaseLock(ctx) + + if err := m.loadState(ctx); err != nil { + m.logger.Error().Err(err).Msg("failed to load migration state; skipping migrations") + return + } + + m.logger.Info().Int("current state", m.state.version).Msg("checking migrations") + + for _, mig := range migrations { + if mig.Version() > m.state.version { + m.logger.Info().Str("migration", mig.Name()).Int("version", mig.Version()).Msg("running migration") + mig.Initialize(m.config) + if err := mig.Migrate(); err != nil { + m.logger.Error().Err(err).Str("migration", mig.Name()).Msg("migration failed; stopping") + return + } + m.state.version = mig.Version() + if err := m.saveState(ctx); err != nil { + m.logger.Error().Err(err).Msg("failed to save migration state; stopping") + return + } + } else { + m.logger.Info().Str("migration", mig.Name()).Int("version", mig.Version()).Msg("skipping migration") + } + } +} diff --git a/vendor/github.com/opencloud-eu/reva/v2/pkg/share/manager/memory/memory.go b/vendor/github.com/opencloud-eu/reva/v2/pkg/share/manager/memory/memory.go index 1e7dc7ef2..0f34d3a68 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/pkg/share/manager/memory/memory.go +++ b/vendor/github.com/opencloud-eu/reva/v2/pkg/share/manager/memory/memory.go @@ -28,6 +28,7 @@ import ( ctxpkg "github.com/opencloud-eu/reva/v2/pkg/ctx" "github.com/opencloud-eu/reva/v2/pkg/share" + "github.com/rs/zerolog" "google.golang.org/genproto/protobuf/field_mask" userv1beta1 "github.com/cs3org/go-cs3apis/cs3/identity/user/v1beta1" @@ -46,7 +47,7 @@ func init() { } // New returns a new manager. -func New(c map[string]interface{}) (share.Manager, error) { +func New(c map[string]any, _ *zerolog.Logger) (share.Manager, error) { state := map[string]map[*collaboration.ShareId]collaboration.ShareState{} mp := map[string]map[*collaboration.ShareId]*provider.Reference{} return &manager{ @@ -82,11 +83,6 @@ func (m *manager) Share(ctx context.Context, md *provider.ResourceInfo, g *colla Nanos: uint32(now % 1000000000), } - if g.Grantee.Type == provider.GranteeType_GRANTEE_TYPE_USER && - (utils.UserEqual(g.Grantee.GetUserId(), user.Id) || utils.UserEqual(g.Grantee.GetUserId(), md.Owner)) { - return nil, errtypes.BadRequest("memory: owner/creator and grantee are the same") - } - // check if share already exists. key := &collaboration.ShareKey{ Owner: md.Owner, diff --git a/vendor/github.com/opencloud-eu/reva/v2/pkg/share/manager/registry/registry.go b/vendor/github.com/opencloud-eu/reva/v2/pkg/share/manager/registry/registry.go index 16fc627ff..6b22beb77 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/pkg/share/manager/registry/registry.go +++ b/vendor/github.com/opencloud-eu/reva/v2/pkg/share/manager/registry/registry.go @@ -18,11 +18,14 @@ package registry -import "github.com/opencloud-eu/reva/v2/pkg/share" +import ( + "github.com/opencloud-eu/reva/v2/pkg/share" + "github.com/rs/zerolog" +) // NewFunc is the function that share managers // should register at init time. -type NewFunc func(map[string]interface{}) (share.Manager, error) +type NewFunc func(map[string]any, *zerolog.Logger) (share.Manager, error) // NewFuncs is a map containing all the registered share managers. var NewFuncs = map[string]NewFunc{} diff --git a/vendor/github.com/opencloud-eu/reva/v2/pkg/share/share.go b/vendor/github.com/opencloud-eu/reva/v2/pkg/share/share.go index 57e5c8226..904cd4171 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/pkg/share/share.go +++ b/vendor/github.com/opencloud-eu/reva/v2/pkg/share/share.go @@ -136,6 +136,18 @@ func StateFilter(state collaboration.ShareState) *collaboration.Filter { } } +// SpaceRootFilter is an abstraction for filtering shares by whether the shared +// resource is a space root. Pass true to include only space-root shares (space +// membership), false to exclude them (file/folder shares only). +func SpaceRootFilter(spaceRoot bool) *collaboration.Filter { + return &collaboration.Filter{ + Type: collaboration.Filter_TYPE_SPACE_ROOT, + Term: &collaboration.Filter_SpaceRoot{ + SpaceRoot: spaceRoot, + }, + } +} + // IsCreatedByUser checks if the user is the owner or creator of the share. func IsCreatedByUser(share *collaboration.Share, user *userv1beta1.User) bool { return utils.UserEqual(user.Id, share.Owner) || utils.UserEqual(user.Id, share.Creator) @@ -172,6 +184,9 @@ func MatchesFilter(share *collaboration.Share, state collaboration.ShareState, f return share.ResourceId.SpaceId == filter.GetSpaceId() case collaboration.Filter_TYPE_STATE: return state == filter.GetState() + case collaboration.Filter_TYPE_SPACE_ROOT: + isSpaceRoot := share.ResourceId.SpaceId == share.ResourceId.OpaqueId + return isSpaceRoot == filter.GetSpaceRoot() default: return false } diff --git a/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/pkg/decomposedfs/node/permissions.go b/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/pkg/decomposedfs/node/permissions.go index 6b1beb37d..9fe2a459f 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/pkg/decomposedfs/node/permissions.go +++ b/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/pkg/decomposedfs/node/permissions.go @@ -101,6 +101,7 @@ func ServiceAccountPermissions() *provider.ResourcePermissions { Delete: true, // for cli restore command with replace option CreateContainer: true, // for space provisioning AddGrant: true, // for initial project space member assignment + ListGrants: true, // for initial project space member assignment } } diff --git a/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/utils/metadata/disk.go b/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/utils/metadata/disk.go index 6eae43e63..5caef632d 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/utils/metadata/disk.go +++ b/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/utils/metadata/disk.go @@ -93,6 +93,40 @@ func (disk *Disk) SimpleUpload(ctx context.Context, uploadpath string, content [ // Upload stores a file on disk func (disk *Disk) Upload(_ context.Context, req UploadRequest) (*UploadResponse, error) { p := disk.targetPath(req.Path) + + // IfNoneMatch: ["*"] means create the file only if it does not already + // exist. Use O_EXCL so the check and the create are atomic on the local + // filesystem. + for _, tag := range req.IfNoneMatch { + if tag != "*" { + continue + } + f, err := os.OpenFile(p, os.O_WRONLY|os.O_CREATE|os.O_EXCL, 0644) + if err != nil { + if errors.Is(err, os.ErrExist) { + return nil, errtypes.AlreadyExists(p) + } + return nil, err + } + if _, err := f.Write(req.Content); err != nil { + _ = f.Close() + return nil, err + } + if err := f.Close(); err != nil { + return nil, err + } + info, err := os.Stat(p) + if err != nil { + return nil, err + } + res := &UploadResponse{} + res.Etag, err = calcEtag(info.ModTime(), info.Size()) + if err != nil { + return nil, err + } + return res, nil + } + if req.IfMatchEtag != "" { info, err := os.Stat(p) if err != nil && !errors.Is(err, os.ErrNotExist) { @@ -170,7 +204,10 @@ func (disk *Disk) Download(_ context.Context, req DownloadRequest) (*DownloadRes // SimpleDownload reads a file from disk func (disk *Disk) SimpleDownload(ctx context.Context, downloadpath string) ([]byte, error) { res, err := disk.Download(ctx, DownloadRequest{Path: downloadpath}) - return res.Content, err + if err != nil { + return nil, err + } + return res.Content, nil } // Delete deletes a path diff --git a/vendor/github.com/opencloud-eu/reva/v2/pkg/utils/utils.go b/vendor/github.com/opencloud-eu/reva/v2/pkg/utils/utils.go index c10313687..d2f3e4cd1 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/pkg/utils/utils.go +++ b/vendor/github.com/opencloud-eu/reva/v2/pkg/utils/utils.go @@ -470,6 +470,16 @@ func ExistsInOpaque(o *types.Opaque, key string) bool { return ok } +// SpaceGrantOpaque returns an Opaque with the "spacegrant" key set, which +// signals to storage and event middleware that a grant targets a space root. +func SpaceGrantOpaque() *types.Opaque { + return &types.Opaque{ + Map: map[string]*types.OpaqueEntry{ + "spacegrant": {}, + }, + } +} + // MergeOpaques will merge the opaques. If a key exists in both opaques // the values from the first opaque will be taken func MergeOpaques(o *types.Opaque, p *types.Opaque) *types.Opaque { diff --git a/vendor/github.com/opencloud-eu/reva/v2/tests/cs3mocks/mocks/SpacesAPIClient.go b/vendor/github.com/opencloud-eu/reva/v2/tests/cs3mocks/mocks/SpacesAPIClient.go new file mode 100644 index 000000000..250a04d5e --- /dev/null +++ b/vendor/github.com/opencloud-eu/reva/v2/tests/cs3mocks/mocks/SpacesAPIClient.go @@ -0,0 +1,350 @@ +// Copyright 2018-2022 CERN +// +// Licensed under the Apache License, Version 2.0 (the "License"); +// you may not use this file except in compliance with the License. +// You may obtain a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, +// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +// See the License for the specific language governing permissions and +// limitations under the License. +// +// In applying this license, CERN does not waive the privileges and immunities +// granted to it by virtue of its status as an Intergovernmental Organization +// or submit itself to any jurisdiction. + +// Code generated by mockery v2.53.2. DO NOT EDIT. + +package mocks + +import ( + context "context" + + grpc "google.golang.org/grpc" + + mock "github.com/stretchr/testify/mock" + + providerv1beta1 "github.com/cs3org/go-cs3apis/cs3/storage/provider/v1beta1" +) + +// SpacesAPIClient is an autogenerated mock type for the SpacesAPIClient type +type SpacesAPIClient struct { + mock.Mock +} + +type SpacesAPIClient_Expecter struct { + mock *mock.Mock +} + +func (_m *SpacesAPIClient) EXPECT() *SpacesAPIClient_Expecter { + return &SpacesAPIClient_Expecter{mock: &_m.Mock} +} + +// CreateStorageSpace provides a mock function with given fields: ctx, in, opts +func (_m *SpacesAPIClient) CreateStorageSpace(ctx context.Context, in *providerv1beta1.CreateStorageSpaceRequest, opts ...grpc.CallOption) (*providerv1beta1.CreateStorageSpaceResponse, error) { + var tmpRet mock.Arguments + if len(opts) > 0 { + tmpRet = _m.Called(ctx, in, opts) + } else { + tmpRet = _m.Called(ctx, in) + } + ret := tmpRet + + if len(ret) == 0 { + panic("no return value specified for CreateStorageSpace") + } + + var r0 *providerv1beta1.CreateStorageSpaceResponse + var r1 error + if rf, ok := ret.Get(0).(func(context.Context, *providerv1beta1.CreateStorageSpaceRequest, ...grpc.CallOption) (*providerv1beta1.CreateStorageSpaceResponse, error)); ok { + return rf(ctx, in, opts...) + } + if rf, ok := ret.Get(0).(func(context.Context, *providerv1beta1.CreateStorageSpaceRequest, ...grpc.CallOption) *providerv1beta1.CreateStorageSpaceResponse); ok { + r0 = rf(ctx, in, opts...) + } else { + if ret.Get(0) != nil { + r0 = ret.Get(0).(*providerv1beta1.CreateStorageSpaceResponse) + } + } + + if rf, ok := ret.Get(1).(func(context.Context, *providerv1beta1.CreateStorageSpaceRequest, ...grpc.CallOption) error); ok { + r1 = rf(ctx, in, opts...) + } else { + r1 = ret.Error(1) + } + + return r0, r1 +} + +// SpacesAPIClient_CreateStorageSpace_Call is a *mock.Call that shadows Run/Return methods with type explicit version for method 'CreateStorageSpace' +type SpacesAPIClient_CreateStorageSpace_Call struct { + *mock.Call +} + +// CreateStorageSpace is a helper method to define mock.On call +// - ctx context.Context +// - in *providerv1beta1.CreateStorageSpaceRequest +// - opts ...grpc.CallOption +func (_e *SpacesAPIClient_Expecter) CreateStorageSpace(ctx interface{}, in interface{}, opts ...interface{}) *SpacesAPIClient_CreateStorageSpace_Call { + return &SpacesAPIClient_CreateStorageSpace_Call{Call: _e.mock.On("CreateStorageSpace", + append([]interface{}{ctx, in}, opts...)...)} +} + +func (_c *SpacesAPIClient_CreateStorageSpace_Call) Run(run func(ctx context.Context, in *providerv1beta1.CreateStorageSpaceRequest, opts ...grpc.CallOption)) *SpacesAPIClient_CreateStorageSpace_Call { + _c.Call.Run(func(args mock.Arguments) { + variadicArgs := make([]grpc.CallOption, len(args)-2) + for i, a := range args[2:] { + if a != nil { + variadicArgs[i] = a.(grpc.CallOption) + } + } + run(args[0].(context.Context), args[1].(*providerv1beta1.CreateStorageSpaceRequest), variadicArgs...) + }) + return _c +} + +func (_c *SpacesAPIClient_CreateStorageSpace_Call) Return(_a0 *providerv1beta1.CreateStorageSpaceResponse, _a1 error) *SpacesAPIClient_CreateStorageSpace_Call { + _c.Call.Return(_a0, _a1) + return _c +} + +func (_c *SpacesAPIClient_CreateStorageSpace_Call) RunAndReturn(run func(context.Context, *providerv1beta1.CreateStorageSpaceRequest, ...grpc.CallOption) (*providerv1beta1.CreateStorageSpaceResponse, error)) *SpacesAPIClient_CreateStorageSpace_Call { + _c.Call.Return(run) + return _c +} + +// DeleteStorageSpace provides a mock function with given fields: ctx, in, opts +func (_m *SpacesAPIClient) DeleteStorageSpace(ctx context.Context, in *providerv1beta1.DeleteStorageSpaceRequest, opts ...grpc.CallOption) (*providerv1beta1.DeleteStorageSpaceResponse, error) { + var tmpRet mock.Arguments + if len(opts) > 0 { + tmpRet = _m.Called(ctx, in, opts) + } else { + tmpRet = _m.Called(ctx, in) + } + ret := tmpRet + + if len(ret) == 0 { + panic("no return value specified for DeleteStorageSpace") + } + + var r0 *providerv1beta1.DeleteStorageSpaceResponse + var r1 error + if rf, ok := ret.Get(0).(func(context.Context, *providerv1beta1.DeleteStorageSpaceRequest, ...grpc.CallOption) (*providerv1beta1.DeleteStorageSpaceResponse, error)); ok { + return rf(ctx, in, opts...) + } + if rf, ok := ret.Get(0).(func(context.Context, *providerv1beta1.DeleteStorageSpaceRequest, ...grpc.CallOption) *providerv1beta1.DeleteStorageSpaceResponse); ok { + r0 = rf(ctx, in, opts...) + } else { + if ret.Get(0) != nil { + r0 = ret.Get(0).(*providerv1beta1.DeleteStorageSpaceResponse) + } + } + + if rf, ok := ret.Get(1).(func(context.Context, *providerv1beta1.DeleteStorageSpaceRequest, ...grpc.CallOption) error); ok { + r1 = rf(ctx, in, opts...) + } else { + r1 = ret.Error(1) + } + + return r0, r1 +} + +// SpacesAPIClient_DeleteStorageSpace_Call is a *mock.Call that shadows Run/Return methods with type explicit version for method 'DeleteStorageSpace' +type SpacesAPIClient_DeleteStorageSpace_Call struct { + *mock.Call +} + +// DeleteStorageSpace is a helper method to define mock.On call +// - ctx context.Context +// - in *providerv1beta1.DeleteStorageSpaceRequest +// - opts ...grpc.CallOption +func (_e *SpacesAPIClient_Expecter) DeleteStorageSpace(ctx interface{}, in interface{}, opts ...interface{}) *SpacesAPIClient_DeleteStorageSpace_Call { + return &SpacesAPIClient_DeleteStorageSpace_Call{Call: _e.mock.On("DeleteStorageSpace", + append([]interface{}{ctx, in}, opts...)...)} +} + +func (_c *SpacesAPIClient_DeleteStorageSpace_Call) Run(run func(ctx context.Context, in *providerv1beta1.DeleteStorageSpaceRequest, opts ...grpc.CallOption)) *SpacesAPIClient_DeleteStorageSpace_Call { + _c.Call.Run(func(args mock.Arguments) { + variadicArgs := make([]grpc.CallOption, len(args)-2) + for i, a := range args[2:] { + if a != nil { + variadicArgs[i] = a.(grpc.CallOption) + } + } + run(args[0].(context.Context), args[1].(*providerv1beta1.DeleteStorageSpaceRequest), variadicArgs...) + }) + return _c +} + +func (_c *SpacesAPIClient_DeleteStorageSpace_Call) Return(_a0 *providerv1beta1.DeleteStorageSpaceResponse, _a1 error) *SpacesAPIClient_DeleteStorageSpace_Call { + _c.Call.Return(_a0, _a1) + return _c +} + +func (_c *SpacesAPIClient_DeleteStorageSpace_Call) RunAndReturn(run func(context.Context, *providerv1beta1.DeleteStorageSpaceRequest, ...grpc.CallOption) (*providerv1beta1.DeleteStorageSpaceResponse, error)) *SpacesAPIClient_DeleteStorageSpace_Call { + _c.Call.Return(run) + return _c +} + +// ListStorageSpaces provides a mock function with given fields: ctx, in, opts +func (_m *SpacesAPIClient) ListStorageSpaces(ctx context.Context, in *providerv1beta1.ListStorageSpacesRequest, opts ...grpc.CallOption) (*providerv1beta1.ListStorageSpacesResponse, error) { + var tmpRet mock.Arguments + if len(opts) > 0 { + tmpRet = _m.Called(ctx, in, opts) + } else { + tmpRet = _m.Called(ctx, in) + } + ret := tmpRet + + if len(ret) == 0 { + panic("no return value specified for ListStorageSpaces") + } + + var r0 *providerv1beta1.ListStorageSpacesResponse + var r1 error + if rf, ok := ret.Get(0).(func(context.Context, *providerv1beta1.ListStorageSpacesRequest, ...grpc.CallOption) (*providerv1beta1.ListStorageSpacesResponse, error)); ok { + return rf(ctx, in, opts...) + } + if rf, ok := ret.Get(0).(func(context.Context, *providerv1beta1.ListStorageSpacesRequest, ...grpc.CallOption) *providerv1beta1.ListStorageSpacesResponse); ok { + r0 = rf(ctx, in, opts...) + } else { + if ret.Get(0) != nil { + r0 = ret.Get(0).(*providerv1beta1.ListStorageSpacesResponse) + } + } + + if rf, ok := ret.Get(1).(func(context.Context, *providerv1beta1.ListStorageSpacesRequest, ...grpc.CallOption) error); ok { + r1 = rf(ctx, in, opts...) + } else { + r1 = ret.Error(1) + } + + return r0, r1 +} + +// SpacesAPIClient_ListStorageSpaces_Call is a *mock.Call that shadows Run/Return methods with type explicit version for method 'ListStorageSpaces' +type SpacesAPIClient_ListStorageSpaces_Call struct { + *mock.Call +} + +// ListStorageSpaces is a helper method to define mock.On call +// - ctx context.Context +// - in *providerv1beta1.ListStorageSpacesRequest +// - opts ...grpc.CallOption +func (_e *SpacesAPIClient_Expecter) ListStorageSpaces(ctx interface{}, in interface{}, opts ...interface{}) *SpacesAPIClient_ListStorageSpaces_Call { + return &SpacesAPIClient_ListStorageSpaces_Call{Call: _e.mock.On("ListStorageSpaces", + append([]interface{}{ctx, in}, opts...)...)} +} + +func (_c *SpacesAPIClient_ListStorageSpaces_Call) Run(run func(ctx context.Context, in *providerv1beta1.ListStorageSpacesRequest, opts ...grpc.CallOption)) *SpacesAPIClient_ListStorageSpaces_Call { + _c.Call.Run(func(args mock.Arguments) { + variadicArgs := make([]grpc.CallOption, len(args)-2) + for i, a := range args[2:] { + if a != nil { + variadicArgs[i] = a.(grpc.CallOption) + } + } + run(args[0].(context.Context), args[1].(*providerv1beta1.ListStorageSpacesRequest), variadicArgs...) + }) + return _c +} + +func (_c *SpacesAPIClient_ListStorageSpaces_Call) Return(_a0 *providerv1beta1.ListStorageSpacesResponse, _a1 error) *SpacesAPIClient_ListStorageSpaces_Call { + _c.Call.Return(_a0, _a1) + return _c +} + +func (_c *SpacesAPIClient_ListStorageSpaces_Call) RunAndReturn(run func(context.Context, *providerv1beta1.ListStorageSpacesRequest, ...grpc.CallOption) (*providerv1beta1.ListStorageSpacesResponse, error)) *SpacesAPIClient_ListStorageSpaces_Call { + _c.Call.Return(run) + return _c +} + +// UpdateStorageSpace provides a mock function with given fields: ctx, in, opts +func (_m *SpacesAPIClient) UpdateStorageSpace(ctx context.Context, in *providerv1beta1.UpdateStorageSpaceRequest, opts ...grpc.CallOption) (*providerv1beta1.UpdateStorageSpaceResponse, error) { + var tmpRet mock.Arguments + if len(opts) > 0 { + tmpRet = _m.Called(ctx, in, opts) + } else { + tmpRet = _m.Called(ctx, in) + } + ret := tmpRet + + if len(ret) == 0 { + panic("no return value specified for UpdateStorageSpace") + } + + var r0 *providerv1beta1.UpdateStorageSpaceResponse + var r1 error + if rf, ok := ret.Get(0).(func(context.Context, *providerv1beta1.UpdateStorageSpaceRequest, ...grpc.CallOption) (*providerv1beta1.UpdateStorageSpaceResponse, error)); ok { + return rf(ctx, in, opts...) + } + if rf, ok := ret.Get(0).(func(context.Context, *providerv1beta1.UpdateStorageSpaceRequest, ...grpc.CallOption) *providerv1beta1.UpdateStorageSpaceResponse); ok { + r0 = rf(ctx, in, opts...) + } else { + if ret.Get(0) != nil { + r0 = ret.Get(0).(*providerv1beta1.UpdateStorageSpaceResponse) + } + } + + if rf, ok := ret.Get(1).(func(context.Context, *providerv1beta1.UpdateStorageSpaceRequest, ...grpc.CallOption) error); ok { + r1 = rf(ctx, in, opts...) + } else { + r1 = ret.Error(1) + } + + return r0, r1 +} + +// SpacesAPIClient_UpdateStorageSpace_Call is a *mock.Call that shadows Run/Return methods with type explicit version for method 'UpdateStorageSpace' +type SpacesAPIClient_UpdateStorageSpace_Call struct { + *mock.Call +} + +// UpdateStorageSpace is a helper method to define mock.On call +// - ctx context.Context +// - in *providerv1beta1.UpdateStorageSpaceRequest +// - opts ...grpc.CallOption +func (_e *SpacesAPIClient_Expecter) UpdateStorageSpace(ctx interface{}, in interface{}, opts ...interface{}) *SpacesAPIClient_UpdateStorageSpace_Call { + return &SpacesAPIClient_UpdateStorageSpace_Call{Call: _e.mock.On("UpdateStorageSpace", + append([]interface{}{ctx, in}, opts...)...)} +} + +func (_c *SpacesAPIClient_UpdateStorageSpace_Call) Run(run func(ctx context.Context, in *providerv1beta1.UpdateStorageSpaceRequest, opts ...grpc.CallOption)) *SpacesAPIClient_UpdateStorageSpace_Call { + _c.Call.Run(func(args mock.Arguments) { + variadicArgs := make([]grpc.CallOption, len(args)-2) + for i, a := range args[2:] { + if a != nil { + variadicArgs[i] = a.(grpc.CallOption) + } + } + run(args[0].(context.Context), args[1].(*providerv1beta1.UpdateStorageSpaceRequest), variadicArgs...) + }) + return _c +} + +func (_c *SpacesAPIClient_UpdateStorageSpace_Call) Return(_a0 *providerv1beta1.UpdateStorageSpaceResponse, _a1 error) *SpacesAPIClient_UpdateStorageSpace_Call { + _c.Call.Return(_a0, _a1) + return _c +} + +func (_c *SpacesAPIClient_UpdateStorageSpace_Call) RunAndReturn(run func(context.Context, *providerv1beta1.UpdateStorageSpaceRequest, ...grpc.CallOption) (*providerv1beta1.UpdateStorageSpaceResponse, error)) *SpacesAPIClient_UpdateStorageSpace_Call { + _c.Call.Return(run) + return _c +} + +// NewSpacesAPIClient creates a new instance of SpacesAPIClient. It also registers a testing interface on the mock and a cleanup function to assert the mocks expectations. +// The first argument is typically a *testing.T value. +func NewSpacesAPIClient(t interface { + mock.TestingT + Cleanup(func()) +}) *SpacesAPIClient { + mock := &SpacesAPIClient{} + mock.Mock.Test(t) + + t.Cleanup(func() { mock.AssertExpectations(t) }) + + return mock +} diff --git a/vendor/github.com/opencloud-eu/reva/v2/tests/cs3mocks/mocks/StorageRegistryAPIClient.go b/vendor/github.com/opencloud-eu/reva/v2/tests/cs3mocks/mocks/StorageRegistryAPIClient.go new file mode 100644 index 000000000..4c1784137 --- /dev/null +++ b/vendor/github.com/opencloud-eu/reva/v2/tests/cs3mocks/mocks/StorageRegistryAPIClient.go @@ -0,0 +1,277 @@ +// Copyright 2018-2022 CERN +// +// Licensed under the Apache License, Version 2.0 (the "License"); +// you may not use this file except in compliance with the License. +// You may obtain a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, +// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +// See the License for the specific language governing permissions and +// limitations under the License. +// +// In applying this license, CERN does not waive the privileges and immunities +// granted to it by virtue of its status as an Intergovernmental Organization +// or submit itself to any jurisdiction. + +// Code generated by mockery v2.53.2. DO NOT EDIT. + +package mocks + +import ( + context "context" + + grpc "google.golang.org/grpc" + + mock "github.com/stretchr/testify/mock" + + registryv1beta1 "github.com/cs3org/go-cs3apis/cs3/storage/registry/v1beta1" +) + +// StorageRegistryAPIClient is an autogenerated mock type for the StorageRegistryAPIClient type +type StorageRegistryAPIClient struct { + mock.Mock +} + +type StorageRegistryAPIClient_Expecter struct { + mock *mock.Mock +} + +func (_m *StorageRegistryAPIClient) EXPECT() *StorageRegistryAPIClient_Expecter { + return &StorageRegistryAPIClient_Expecter{mock: &_m.Mock} +} + +// GetHome provides a mock function with given fields: ctx, in, opts +func (_m *StorageRegistryAPIClient) GetHome(ctx context.Context, in *registryv1beta1.GetHomeRequest, opts ...grpc.CallOption) (*registryv1beta1.GetHomeResponse, error) { + var tmpRet mock.Arguments + if len(opts) > 0 { + tmpRet = _m.Called(ctx, in, opts) + } else { + tmpRet = _m.Called(ctx, in) + } + ret := tmpRet + + if len(ret) == 0 { + panic("no return value specified for GetHome") + } + + var r0 *registryv1beta1.GetHomeResponse + var r1 error + if rf, ok := ret.Get(0).(func(context.Context, *registryv1beta1.GetHomeRequest, ...grpc.CallOption) (*registryv1beta1.GetHomeResponse, error)); ok { + return rf(ctx, in, opts...) + } + if rf, ok := ret.Get(0).(func(context.Context, *registryv1beta1.GetHomeRequest, ...grpc.CallOption) *registryv1beta1.GetHomeResponse); ok { + r0 = rf(ctx, in, opts...) + } else { + if ret.Get(0) != nil { + r0 = ret.Get(0).(*registryv1beta1.GetHomeResponse) + } + } + + if rf, ok := ret.Get(1).(func(context.Context, *registryv1beta1.GetHomeRequest, ...grpc.CallOption) error); ok { + r1 = rf(ctx, in, opts...) + } else { + r1 = ret.Error(1) + } + + return r0, r1 +} + +// StorageRegistryAPIClient_GetHome_Call is a *mock.Call that shadows Run/Return methods with type explicit version for method 'GetHome' +type StorageRegistryAPIClient_GetHome_Call struct { + *mock.Call +} + +// GetHome is a helper method to define mock.On call +// - ctx context.Context +// - in *registryv1beta1.GetHomeRequest +// - opts ...grpc.CallOption +func (_e *StorageRegistryAPIClient_Expecter) GetHome(ctx interface{}, in interface{}, opts ...interface{}) *StorageRegistryAPIClient_GetHome_Call { + return &StorageRegistryAPIClient_GetHome_Call{Call: _e.mock.On("GetHome", + append([]interface{}{ctx, in}, opts...)...)} +} + +func (_c *StorageRegistryAPIClient_GetHome_Call) Run(run func(ctx context.Context, in *registryv1beta1.GetHomeRequest, opts ...grpc.CallOption)) *StorageRegistryAPIClient_GetHome_Call { + _c.Call.Run(func(args mock.Arguments) { + variadicArgs := make([]grpc.CallOption, len(args)-2) + for i, a := range args[2:] { + if a != nil { + variadicArgs[i] = a.(grpc.CallOption) + } + } + run(args[0].(context.Context), args[1].(*registryv1beta1.GetHomeRequest), variadicArgs...) + }) + return _c +} + +func (_c *StorageRegistryAPIClient_GetHome_Call) Return(_a0 *registryv1beta1.GetHomeResponse, _a1 error) *StorageRegistryAPIClient_GetHome_Call { + _c.Call.Return(_a0, _a1) + return _c +} + +func (_c *StorageRegistryAPIClient_GetHome_Call) RunAndReturn(run func(context.Context, *registryv1beta1.GetHomeRequest, ...grpc.CallOption) (*registryv1beta1.GetHomeResponse, error)) *StorageRegistryAPIClient_GetHome_Call { + _c.Call.Return(run) + return _c +} + +// GetStorageProviders provides a mock function with given fields: ctx, in, opts +func (_m *StorageRegistryAPIClient) GetStorageProviders(ctx context.Context, in *registryv1beta1.GetStorageProvidersRequest, opts ...grpc.CallOption) (*registryv1beta1.GetStorageProvidersResponse, error) { + var tmpRet mock.Arguments + if len(opts) > 0 { + tmpRet = _m.Called(ctx, in, opts) + } else { + tmpRet = _m.Called(ctx, in) + } + ret := tmpRet + + if len(ret) == 0 { + panic("no return value specified for GetStorageProviders") + } + + var r0 *registryv1beta1.GetStorageProvidersResponse + var r1 error + if rf, ok := ret.Get(0).(func(context.Context, *registryv1beta1.GetStorageProvidersRequest, ...grpc.CallOption) (*registryv1beta1.GetStorageProvidersResponse, error)); ok { + return rf(ctx, in, opts...) + } + if rf, ok := ret.Get(0).(func(context.Context, *registryv1beta1.GetStorageProvidersRequest, ...grpc.CallOption) *registryv1beta1.GetStorageProvidersResponse); ok { + r0 = rf(ctx, in, opts...) + } else { + if ret.Get(0) != nil { + r0 = ret.Get(0).(*registryv1beta1.GetStorageProvidersResponse) + } + } + + if rf, ok := ret.Get(1).(func(context.Context, *registryv1beta1.GetStorageProvidersRequest, ...grpc.CallOption) error); ok { + r1 = rf(ctx, in, opts...) + } else { + r1 = ret.Error(1) + } + + return r0, r1 +} + +// StorageRegistryAPIClient_GetStorageProviders_Call is a *mock.Call that shadows Run/Return methods with type explicit version for method 'GetStorageProviders' +type StorageRegistryAPIClient_GetStorageProviders_Call struct { + *mock.Call +} + +// GetStorageProviders is a helper method to define mock.On call +// - ctx context.Context +// - in *registryv1beta1.GetStorageProvidersRequest +// - opts ...grpc.CallOption +func (_e *StorageRegistryAPIClient_Expecter) GetStorageProviders(ctx interface{}, in interface{}, opts ...interface{}) *StorageRegistryAPIClient_GetStorageProviders_Call { + return &StorageRegistryAPIClient_GetStorageProviders_Call{Call: _e.mock.On("GetStorageProviders", + append([]interface{}{ctx, in}, opts...)...)} +} + +func (_c *StorageRegistryAPIClient_GetStorageProviders_Call) Run(run func(ctx context.Context, in *registryv1beta1.GetStorageProvidersRequest, opts ...grpc.CallOption)) *StorageRegistryAPIClient_GetStorageProviders_Call { + _c.Call.Run(func(args mock.Arguments) { + variadicArgs := make([]grpc.CallOption, len(args)-2) + for i, a := range args[2:] { + if a != nil { + variadicArgs[i] = a.(grpc.CallOption) + } + } + run(args[0].(context.Context), args[1].(*registryv1beta1.GetStorageProvidersRequest), variadicArgs...) + }) + return _c +} + +func (_c *StorageRegistryAPIClient_GetStorageProviders_Call) Return(_a0 *registryv1beta1.GetStorageProvidersResponse, _a1 error) *StorageRegistryAPIClient_GetStorageProviders_Call { + _c.Call.Return(_a0, _a1) + return _c +} + +func (_c *StorageRegistryAPIClient_GetStorageProviders_Call) RunAndReturn(run func(context.Context, *registryv1beta1.GetStorageProvidersRequest, ...grpc.CallOption) (*registryv1beta1.GetStorageProvidersResponse, error)) *StorageRegistryAPIClient_GetStorageProviders_Call { + _c.Call.Return(run) + return _c +} + +// ListStorageProviders provides a mock function with given fields: ctx, in, opts +func (_m *StorageRegistryAPIClient) ListStorageProviders(ctx context.Context, in *registryv1beta1.ListStorageProvidersRequest, opts ...grpc.CallOption) (*registryv1beta1.ListStorageProvidersResponse, error) { + var tmpRet mock.Arguments + if len(opts) > 0 { + tmpRet = _m.Called(ctx, in, opts) + } else { + tmpRet = _m.Called(ctx, in) + } + ret := tmpRet + + if len(ret) == 0 { + panic("no return value specified for ListStorageProviders") + } + + var r0 *registryv1beta1.ListStorageProvidersResponse + var r1 error + if rf, ok := ret.Get(0).(func(context.Context, *registryv1beta1.ListStorageProvidersRequest, ...grpc.CallOption) (*registryv1beta1.ListStorageProvidersResponse, error)); ok { + return rf(ctx, in, opts...) + } + if rf, ok := ret.Get(0).(func(context.Context, *registryv1beta1.ListStorageProvidersRequest, ...grpc.CallOption) *registryv1beta1.ListStorageProvidersResponse); ok { + r0 = rf(ctx, in, opts...) + } else { + if ret.Get(0) != nil { + r0 = ret.Get(0).(*registryv1beta1.ListStorageProvidersResponse) + } + } + + if rf, ok := ret.Get(1).(func(context.Context, *registryv1beta1.ListStorageProvidersRequest, ...grpc.CallOption) error); ok { + r1 = rf(ctx, in, opts...) + } else { + r1 = ret.Error(1) + } + + return r0, r1 +} + +// StorageRegistryAPIClient_ListStorageProviders_Call is a *mock.Call that shadows Run/Return methods with type explicit version for method 'ListStorageProviders' +type StorageRegistryAPIClient_ListStorageProviders_Call struct { + *mock.Call +} + +// ListStorageProviders is a helper method to define mock.On call +// - ctx context.Context +// - in *registryv1beta1.ListStorageProvidersRequest +// - opts ...grpc.CallOption +func (_e *StorageRegistryAPIClient_Expecter) ListStorageProviders(ctx interface{}, in interface{}, opts ...interface{}) *StorageRegistryAPIClient_ListStorageProviders_Call { + return &StorageRegistryAPIClient_ListStorageProviders_Call{Call: _e.mock.On("ListStorageProviders", + append([]interface{}{ctx, in}, opts...)...)} +} + +func (_c *StorageRegistryAPIClient_ListStorageProviders_Call) Run(run func(ctx context.Context, in *registryv1beta1.ListStorageProvidersRequest, opts ...grpc.CallOption)) *StorageRegistryAPIClient_ListStorageProviders_Call { + _c.Call.Run(func(args mock.Arguments) { + variadicArgs := make([]grpc.CallOption, len(args)-2) + for i, a := range args[2:] { + if a != nil { + variadicArgs[i] = a.(grpc.CallOption) + } + } + run(args[0].(context.Context), args[1].(*registryv1beta1.ListStorageProvidersRequest), variadicArgs...) + }) + return _c +} + +func (_c *StorageRegistryAPIClient_ListStorageProviders_Call) Return(_a0 *registryv1beta1.ListStorageProvidersResponse, _a1 error) *StorageRegistryAPIClient_ListStorageProviders_Call { + _c.Call.Return(_a0, _a1) + return _c +} + +func (_c *StorageRegistryAPIClient_ListStorageProviders_Call) RunAndReturn(run func(context.Context, *registryv1beta1.ListStorageProvidersRequest, ...grpc.CallOption) (*registryv1beta1.ListStorageProvidersResponse, error)) *StorageRegistryAPIClient_ListStorageProviders_Call { + _c.Call.Return(run) + return _c +} + +// NewStorageRegistryAPIClient creates a new instance of StorageRegistryAPIClient. It also registers a testing interface on the mock and a cleanup function to assert the mocks expectations. +// The first argument is typically a *testing.T value. +func NewStorageRegistryAPIClient(t interface { + mock.TestingT + Cleanup(func()) +}) *StorageRegistryAPIClient { + mock := &StorageRegistryAPIClient{} + mock.Mock.Test(t) + + t.Cleanup(func() { mock.AssertExpectations(t) }) + + return mock +} diff --git a/vendor/github.com/pjbgf/sha1cd/Dockerfile.arm b/vendor/github.com/pjbgf/sha1cd/Dockerfile.arm index 4230fba01..1fe43ec4a 100644 --- a/vendor/github.com/pjbgf/sha1cd/Dockerfile.arm +++ b/vendor/github.com/pjbgf/sha1cd/Dockerfile.arm @@ -1,4 +1,4 @@ -FROM golang:1.23@sha256:51a6466e8dbf3e00e422eb0f7a97ac450b2d57b33617bbe8d2ee0bddcd9d0d37 +FROM golang:1.25@sha256:31c1e53dfc1cc2d269deec9c83f58729fa3c53dc9a576f6426109d1e319e9e9a ENV GOOS=linux ENV GOARCH=arm diff --git a/vendor/github.com/pjbgf/sha1cd/Dockerfile.arm64 b/vendor/github.com/pjbgf/sha1cd/Dockerfile.arm64 index 59928252a..af7f2e21b 100644 --- a/vendor/github.com/pjbgf/sha1cd/Dockerfile.arm64 +++ b/vendor/github.com/pjbgf/sha1cd/Dockerfile.arm64 @@ -1,4 +1,4 @@ -FROM golang:1.23@sha256:51a6466e8dbf3e00e422eb0f7a97ac450b2d57b33617bbe8d2ee0bddcd9d0d37 +FROM golang:1.25@sha256:31c1e53dfc1cc2d269deec9c83f58729fa3c53dc9a576f6426109d1e319e9e9a ENV GOOS=linux ENV GOARCH=arm64 diff --git a/vendor/github.com/pjbgf/sha1cd/Makefile b/vendor/github.com/pjbgf/sha1cd/Makefile index 278a109d8..e746d62a1 100644 --- a/vendor/github.com/pjbgf/sha1cd/Makefile +++ b/vendor/github.com/pjbgf/sha1cd/Makefile @@ -4,7 +4,7 @@ export CGO_ENABLED := 1 .PHONY: test test: - go test ./... + go test -race -timeout 15s ./... .PHONY: bench bench: @@ -31,9 +31,6 @@ build-nocgo: # Run cross-compilation to assure supported architectures. cross-build: build-arm build-arm64 build-nocgo -generate: - go generate -x ./... - -verify: generate +verify: git diff --exit-code go vet ./... diff --git a/vendor/github.com/pjbgf/sha1cd/README.md b/vendor/github.com/pjbgf/sha1cd/README.md index 378cf78cf..f3ae73290 100644 --- a/vendor/github.com/pjbgf/sha1cd/README.md +++ b/vendor/github.com/pjbgf/sha1cd/README.md @@ -6,8 +6,7 @@ collision attacks. The `cgo/lib` code is a carbon copy of the [original code], based on the award winning [white paper] by Marc Stevens. -The Go implementation is largely based off Go's generic sha1. -At present no SIMD optimisations have been implemented. +The Go and native implementations are largely based off upstream Go. ## Usage diff --git a/vendor/github.com/pjbgf/sha1cd/sha1cd.go b/vendor/github.com/pjbgf/sha1cd/sha1cd.go index 509569f66..865a995ca 100644 --- a/vendor/github.com/pjbgf/sha1cd/sha1cd.go +++ b/vendor/github.com/pjbgf/sha1cd/sha1cd.go @@ -12,7 +12,6 @@ package sha1cd // Original: https://github.com/golang/go/blob/master/src/crypto/sha1/sha1.go import ( - "crypto" "encoding/binary" "errors" "hash" @@ -20,12 +19,6 @@ import ( shared "github.com/pjbgf/sha1cd/internal" ) -//go:generate go run -C asm . -out ../sha1cdblock_amd64.s -pkg $GOPACKAGE - -func init() { - crypto.RegisterHash(crypto.SHA1, New) -} - // The size of a SHA-1 checksum in bytes. const Size = shared.Size @@ -40,8 +33,7 @@ type digest struct { len uint64 // col defines whether a collision has been found. - col bool - blockFunc func(dig *digest, p []byte) + col bool } func (d *digest) MarshalBinary() ([]byte, error) { @@ -101,7 +93,7 @@ func (d *digest) UnmarshalBinary(b []byte) error { func consumeUint64(b []byte) ([]byte, uint64) { _ = b[7] - x := uint64(b[7]) | uint64(b[6])<<8 | uint64(b[shared.WordBuffers])<<16 | uint64(b[4])<<24 | + x := uint64(b[7]) | uint64(b[6])<<8 | uint64(b[5])<<16 | uint64(b[4])<<24 | uint64(b[3])<<32 | uint64(b[2])<<40 | uint64(b[1])<<48 | uint64(b[0])<<56 return b[8:], x } @@ -128,21 +120,9 @@ func (d *digest) Reset() { // implements encoding.BinaryMarshaler and encoding.BinaryUnmarshaler to // marshal and unmarshal the internal state of the hash. func New() hash.Hash { - d := new(digest) - - d.blockFunc = block + var d digest d.Reset() - return d -} - -// NewGeneric is equivalent to New but uses the Go generic implementation, -// avoiding any processor-specific optimizations. -func NewGeneric() hash.Hash { - d := new(digest) - - d.blockFunc = blockGeneric - d.Reset() - return d + return &d } func (d *digest) Size() int { return Size } @@ -160,14 +140,14 @@ func (d *digest) Write(p []byte) (nn int, err error) { n := copy(d.x[d.nx:], p) d.nx += n if d.nx == shared.Chunk { - d.blockFunc(d, d.x[:]) + block(d, d.x[:]) d.nx = 0 } p = p[n:] } if len(p) >= shared.Chunk { n := len(p) &^ (shared.Chunk - 1) - d.blockFunc(d, p[:n]) + block(d, p[:n]) p = p[n:] } if len(p) > 0 { @@ -186,18 +166,20 @@ func (d *digest) Sum(in []byte) []byte { func (d *digest) checkSum() [Size]byte { len := d.len // Padding. Add a 1 bit and 0 bits until 56 bytes mod 64. - var tmp [64]byte + var tmp [64 + 8]byte tmp[0] = 0x80 + var t uint64 if len%64 < 56 { - d.Write(tmp[0 : 56-len%64]) + t = 56 - len%64 } else { - d.Write(tmp[0 : 64+56-len%64]) + t = 64 + 56 - len%64 } // Length in bits. len <<= 3 - binary.BigEndian.PutUint64(tmp[:], len) - d.Write(tmp[0:8]) + padlen := tmp[:t+8] + binary.BigEndian.PutUint64(tmp[t:], len) + d.Write(padlen) if d.nx != 0 { panic("d.nx != 0") @@ -216,7 +198,8 @@ func (d *digest) checkSum() [Size]byte { // Sum returns the SHA-1 checksum of the data. func Sum(data []byte) ([Size]byte, bool) { - d := New().(*digest) + var d digest + d.Reset() d.Write(data) return d.checkSum(), d.col } diff --git a/vendor/github.com/pjbgf/sha1cd/sha1cdblock_amd64.go b/vendor/github.com/pjbgf/sha1cd/sha1cdblock_amd64.go index 95e083084..6b716abd6 100644 --- a/vendor/github.com/pjbgf/sha1cd/sha1cdblock_amd64.go +++ b/vendor/github.com/pjbgf/sha1cd/sha1cdblock_amd64.go @@ -1,48 +1,50 @@ -//go:build !noasm && gc && amd64 -// +build !noasm,gc,amd64 +//go:build !noasm && gc && amd64 && !arm64 +// +build !noasm,gc,amd64,!arm64 package sha1cd import ( - "math" - "unsafe" + "runtime" + "github.com/klauspost/cpuid/v2" shared "github.com/pjbgf/sha1cd/internal" ) -type sliceHeader struct { - base uintptr - len int - cap int -} +var hasSHANI = (runtime.GOARCH == "amd64" && + cpuid.CPU.Supports(cpuid.AVX) && + cpuid.CPU.Supports(cpuid.SHA) && + cpuid.CPU.Supports(cpuid.SSE3) && + cpuid.CPU.Supports(cpuid.SSE4)) -// blockAMD64 hashes the message p into the current state in dig. +// blockAMD64 hashes the message p into the current state in h. // Both m1 and cs are used to store intermediate results which are used by the collision detection logic. // //go:noescape -func blockAMD64(dig *digest, p sliceHeader, m1 []uint32, cs [][5]uint32) +func blockAMD64(h []uint32, p []byte, m1 []uint32, cs [][5]uint32) func block(dig *digest, p []byte) { + if forceGeneric || !hasSHANI { + blockGeneric(dig, p) + return + } + m1 := [shared.Rounds]uint32{} cs := [shared.PreStepState][shared.WordBuffers]uint32{} for len(p) >= shared.Chunk { - // Only send a block to be processed, as the collission detection - // works on a block by block basis. - ips := sliceHeader{ - base: uintptr(unsafe.Pointer(&p[0])), - len: int(math.Min(float64(len(p)), float64(shared.Chunk))), - cap: shared.Chunk, - } + // The assembly code only supports processing a block at a time, + // so adjust the chunk accordingly. + chunk := p[:shared.Chunk] - blockAMD64(dig, ips, m1[:], cs[:]) + blockAMD64(dig.h[:], chunk, m1[:], cs[:]) + rectifyCompressionState(&m1, &cs) - col := checkCollision(m1, cs, dig.h) + col := checkCollision(&m1, &cs, &dig.h) if col { dig.col = true - blockAMD64(dig, ips, m1[:], cs[:]) - blockAMD64(dig, ips, m1[:], cs[:]) + blockAMD64(dig.h[:], chunk, m1[:], cs[:]) + blockAMD64(dig.h[:], chunk, m1[:], cs[:]) } p = p[shared.Chunk:] diff --git a/vendor/github.com/pjbgf/sha1cd/sha1cdblock_amd64.s b/vendor/github.com/pjbgf/sha1cd/sha1cdblock_amd64.s index e5e213a52..061906a95 100644 --- a/vendor/github.com/pjbgf/sha1cd/sha1cdblock_amd64.s +++ b/vendor/github.com/pjbgf/sha1cd/sha1cdblock_amd64.s @@ -1,2273 +1,274 @@ -// Code generated by command: go run asm.go -out ../sha1cdblock_amd64.s -pkg sha1cd. DO NOT EDIT. - -//go:build !noasm && gc && amd64 +//go:build !noasm && gc && amd64 && !arm64 #include "textflag.h" -// func blockAMD64(dig *digest, p []byte, m1 []uint32, cs [][5]uint32) -TEXT ·blockAMD64(SB), NOSPLIT, $64-80 - MOVQ dig+0(FP), R8 - MOVQ p_base+8(FP), DI - MOVQ p_len+16(FP), DX - SHRQ $+6, DX - SHLQ $+6, DX - LEAQ (DI)(DX*1), SI +// License information for the original SHA1 arm64 implemention: +// Copyright 2024 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found at: +// - https://github.com/golang/go/blob/master/LICENSE +// +// Reference implementations: +// - https://github.com/golang/go/blob/master/src/crypto/sha1/sha1block_amd64.s - // Load h0, h1, h2, h3, h4. - MOVL (R8), AX - MOVL 4(R8), BX - MOVL 8(R8), CX - MOVL 12(R8), DX - MOVL 16(R8), BP +// Reverse the dword order in abcd via PSHUFD then store the 16 bytes in one +// move, instead of issuing four VPEXTRD's that each go through the store port. +#define LOADCS(abcd, e, index, target) \ + VPSHUFD $0x1B, abcd, X8; \ + VMOVDQU X8, ((index*20)+0)(target); \ + MOVL e, ((index*20)+16)(target); - // len(p) >= chunk - CMPQ DI, SI - JEQ end +#define LOADM1(m1, index, target) \ + VPSHUFD $0x1B, m1, X8; \ + VMOVDQU X8, ((index*16)+0)(target); + +// func blockAMD64(h []uint32, p []byte, m1 []uint32, cs [][5]uint32) +// Requires: AVX, SHA, SSE2, SSE4.1, SSSE3 +TEXT ·blockAMD64(SB), NOSPLIT, $80-96 + MOVQ h_base+0(FP), DI + MOVQ p_base+24(FP), SI + MOVQ p_len+32(FP), DX + MOVQ m1_base+48(FP), R13 + MOVQ cs_base+72(FP), R15 + CMPQ DX, $0x00 + JEQ done + ADDQ SI, DX + + // Allocate space on the stack for saving ABCD and E0, and align it to 16 bytes + LEAQ 15(SP), AX + MOVQ $0x000000000000000f, CX + NOTQ CX + ANDQ CX, AX + + // Load initial hash state + PINSRD $0x03, 16(DI), X5 + VMOVDQU (DI), X0 + PAND upper_mask<>+0(SB), X5 + PSHUFD $0x1b, X0, X0 + VMOVDQA shuffle_mask<>+0(SB), X7 loop: - // Initialize registers a, b, c, d, e. - MOVL AX, R10 - MOVL BX, R11 - MOVL CX, R12 - MOVL DX, R13 - MOVL BP, R14 - - // ROUND1 (steps 0-15) - // Load cs - MOVQ cs_base+56(FP), R8 - MOVL R10, (R8) - MOVL R11, 4(R8) - MOVL R12, 8(R8) - MOVL R13, 12(R8) - MOVL R14, 16(R8) - - // ROUND1(0) - // LOAD - MOVL (DI), R9 - BSWAPL R9 - MOVL R9, (SP) - - // FUNC1 - MOVL R13, R15 - XORL R12, R15 - ANDL R11, R15 - XORL R13, R15 - - // MIX - ROLL $+30, R11 - ADDL R15, R14 - MOVL R10, R8 - ROLL $+5, R8 - LEAL 1518500249(R14)(R9*1), R14 - ADDL R8, R14 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL (SP), R9 - MOVL R9, (R8) - - // ROUND1(1) - // LOAD - MOVL 4(DI), R9 - BSWAPL R9 - MOVL R9, 4(SP) - - // FUNC1 - MOVL R12, R15 - XORL R11, R15 - ANDL R10, R15 - XORL R12, R15 - - // MIX - ROLL $+30, R10 - ADDL R15, R13 - MOVL R14, R8 - ROLL $+5, R8 - LEAL 1518500249(R13)(R9*1), R13 - ADDL R8, R13 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 4(SP), R9 - MOVL R9, 4(R8) - - // ROUND1(2) - // LOAD - MOVL 8(DI), R9 - BSWAPL R9 - MOVL R9, 8(SP) - - // FUNC1 - MOVL R11, R15 - XORL R10, R15 - ANDL R14, R15 - XORL R11, R15 - - // MIX - ROLL $+30, R14 - ADDL R15, R12 - MOVL R13, R8 - ROLL $+5, R8 - LEAL 1518500249(R12)(R9*1), R12 - ADDL R8, R12 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 8(SP), R9 - MOVL R9, 8(R8) - - // ROUND1(3) - // LOAD - MOVL 12(DI), R9 - BSWAPL R9 - MOVL R9, 12(SP) - - // FUNC1 - MOVL R10, R15 - XORL R14, R15 - ANDL R13, R15 - XORL R10, R15 - - // MIX - ROLL $+30, R13 - ADDL R15, R11 - MOVL R12, R8 - ROLL $+5, R8 - LEAL 1518500249(R11)(R9*1), R11 - ADDL R8, R11 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 12(SP), R9 - MOVL R9, 12(R8) - - // ROUND1(4) - // LOAD - MOVL 16(DI), R9 - BSWAPL R9 - MOVL R9, 16(SP) - - // FUNC1 - MOVL R14, R15 - XORL R13, R15 - ANDL R12, R15 - XORL R14, R15 - - // MIX - ROLL $+30, R12 - ADDL R15, R10 - MOVL R11, R8 - ROLL $+5, R8 - LEAL 1518500249(R10)(R9*1), R10 - ADDL R8, R10 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 16(SP), R9 - MOVL R9, 16(R8) - - // ROUND1(5) - // LOAD - MOVL 20(DI), R9 - BSWAPL R9 - MOVL R9, 20(SP) - - // FUNC1 - MOVL R13, R15 - XORL R12, R15 - ANDL R11, R15 - XORL R13, R15 - - // MIX - ROLL $+30, R11 - ADDL R15, R14 - MOVL R10, R8 - ROLL $+5, R8 - LEAL 1518500249(R14)(R9*1), R14 - ADDL R8, R14 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 20(SP), R9 - MOVL R9, 20(R8) - - // ROUND1(6) - // LOAD - MOVL 24(DI), R9 - BSWAPL R9 - MOVL R9, 24(SP) - - // FUNC1 - MOVL R12, R15 - XORL R11, R15 - ANDL R10, R15 - XORL R12, R15 - - // MIX - ROLL $+30, R10 - ADDL R15, R13 - MOVL R14, R8 - ROLL $+5, R8 - LEAL 1518500249(R13)(R9*1), R13 - ADDL R8, R13 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 24(SP), R9 - MOVL R9, 24(R8) - - // ROUND1(7) - // LOAD - MOVL 28(DI), R9 - BSWAPL R9 - MOVL R9, 28(SP) - - // FUNC1 - MOVL R11, R15 - XORL R10, R15 - ANDL R14, R15 - XORL R11, R15 - - // MIX - ROLL $+30, R14 - ADDL R15, R12 - MOVL R13, R8 - ROLL $+5, R8 - LEAL 1518500249(R12)(R9*1), R12 - ADDL R8, R12 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 28(SP), R9 - MOVL R9, 28(R8) - - // ROUND1(8) - // LOAD - MOVL 32(DI), R9 - BSWAPL R9 - MOVL R9, 32(SP) - - // FUNC1 - MOVL R10, R15 - XORL R14, R15 - ANDL R13, R15 - XORL R10, R15 - - // MIX - ROLL $+30, R13 - ADDL R15, R11 - MOVL R12, R8 - ROLL $+5, R8 - LEAL 1518500249(R11)(R9*1), R11 - ADDL R8, R11 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 32(SP), R9 - MOVL R9, 32(R8) - - // ROUND1(9) - // LOAD - MOVL 36(DI), R9 - BSWAPL R9 - MOVL R9, 36(SP) - - // FUNC1 - MOVL R14, R15 - XORL R13, R15 - ANDL R12, R15 - XORL R14, R15 - - // MIX - ROLL $+30, R12 - ADDL R15, R10 - MOVL R11, R8 - ROLL $+5, R8 - LEAL 1518500249(R10)(R9*1), R10 - ADDL R8, R10 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 36(SP), R9 - MOVL R9, 36(R8) - - // ROUND1(10) - // LOAD - MOVL 40(DI), R9 - BSWAPL R9 - MOVL R9, 40(SP) - - // FUNC1 - MOVL R13, R15 - XORL R12, R15 - ANDL R11, R15 - XORL R13, R15 - - // MIX - ROLL $+30, R11 - ADDL R15, R14 - MOVL R10, R8 - ROLL $+5, R8 - LEAL 1518500249(R14)(R9*1), R14 - ADDL R8, R14 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 40(SP), R9 - MOVL R9, 40(R8) - - // ROUND1(11) - // LOAD - MOVL 44(DI), R9 - BSWAPL R9 - MOVL R9, 44(SP) - - // FUNC1 - MOVL R12, R15 - XORL R11, R15 - ANDL R10, R15 - XORL R12, R15 - - // MIX - ROLL $+30, R10 - ADDL R15, R13 - MOVL R14, R8 - ROLL $+5, R8 - LEAL 1518500249(R13)(R9*1), R13 - ADDL R8, R13 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 44(SP), R9 - MOVL R9, 44(R8) - - // ROUND1(12) - // LOAD - MOVL 48(DI), R9 - BSWAPL R9 - MOVL R9, 48(SP) - - // FUNC1 - MOVL R11, R15 - XORL R10, R15 - ANDL R14, R15 - XORL R11, R15 - - // MIX - ROLL $+30, R14 - ADDL R15, R12 - MOVL R13, R8 - ROLL $+5, R8 - LEAL 1518500249(R12)(R9*1), R12 - ADDL R8, R12 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 48(SP), R9 - MOVL R9, 48(R8) - - // ROUND1(13) - // LOAD - MOVL 52(DI), R9 - BSWAPL R9 - MOVL R9, 52(SP) - - // FUNC1 - MOVL R10, R15 - XORL R14, R15 - ANDL R13, R15 - XORL R10, R15 - - // MIX - ROLL $+30, R13 - ADDL R15, R11 - MOVL R12, R8 - ROLL $+5, R8 - LEAL 1518500249(R11)(R9*1), R11 - ADDL R8, R11 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 52(SP), R9 - MOVL R9, 52(R8) - - // ROUND1(14) - // LOAD - MOVL 56(DI), R9 - BSWAPL R9 - MOVL R9, 56(SP) - - // FUNC1 - MOVL R14, R15 - XORL R13, R15 - ANDL R12, R15 - XORL R14, R15 - - // MIX - ROLL $+30, R12 - ADDL R15, R10 - MOVL R11, R8 - ROLL $+5, R8 - LEAL 1518500249(R10)(R9*1), R10 - ADDL R8, R10 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 56(SP), R9 - MOVL R9, 56(R8) - - // ROUND1(15) - // LOAD - MOVL 60(DI), R9 - BSWAPL R9 - MOVL R9, 60(SP) - - // FUNC1 - MOVL R13, R15 - XORL R12, R15 - ANDL R11, R15 - XORL R13, R15 - - // MIX - ROLL $+30, R11 - ADDL R15, R14 - MOVL R10, R8 - ROLL $+5, R8 - LEAL 1518500249(R14)(R9*1), R14 - ADDL R8, R14 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 60(SP), R9 - MOVL R9, 60(R8) - - // ROUND1x (steps 16-19) - same as ROUND1 but with no data load. - // ROUND1x(16) - // SHUFFLE - MOVL (SP), R9 - XORL 52(SP), R9 - XORL 32(SP), R9 - XORL 8(SP), R9 - ROLL $+1, R9 - MOVL R9, (SP) - - // FUNC1 - MOVL R12, R15 - XORL R11, R15 - ANDL R10, R15 - XORL R12, R15 - - // MIX - ROLL $+30, R10 - ADDL R15, R13 - MOVL R14, R8 - ROLL $+5, R8 - LEAL 1518500249(R13)(R9*1), R13 - ADDL R8, R13 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL (SP), R9 - MOVL R9, 64(R8) - - // ROUND1x(17) - // SHUFFLE - MOVL 4(SP), R9 - XORL 56(SP), R9 - XORL 36(SP), R9 - XORL 12(SP), R9 - ROLL $+1, R9 - MOVL R9, 4(SP) - - // FUNC1 - MOVL R11, R15 - XORL R10, R15 - ANDL R14, R15 - XORL R11, R15 - - // MIX - ROLL $+30, R14 - ADDL R15, R12 - MOVL R13, R8 - ROLL $+5, R8 - LEAL 1518500249(R12)(R9*1), R12 - ADDL R8, R12 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 4(SP), R9 - MOVL R9, 68(R8) - - // ROUND1x(18) - // SHUFFLE - MOVL 8(SP), R9 - XORL 60(SP), R9 - XORL 40(SP), R9 - XORL 16(SP), R9 - ROLL $+1, R9 - MOVL R9, 8(SP) - - // FUNC1 - MOVL R10, R15 - XORL R14, R15 - ANDL R13, R15 - XORL R10, R15 - - // MIX - ROLL $+30, R13 - ADDL R15, R11 - MOVL R12, R8 - ROLL $+5, R8 - LEAL 1518500249(R11)(R9*1), R11 - ADDL R8, R11 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 8(SP), R9 - MOVL R9, 72(R8) - - // ROUND1x(19) - // SHUFFLE - MOVL 12(SP), R9 - XORL (SP), R9 - XORL 44(SP), R9 - XORL 20(SP), R9 - ROLL $+1, R9 - MOVL R9, 12(SP) - - // FUNC1 - MOVL R14, R15 - XORL R13, R15 - ANDL R12, R15 - XORL R14, R15 - - // MIX - ROLL $+30, R12 - ADDL R15, R10 - MOVL R11, R8 - ROLL $+5, R8 - LEAL 1518500249(R10)(R9*1), R10 - ADDL R8, R10 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 12(SP), R9 - MOVL R9, 76(R8) - - // ROUND2 (steps 20-39) - // ROUND2(20) - // SHUFFLE - MOVL 16(SP), R9 - XORL 4(SP), R9 - XORL 48(SP), R9 - XORL 24(SP), R9 - ROLL $+1, R9 - MOVL R9, 16(SP) - - // FUNC2 - MOVL R11, R15 - XORL R12, R15 - XORL R13, R15 - - // MIX - ROLL $+30, R11 - ADDL R15, R14 - MOVL R10, R8 - ROLL $+5, R8 - LEAL 1859775393(R14)(R9*1), R14 - ADDL R8, R14 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 16(SP), R9 - MOVL R9, 80(R8) - - // ROUND2(21) - // SHUFFLE - MOVL 20(SP), R9 - XORL 8(SP), R9 - XORL 52(SP), R9 - XORL 28(SP), R9 - ROLL $+1, R9 - MOVL R9, 20(SP) - - // FUNC2 - MOVL R10, R15 - XORL R11, R15 - XORL R12, R15 - - // MIX - ROLL $+30, R10 - ADDL R15, R13 - MOVL R14, R8 - ROLL $+5, R8 - LEAL 1859775393(R13)(R9*1), R13 - ADDL R8, R13 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 20(SP), R9 - MOVL R9, 84(R8) - - // ROUND2(22) - // SHUFFLE - MOVL 24(SP), R9 - XORL 12(SP), R9 - XORL 56(SP), R9 - XORL 32(SP), R9 - ROLL $+1, R9 - MOVL R9, 24(SP) - - // FUNC2 - MOVL R14, R15 - XORL R10, R15 - XORL R11, R15 - - // MIX - ROLL $+30, R14 - ADDL R15, R12 - MOVL R13, R8 - ROLL $+5, R8 - LEAL 1859775393(R12)(R9*1), R12 - ADDL R8, R12 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 24(SP), R9 - MOVL R9, 88(R8) - - // ROUND2(23) - // SHUFFLE - MOVL 28(SP), R9 - XORL 16(SP), R9 - XORL 60(SP), R9 - XORL 36(SP), R9 - ROLL $+1, R9 - MOVL R9, 28(SP) - - // FUNC2 - MOVL R13, R15 - XORL R14, R15 - XORL R10, R15 - - // MIX - ROLL $+30, R13 - ADDL R15, R11 - MOVL R12, R8 - ROLL $+5, R8 - LEAL 1859775393(R11)(R9*1), R11 - ADDL R8, R11 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 28(SP), R9 - MOVL R9, 92(R8) - - // ROUND2(24) - // SHUFFLE - MOVL 32(SP), R9 - XORL 20(SP), R9 - XORL (SP), R9 - XORL 40(SP), R9 - ROLL $+1, R9 - MOVL R9, 32(SP) - - // FUNC2 - MOVL R12, R15 - XORL R13, R15 - XORL R14, R15 - - // MIX - ROLL $+30, R12 - ADDL R15, R10 - MOVL R11, R8 - ROLL $+5, R8 - LEAL 1859775393(R10)(R9*1), R10 - ADDL R8, R10 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 32(SP), R9 - MOVL R9, 96(R8) - - // ROUND2(25) - // SHUFFLE - MOVL 36(SP), R9 - XORL 24(SP), R9 - XORL 4(SP), R9 - XORL 44(SP), R9 - ROLL $+1, R9 - MOVL R9, 36(SP) - - // FUNC2 - MOVL R11, R15 - XORL R12, R15 - XORL R13, R15 - - // MIX - ROLL $+30, R11 - ADDL R15, R14 - MOVL R10, R8 - ROLL $+5, R8 - LEAL 1859775393(R14)(R9*1), R14 - ADDL R8, R14 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 36(SP), R9 - MOVL R9, 100(R8) - - // ROUND2(26) - // SHUFFLE - MOVL 40(SP), R9 - XORL 28(SP), R9 - XORL 8(SP), R9 - XORL 48(SP), R9 - ROLL $+1, R9 - MOVL R9, 40(SP) - - // FUNC2 - MOVL R10, R15 - XORL R11, R15 - XORL R12, R15 - - // MIX - ROLL $+30, R10 - ADDL R15, R13 - MOVL R14, R8 - ROLL $+5, R8 - LEAL 1859775393(R13)(R9*1), R13 - ADDL R8, R13 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 40(SP), R9 - MOVL R9, 104(R8) - - // ROUND2(27) - // SHUFFLE - MOVL 44(SP), R9 - XORL 32(SP), R9 - XORL 12(SP), R9 - XORL 52(SP), R9 - ROLL $+1, R9 - MOVL R9, 44(SP) - - // FUNC2 - MOVL R14, R15 - XORL R10, R15 - XORL R11, R15 - - // MIX - ROLL $+30, R14 - ADDL R15, R12 - MOVL R13, R8 - ROLL $+5, R8 - LEAL 1859775393(R12)(R9*1), R12 - ADDL R8, R12 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 44(SP), R9 - MOVL R9, 108(R8) - - // ROUND2(28) - // SHUFFLE - MOVL 48(SP), R9 - XORL 36(SP), R9 - XORL 16(SP), R9 - XORL 56(SP), R9 - ROLL $+1, R9 - MOVL R9, 48(SP) - - // FUNC2 - MOVL R13, R15 - XORL R14, R15 - XORL R10, R15 - - // MIX - ROLL $+30, R13 - ADDL R15, R11 - MOVL R12, R8 - ROLL $+5, R8 - LEAL 1859775393(R11)(R9*1), R11 - ADDL R8, R11 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 48(SP), R9 - MOVL R9, 112(R8) - - // ROUND2(29) - // SHUFFLE - MOVL 52(SP), R9 - XORL 40(SP), R9 - XORL 20(SP), R9 - XORL 60(SP), R9 - ROLL $+1, R9 - MOVL R9, 52(SP) - - // FUNC2 - MOVL R12, R15 - XORL R13, R15 - XORL R14, R15 - - // MIX - ROLL $+30, R12 - ADDL R15, R10 - MOVL R11, R8 - ROLL $+5, R8 - LEAL 1859775393(R10)(R9*1), R10 - ADDL R8, R10 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 52(SP), R9 - MOVL R9, 116(R8) - - // ROUND2(30) - // SHUFFLE - MOVL 56(SP), R9 - XORL 44(SP), R9 - XORL 24(SP), R9 - XORL (SP), R9 - ROLL $+1, R9 - MOVL R9, 56(SP) - - // FUNC2 - MOVL R11, R15 - XORL R12, R15 - XORL R13, R15 - - // MIX - ROLL $+30, R11 - ADDL R15, R14 - MOVL R10, R8 - ROLL $+5, R8 - LEAL 1859775393(R14)(R9*1), R14 - ADDL R8, R14 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 56(SP), R9 - MOVL R9, 120(R8) - - // ROUND2(31) - // SHUFFLE - MOVL 60(SP), R9 - XORL 48(SP), R9 - XORL 28(SP), R9 - XORL 4(SP), R9 - ROLL $+1, R9 - MOVL R9, 60(SP) - - // FUNC2 - MOVL R10, R15 - XORL R11, R15 - XORL R12, R15 - - // MIX - ROLL $+30, R10 - ADDL R15, R13 - MOVL R14, R8 - ROLL $+5, R8 - LEAL 1859775393(R13)(R9*1), R13 - ADDL R8, R13 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 60(SP), R9 - MOVL R9, 124(R8) - - // ROUND2(32) - // SHUFFLE - MOVL (SP), R9 - XORL 52(SP), R9 - XORL 32(SP), R9 - XORL 8(SP), R9 - ROLL $+1, R9 - MOVL R9, (SP) - - // FUNC2 - MOVL R14, R15 - XORL R10, R15 - XORL R11, R15 - - // MIX - ROLL $+30, R14 - ADDL R15, R12 - MOVL R13, R8 - ROLL $+5, R8 - LEAL 1859775393(R12)(R9*1), R12 - ADDL R8, R12 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL (SP), R9 - MOVL R9, 128(R8) - - // ROUND2(33) - // SHUFFLE - MOVL 4(SP), R9 - XORL 56(SP), R9 - XORL 36(SP), R9 - XORL 12(SP), R9 - ROLL $+1, R9 - MOVL R9, 4(SP) - - // FUNC2 - MOVL R13, R15 - XORL R14, R15 - XORL R10, R15 - - // MIX - ROLL $+30, R13 - ADDL R15, R11 - MOVL R12, R8 - ROLL $+5, R8 - LEAL 1859775393(R11)(R9*1), R11 - ADDL R8, R11 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 4(SP), R9 - MOVL R9, 132(R8) - - // ROUND2(34) - // SHUFFLE - MOVL 8(SP), R9 - XORL 60(SP), R9 - XORL 40(SP), R9 - XORL 16(SP), R9 - ROLL $+1, R9 - MOVL R9, 8(SP) - - // FUNC2 - MOVL R12, R15 - XORL R13, R15 - XORL R14, R15 - - // MIX - ROLL $+30, R12 - ADDL R15, R10 - MOVL R11, R8 - ROLL $+5, R8 - LEAL 1859775393(R10)(R9*1), R10 - ADDL R8, R10 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 8(SP), R9 - MOVL R9, 136(R8) - - // ROUND2(35) - // SHUFFLE - MOVL 12(SP), R9 - XORL (SP), R9 - XORL 44(SP), R9 - XORL 20(SP), R9 - ROLL $+1, R9 - MOVL R9, 12(SP) - - // FUNC2 - MOVL R11, R15 - XORL R12, R15 - XORL R13, R15 - - // MIX - ROLL $+30, R11 - ADDL R15, R14 - MOVL R10, R8 - ROLL $+5, R8 - LEAL 1859775393(R14)(R9*1), R14 - ADDL R8, R14 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 12(SP), R9 - MOVL R9, 140(R8) - - // ROUND2(36) - // SHUFFLE - MOVL 16(SP), R9 - XORL 4(SP), R9 - XORL 48(SP), R9 - XORL 24(SP), R9 - ROLL $+1, R9 - MOVL R9, 16(SP) - - // FUNC2 - MOVL R10, R15 - XORL R11, R15 - XORL R12, R15 - - // MIX - ROLL $+30, R10 - ADDL R15, R13 - MOVL R14, R8 - ROLL $+5, R8 - LEAL 1859775393(R13)(R9*1), R13 - ADDL R8, R13 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 16(SP), R9 - MOVL R9, 144(R8) - - // ROUND2(37) - // SHUFFLE - MOVL 20(SP), R9 - XORL 8(SP), R9 - XORL 52(SP), R9 - XORL 28(SP), R9 - ROLL $+1, R9 - MOVL R9, 20(SP) - - // FUNC2 - MOVL R14, R15 - XORL R10, R15 - XORL R11, R15 - - // MIX - ROLL $+30, R14 - ADDL R15, R12 - MOVL R13, R8 - ROLL $+5, R8 - LEAL 1859775393(R12)(R9*1), R12 - ADDL R8, R12 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 20(SP), R9 - MOVL R9, 148(R8) - - // ROUND2(38) - // SHUFFLE - MOVL 24(SP), R9 - XORL 12(SP), R9 - XORL 56(SP), R9 - XORL 32(SP), R9 - ROLL $+1, R9 - MOVL R9, 24(SP) - - // FUNC2 - MOVL R13, R15 - XORL R14, R15 - XORL R10, R15 - - // MIX - ROLL $+30, R13 - ADDL R15, R11 - MOVL R12, R8 - ROLL $+5, R8 - LEAL 1859775393(R11)(R9*1), R11 - ADDL R8, R11 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 24(SP), R9 - MOVL R9, 152(R8) - - // ROUND2(39) - // SHUFFLE - MOVL 28(SP), R9 - XORL 16(SP), R9 - XORL 60(SP), R9 - XORL 36(SP), R9 - ROLL $+1, R9 - MOVL R9, 28(SP) - - // FUNC2 - MOVL R12, R15 - XORL R13, R15 - XORL R14, R15 - - // MIX - ROLL $+30, R12 - ADDL R15, R10 - MOVL R11, R8 - ROLL $+5, R8 - LEAL 1859775393(R10)(R9*1), R10 - ADDL R8, R10 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 28(SP), R9 - MOVL R9, 156(R8) - - // ROUND3 (steps 40-59) - // ROUND3(40) - // SHUFFLE - MOVL 32(SP), R9 - XORL 20(SP), R9 - XORL (SP), R9 - XORL 40(SP), R9 - ROLL $+1, R9 - MOVL R9, 32(SP) - - // FUNC3 - MOVL R11, R8 - ORL R12, R8 - ANDL R13, R8 - MOVL R11, R15 - ANDL R12, R15 - ORL R8, R15 - - // MIX - ROLL $+30, R11 - ADDL R15, R14 - MOVL R10, R8 - ROLL $+5, R8 - LEAL 2400959708(R14)(R9*1), R14 - ADDL R8, R14 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 32(SP), R9 - MOVL R9, 160(R8) - - // ROUND3(41) - // SHUFFLE - MOVL 36(SP), R9 - XORL 24(SP), R9 - XORL 4(SP), R9 - XORL 44(SP), R9 - ROLL $+1, R9 - MOVL R9, 36(SP) - - // FUNC3 - MOVL R10, R8 - ORL R11, R8 - ANDL R12, R8 - MOVL R10, R15 - ANDL R11, R15 - ORL R8, R15 - - // MIX - ROLL $+30, R10 - ADDL R15, R13 - MOVL R14, R8 - ROLL $+5, R8 - LEAL 2400959708(R13)(R9*1), R13 - ADDL R8, R13 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 36(SP), R9 - MOVL R9, 164(R8) - - // ROUND3(42) - // SHUFFLE - MOVL 40(SP), R9 - XORL 28(SP), R9 - XORL 8(SP), R9 - XORL 48(SP), R9 - ROLL $+1, R9 - MOVL R9, 40(SP) - - // FUNC3 - MOVL R14, R8 - ORL R10, R8 - ANDL R11, R8 - MOVL R14, R15 - ANDL R10, R15 - ORL R8, R15 - - // MIX - ROLL $+30, R14 - ADDL R15, R12 - MOVL R13, R8 - ROLL $+5, R8 - LEAL 2400959708(R12)(R9*1), R12 - ADDL R8, R12 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 40(SP), R9 - MOVL R9, 168(R8) - - // ROUND3(43) - // SHUFFLE - MOVL 44(SP), R9 - XORL 32(SP), R9 - XORL 12(SP), R9 - XORL 52(SP), R9 - ROLL $+1, R9 - MOVL R9, 44(SP) - - // FUNC3 - MOVL R13, R8 - ORL R14, R8 - ANDL R10, R8 - MOVL R13, R15 - ANDL R14, R15 - ORL R8, R15 - - // MIX - ROLL $+30, R13 - ADDL R15, R11 - MOVL R12, R8 - ROLL $+5, R8 - LEAL 2400959708(R11)(R9*1), R11 - ADDL R8, R11 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 44(SP), R9 - MOVL R9, 172(R8) - - // ROUND3(44) - // SHUFFLE - MOVL 48(SP), R9 - XORL 36(SP), R9 - XORL 16(SP), R9 - XORL 56(SP), R9 - ROLL $+1, R9 - MOVL R9, 48(SP) - - // FUNC3 - MOVL R12, R8 - ORL R13, R8 - ANDL R14, R8 - MOVL R12, R15 - ANDL R13, R15 - ORL R8, R15 - - // MIX - ROLL $+30, R12 - ADDL R15, R10 - MOVL R11, R8 - ROLL $+5, R8 - LEAL 2400959708(R10)(R9*1), R10 - ADDL R8, R10 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 48(SP), R9 - MOVL R9, 176(R8) - - // ROUND3(45) - // SHUFFLE - MOVL 52(SP), R9 - XORL 40(SP), R9 - XORL 20(SP), R9 - XORL 60(SP), R9 - ROLL $+1, R9 - MOVL R9, 52(SP) - - // FUNC3 - MOVL R11, R8 - ORL R12, R8 - ANDL R13, R8 - MOVL R11, R15 - ANDL R12, R15 - ORL R8, R15 - - // MIX - ROLL $+30, R11 - ADDL R15, R14 - MOVL R10, R8 - ROLL $+5, R8 - LEAL 2400959708(R14)(R9*1), R14 - ADDL R8, R14 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 52(SP), R9 - MOVL R9, 180(R8) - - // ROUND3(46) - // SHUFFLE - MOVL 56(SP), R9 - XORL 44(SP), R9 - XORL 24(SP), R9 - XORL (SP), R9 - ROLL $+1, R9 - MOVL R9, 56(SP) - - // FUNC3 - MOVL R10, R8 - ORL R11, R8 - ANDL R12, R8 - MOVL R10, R15 - ANDL R11, R15 - ORL R8, R15 - - // MIX - ROLL $+30, R10 - ADDL R15, R13 - MOVL R14, R8 - ROLL $+5, R8 - LEAL 2400959708(R13)(R9*1), R13 - ADDL R8, R13 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 56(SP), R9 - MOVL R9, 184(R8) - - // ROUND3(47) - // SHUFFLE - MOVL 60(SP), R9 - XORL 48(SP), R9 - XORL 28(SP), R9 - XORL 4(SP), R9 - ROLL $+1, R9 - MOVL R9, 60(SP) - - // FUNC3 - MOVL R14, R8 - ORL R10, R8 - ANDL R11, R8 - MOVL R14, R15 - ANDL R10, R15 - ORL R8, R15 - - // MIX - ROLL $+30, R14 - ADDL R15, R12 - MOVL R13, R8 - ROLL $+5, R8 - LEAL 2400959708(R12)(R9*1), R12 - ADDL R8, R12 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 60(SP), R9 - MOVL R9, 188(R8) - - // ROUND3(48) - // SHUFFLE - MOVL (SP), R9 - XORL 52(SP), R9 - XORL 32(SP), R9 - XORL 8(SP), R9 - ROLL $+1, R9 - MOVL R9, (SP) - - // FUNC3 - MOVL R13, R8 - ORL R14, R8 - ANDL R10, R8 - MOVL R13, R15 - ANDL R14, R15 - ORL R8, R15 - - // MIX - ROLL $+30, R13 - ADDL R15, R11 - MOVL R12, R8 - ROLL $+5, R8 - LEAL 2400959708(R11)(R9*1), R11 - ADDL R8, R11 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL (SP), R9 - MOVL R9, 192(R8) - - // ROUND3(49) - // SHUFFLE - MOVL 4(SP), R9 - XORL 56(SP), R9 - XORL 36(SP), R9 - XORL 12(SP), R9 - ROLL $+1, R9 - MOVL R9, 4(SP) - - // FUNC3 - MOVL R12, R8 - ORL R13, R8 - ANDL R14, R8 - MOVL R12, R15 - ANDL R13, R15 - ORL R8, R15 - - // MIX - ROLL $+30, R12 - ADDL R15, R10 - MOVL R11, R8 - ROLL $+5, R8 - LEAL 2400959708(R10)(R9*1), R10 - ADDL R8, R10 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 4(SP), R9 - MOVL R9, 196(R8) - - // ROUND3(50) - // SHUFFLE - MOVL 8(SP), R9 - XORL 60(SP), R9 - XORL 40(SP), R9 - XORL 16(SP), R9 - ROLL $+1, R9 - MOVL R9, 8(SP) - - // FUNC3 - MOVL R11, R8 - ORL R12, R8 - ANDL R13, R8 - MOVL R11, R15 - ANDL R12, R15 - ORL R8, R15 - - // MIX - ROLL $+30, R11 - ADDL R15, R14 - MOVL R10, R8 - ROLL $+5, R8 - LEAL 2400959708(R14)(R9*1), R14 - ADDL R8, R14 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 8(SP), R9 - MOVL R9, 200(R8) - - // ROUND3(51) - // SHUFFLE - MOVL 12(SP), R9 - XORL (SP), R9 - XORL 44(SP), R9 - XORL 20(SP), R9 - ROLL $+1, R9 - MOVL R9, 12(SP) - - // FUNC3 - MOVL R10, R8 - ORL R11, R8 - ANDL R12, R8 - MOVL R10, R15 - ANDL R11, R15 - ORL R8, R15 - - // MIX - ROLL $+30, R10 - ADDL R15, R13 - MOVL R14, R8 - ROLL $+5, R8 - LEAL 2400959708(R13)(R9*1), R13 - ADDL R8, R13 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 12(SP), R9 - MOVL R9, 204(R8) - - // ROUND3(52) - // SHUFFLE - MOVL 16(SP), R9 - XORL 4(SP), R9 - XORL 48(SP), R9 - XORL 24(SP), R9 - ROLL $+1, R9 - MOVL R9, 16(SP) - - // FUNC3 - MOVL R14, R8 - ORL R10, R8 - ANDL R11, R8 - MOVL R14, R15 - ANDL R10, R15 - ORL R8, R15 - - // MIX - ROLL $+30, R14 - ADDL R15, R12 - MOVL R13, R8 - ROLL $+5, R8 - LEAL 2400959708(R12)(R9*1), R12 - ADDL R8, R12 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 16(SP), R9 - MOVL R9, 208(R8) - - // ROUND3(53) - // SHUFFLE - MOVL 20(SP), R9 - XORL 8(SP), R9 - XORL 52(SP), R9 - XORL 28(SP), R9 - ROLL $+1, R9 - MOVL R9, 20(SP) - - // FUNC3 - MOVL R13, R8 - ORL R14, R8 - ANDL R10, R8 - MOVL R13, R15 - ANDL R14, R15 - ORL R8, R15 - - // MIX - ROLL $+30, R13 - ADDL R15, R11 - MOVL R12, R8 - ROLL $+5, R8 - LEAL 2400959708(R11)(R9*1), R11 - ADDL R8, R11 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 20(SP), R9 - MOVL R9, 212(R8) - - // ROUND3(54) - // SHUFFLE - MOVL 24(SP), R9 - XORL 12(SP), R9 - XORL 56(SP), R9 - XORL 32(SP), R9 - ROLL $+1, R9 - MOVL R9, 24(SP) - - // FUNC3 - MOVL R12, R8 - ORL R13, R8 - ANDL R14, R8 - MOVL R12, R15 - ANDL R13, R15 - ORL R8, R15 - - // MIX - ROLL $+30, R12 - ADDL R15, R10 - MOVL R11, R8 - ROLL $+5, R8 - LEAL 2400959708(R10)(R9*1), R10 - ADDL R8, R10 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 24(SP), R9 - MOVL R9, 216(R8) - - // ROUND3(55) - // SHUFFLE - MOVL 28(SP), R9 - XORL 16(SP), R9 - XORL 60(SP), R9 - XORL 36(SP), R9 - ROLL $+1, R9 - MOVL R9, 28(SP) - - // FUNC3 - MOVL R11, R8 - ORL R12, R8 - ANDL R13, R8 - MOVL R11, R15 - ANDL R12, R15 - ORL R8, R15 - - // MIX - ROLL $+30, R11 - ADDL R15, R14 - MOVL R10, R8 - ROLL $+5, R8 - LEAL 2400959708(R14)(R9*1), R14 - ADDL R8, R14 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 28(SP), R9 - MOVL R9, 220(R8) - - // ROUND3(56) - // SHUFFLE - MOVL 32(SP), R9 - XORL 20(SP), R9 - XORL (SP), R9 - XORL 40(SP), R9 - ROLL $+1, R9 - MOVL R9, 32(SP) - - // FUNC3 - MOVL R10, R8 - ORL R11, R8 - ANDL R12, R8 - MOVL R10, R15 - ANDL R11, R15 - ORL R8, R15 - - // MIX - ROLL $+30, R10 - ADDL R15, R13 - MOVL R14, R8 - ROLL $+5, R8 - LEAL 2400959708(R13)(R9*1), R13 - ADDL R8, R13 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 32(SP), R9 - MOVL R9, 224(R8) - - // ROUND3(57) - // SHUFFLE - MOVL 36(SP), R9 - XORL 24(SP), R9 - XORL 4(SP), R9 - XORL 44(SP), R9 - ROLL $+1, R9 - MOVL R9, 36(SP) - - // FUNC3 - MOVL R14, R8 - ORL R10, R8 - ANDL R11, R8 - MOVL R14, R15 - ANDL R10, R15 - ORL R8, R15 - - // MIX - ROLL $+30, R14 - ADDL R15, R12 - MOVL R13, R8 - ROLL $+5, R8 - LEAL 2400959708(R12)(R9*1), R12 - ADDL R8, R12 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 36(SP), R9 - MOVL R9, 228(R8) - - // Load cs - MOVQ cs_base+56(FP), R8 - MOVL R12, 20(R8) - MOVL R13, 24(R8) - MOVL R14, 28(R8) - MOVL R10, 32(R8) - MOVL R11, 36(R8) - - // ROUND3(58) - // SHUFFLE - MOVL 40(SP), R9 - XORL 28(SP), R9 - XORL 8(SP), R9 - XORL 48(SP), R9 - ROLL $+1, R9 - MOVL R9, 40(SP) - - // FUNC3 - MOVL R13, R8 - ORL R14, R8 - ANDL R10, R8 - MOVL R13, R15 - ANDL R14, R15 - ORL R8, R15 - - // MIX - ROLL $+30, R13 - ADDL R15, R11 - MOVL R12, R8 - ROLL $+5, R8 - LEAL 2400959708(R11)(R9*1), R11 - ADDL R8, R11 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 40(SP), R9 - MOVL R9, 232(R8) - - // ROUND3(59) - // SHUFFLE - MOVL 44(SP), R9 - XORL 32(SP), R9 - XORL 12(SP), R9 - XORL 52(SP), R9 - ROLL $+1, R9 - MOVL R9, 44(SP) - - // FUNC3 - MOVL R12, R8 - ORL R13, R8 - ANDL R14, R8 - MOVL R12, R15 - ANDL R13, R15 - ORL R8, R15 - - // MIX - ROLL $+30, R12 - ADDL R15, R10 - MOVL R11, R8 - ROLL $+5, R8 - LEAL 2400959708(R10)(R9*1), R10 - ADDL R8, R10 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 44(SP), R9 - MOVL R9, 236(R8) - - // ROUND4 (steps 60-79) - // ROUND4(60) - // SHUFFLE - MOVL 48(SP), R9 - XORL 36(SP), R9 - XORL 16(SP), R9 - XORL 56(SP), R9 - ROLL $+1, R9 - MOVL R9, 48(SP) - - // FUNC2 - MOVL R11, R15 - XORL R12, R15 - XORL R13, R15 - - // MIX - ROLL $+30, R11 - ADDL R15, R14 - MOVL R10, R8 - ROLL $+5, R8 - LEAL 3395469782(R14)(R9*1), R14 - ADDL R8, R14 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 48(SP), R9 - MOVL R9, 240(R8) - - // ROUND4(61) - // SHUFFLE - MOVL 52(SP), R9 - XORL 40(SP), R9 - XORL 20(SP), R9 - XORL 60(SP), R9 - ROLL $+1, R9 - MOVL R9, 52(SP) - - // FUNC2 - MOVL R10, R15 - XORL R11, R15 - XORL R12, R15 - - // MIX - ROLL $+30, R10 - ADDL R15, R13 - MOVL R14, R8 - ROLL $+5, R8 - LEAL 3395469782(R13)(R9*1), R13 - ADDL R8, R13 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 52(SP), R9 - MOVL R9, 244(R8) - - // ROUND4(62) - // SHUFFLE - MOVL 56(SP), R9 - XORL 44(SP), R9 - XORL 24(SP), R9 - XORL (SP), R9 - ROLL $+1, R9 - MOVL R9, 56(SP) - - // FUNC2 - MOVL R14, R15 - XORL R10, R15 - XORL R11, R15 - - // MIX - ROLL $+30, R14 - ADDL R15, R12 - MOVL R13, R8 - ROLL $+5, R8 - LEAL 3395469782(R12)(R9*1), R12 - ADDL R8, R12 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 56(SP), R9 - MOVL R9, 248(R8) - - // ROUND4(63) - // SHUFFLE - MOVL 60(SP), R9 - XORL 48(SP), R9 - XORL 28(SP), R9 - XORL 4(SP), R9 - ROLL $+1, R9 - MOVL R9, 60(SP) - - // FUNC2 - MOVL R13, R15 - XORL R14, R15 - XORL R10, R15 - - // MIX - ROLL $+30, R13 - ADDL R15, R11 - MOVL R12, R8 - ROLL $+5, R8 - LEAL 3395469782(R11)(R9*1), R11 - ADDL R8, R11 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 60(SP), R9 - MOVL R9, 252(R8) - - // ROUND4(64) - // SHUFFLE - MOVL (SP), R9 - XORL 52(SP), R9 - XORL 32(SP), R9 - XORL 8(SP), R9 - ROLL $+1, R9 - MOVL R9, (SP) - - // FUNC2 - MOVL R12, R15 - XORL R13, R15 - XORL R14, R15 - - // MIX - ROLL $+30, R12 - ADDL R15, R10 - MOVL R11, R8 - ROLL $+5, R8 - LEAL 3395469782(R10)(R9*1), R10 - ADDL R8, R10 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL (SP), R9 - MOVL R9, 256(R8) - - // Load cs - MOVQ cs_base+56(FP), R8 - MOVL R10, 40(R8) - MOVL R11, 44(R8) - MOVL R12, 48(R8) - MOVL R13, 52(R8) - MOVL R14, 56(R8) - - // ROUND4(65) - // SHUFFLE - MOVL 4(SP), R9 - XORL 56(SP), R9 - XORL 36(SP), R9 - XORL 12(SP), R9 - ROLL $+1, R9 - MOVL R9, 4(SP) - - // FUNC2 - MOVL R11, R15 - XORL R12, R15 - XORL R13, R15 - - // MIX - ROLL $+30, R11 - ADDL R15, R14 - MOVL R10, R8 - ROLL $+5, R8 - LEAL 3395469782(R14)(R9*1), R14 - ADDL R8, R14 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 4(SP), R9 - MOVL R9, 260(R8) - - // ROUND4(66) - // SHUFFLE - MOVL 8(SP), R9 - XORL 60(SP), R9 - XORL 40(SP), R9 - XORL 16(SP), R9 - ROLL $+1, R9 - MOVL R9, 8(SP) - - // FUNC2 - MOVL R10, R15 - XORL R11, R15 - XORL R12, R15 - - // MIX - ROLL $+30, R10 - ADDL R15, R13 - MOVL R14, R8 - ROLL $+5, R8 - LEAL 3395469782(R13)(R9*1), R13 - ADDL R8, R13 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 8(SP), R9 - MOVL R9, 264(R8) - - // ROUND4(67) - // SHUFFLE - MOVL 12(SP), R9 - XORL (SP), R9 - XORL 44(SP), R9 - XORL 20(SP), R9 - ROLL $+1, R9 - MOVL R9, 12(SP) - - // FUNC2 - MOVL R14, R15 - XORL R10, R15 - XORL R11, R15 - - // MIX - ROLL $+30, R14 - ADDL R15, R12 - MOVL R13, R8 - ROLL $+5, R8 - LEAL 3395469782(R12)(R9*1), R12 - ADDL R8, R12 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 12(SP), R9 - MOVL R9, 268(R8) - - // ROUND4(68) - // SHUFFLE - MOVL 16(SP), R9 - XORL 4(SP), R9 - XORL 48(SP), R9 - XORL 24(SP), R9 - ROLL $+1, R9 - MOVL R9, 16(SP) - - // FUNC2 - MOVL R13, R15 - XORL R14, R15 - XORL R10, R15 - - // MIX - ROLL $+30, R13 - ADDL R15, R11 - MOVL R12, R8 - ROLL $+5, R8 - LEAL 3395469782(R11)(R9*1), R11 - ADDL R8, R11 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 16(SP), R9 - MOVL R9, 272(R8) - - // ROUND4(69) - // SHUFFLE - MOVL 20(SP), R9 - XORL 8(SP), R9 - XORL 52(SP), R9 - XORL 28(SP), R9 - ROLL $+1, R9 - MOVL R9, 20(SP) - - // FUNC2 - MOVL R12, R15 - XORL R13, R15 - XORL R14, R15 - - // MIX - ROLL $+30, R12 - ADDL R15, R10 - MOVL R11, R8 - ROLL $+5, R8 - LEAL 3395469782(R10)(R9*1), R10 - ADDL R8, R10 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 20(SP), R9 - MOVL R9, 276(R8) - - // ROUND4(70) - // SHUFFLE - MOVL 24(SP), R9 - XORL 12(SP), R9 - XORL 56(SP), R9 - XORL 32(SP), R9 - ROLL $+1, R9 - MOVL R9, 24(SP) - - // FUNC2 - MOVL R11, R15 - XORL R12, R15 - XORL R13, R15 - - // MIX - ROLL $+30, R11 - ADDL R15, R14 - MOVL R10, R8 - ROLL $+5, R8 - LEAL 3395469782(R14)(R9*1), R14 - ADDL R8, R14 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 24(SP), R9 - MOVL R9, 280(R8) - - // ROUND4(71) - // SHUFFLE - MOVL 28(SP), R9 - XORL 16(SP), R9 - XORL 60(SP), R9 - XORL 36(SP), R9 - ROLL $+1, R9 - MOVL R9, 28(SP) - - // FUNC2 - MOVL R10, R15 - XORL R11, R15 - XORL R12, R15 - - // MIX - ROLL $+30, R10 - ADDL R15, R13 - MOVL R14, R8 - ROLL $+5, R8 - LEAL 3395469782(R13)(R9*1), R13 - ADDL R8, R13 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 28(SP), R9 - MOVL R9, 284(R8) - - // ROUND4(72) - // SHUFFLE - MOVL 32(SP), R9 - XORL 20(SP), R9 - XORL (SP), R9 - XORL 40(SP), R9 - ROLL $+1, R9 - MOVL R9, 32(SP) - - // FUNC2 - MOVL R14, R15 - XORL R10, R15 - XORL R11, R15 - - // MIX - ROLL $+30, R14 - ADDL R15, R12 - MOVL R13, R8 - ROLL $+5, R8 - LEAL 3395469782(R12)(R9*1), R12 - ADDL R8, R12 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 32(SP), R9 - MOVL R9, 288(R8) - - // ROUND4(73) - // SHUFFLE - MOVL 36(SP), R9 - XORL 24(SP), R9 - XORL 4(SP), R9 - XORL 44(SP), R9 - ROLL $+1, R9 - MOVL R9, 36(SP) - - // FUNC2 - MOVL R13, R15 - XORL R14, R15 - XORL R10, R15 - - // MIX - ROLL $+30, R13 - ADDL R15, R11 - MOVL R12, R8 - ROLL $+5, R8 - LEAL 3395469782(R11)(R9*1), R11 - ADDL R8, R11 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 36(SP), R9 - MOVL R9, 292(R8) - - // ROUND4(74) - // SHUFFLE - MOVL 40(SP), R9 - XORL 28(SP), R9 - XORL 8(SP), R9 - XORL 48(SP), R9 - ROLL $+1, R9 - MOVL R9, 40(SP) - - // FUNC2 - MOVL R12, R15 - XORL R13, R15 - XORL R14, R15 - - // MIX - ROLL $+30, R12 - ADDL R15, R10 - MOVL R11, R8 - ROLL $+5, R8 - LEAL 3395469782(R10)(R9*1), R10 - ADDL R8, R10 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 40(SP), R9 - MOVL R9, 296(R8) - - // ROUND4(75) - // SHUFFLE - MOVL 44(SP), R9 - XORL 32(SP), R9 - XORL 12(SP), R9 - XORL 52(SP), R9 - ROLL $+1, R9 - MOVL R9, 44(SP) - - // FUNC2 - MOVL R11, R15 - XORL R12, R15 - XORL R13, R15 - - // MIX - ROLL $+30, R11 - ADDL R15, R14 - MOVL R10, R8 - ROLL $+5, R8 - LEAL 3395469782(R14)(R9*1), R14 - ADDL R8, R14 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 44(SP), R9 - MOVL R9, 300(R8) - - // ROUND4(76) - // SHUFFLE - MOVL 48(SP), R9 - XORL 36(SP), R9 - XORL 16(SP), R9 - XORL 56(SP), R9 - ROLL $+1, R9 - MOVL R9, 48(SP) - - // FUNC2 - MOVL R10, R15 - XORL R11, R15 - XORL R12, R15 - - // MIX - ROLL $+30, R10 - ADDL R15, R13 - MOVL R14, R8 - ROLL $+5, R8 - LEAL 3395469782(R13)(R9*1), R13 - ADDL R8, R13 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 48(SP), R9 - MOVL R9, 304(R8) - - // ROUND4(77) - // SHUFFLE - MOVL 52(SP), R9 - XORL 40(SP), R9 - XORL 20(SP), R9 - XORL 60(SP), R9 - ROLL $+1, R9 - MOVL R9, 52(SP) - - // FUNC2 - MOVL R14, R15 - XORL R10, R15 - XORL R11, R15 - - // MIX - ROLL $+30, R14 - ADDL R15, R12 - MOVL R13, R8 - ROLL $+5, R8 - LEAL 3395469782(R12)(R9*1), R12 - ADDL R8, R12 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 52(SP), R9 - MOVL R9, 308(R8) - - // ROUND4(78) - // SHUFFLE - MOVL 56(SP), R9 - XORL 44(SP), R9 - XORL 24(SP), R9 - XORL (SP), R9 - ROLL $+1, R9 - MOVL R9, 56(SP) - - // FUNC2 - MOVL R13, R15 - XORL R14, R15 - XORL R10, R15 - - // MIX - ROLL $+30, R13 - ADDL R15, R11 - MOVL R12, R8 - ROLL $+5, R8 - LEAL 3395469782(R11)(R9*1), R11 - ADDL R8, R11 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 56(SP), R9 - MOVL R9, 312(R8) - - // ROUND4(79) - // SHUFFLE - MOVL 60(SP), R9 - XORL 48(SP), R9 - XORL 28(SP), R9 - XORL 4(SP), R9 - ROLL $+1, R9 - MOVL R9, 60(SP) - - // FUNC2 - MOVL R12, R15 - XORL R13, R15 - XORL R14, R15 - - // MIX - ROLL $+30, R12 - ADDL R15, R10 - MOVL R11, R8 - ROLL $+5, R8 - LEAL 3395469782(R10)(R9*1), R10 - ADDL R8, R10 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 60(SP), R9 - MOVL R9, 316(R8) - - // Add registers to temp hash. - ADDL R10, AX - ADDL R11, BX - ADDL R12, CX - ADDL R13, DX - ADDL R14, BP - ADDQ $+64, DI - CMPQ DI, SI - JB loop - -end: - MOVQ dig+0(FP), SI - MOVL AX, (SI) - MOVL BX, 4(SI) - MOVL CX, 8(SI) - MOVL DX, 12(SI) - MOVL BP, 16(SI) + // Save ABCD and E working values + VMOVDQA X5, (AX) + VMOVDQA X0, 16(AX) + + // LOAD CS 0 + VPEXTRD $3, X5, R12 + LOADCS(X0, R12, 0, R15) + + // Rounds 0-3 + VMOVDQU (SI), X1 + PSHUFB X7, X1 + PADDD X1, X5 + VMOVDQA X0, X6 + SHA1RNDS4 $0x00, X5, X0 + LOADM1(X1, 0, R13) + + // Rounds 4-7 + VMOVDQU 16(SI), X2 + PSHUFB X7, X2 + SHA1NEXTE X2, X6 + VMOVDQA X0, X5 + SHA1RNDS4 $0x00, X6, X0 + SHA1MSG1 X2, X1 + LOADM1(X2, 1, R13) + + // Rounds 8-11 + VMOVDQU 32(SI), X3 + PSHUFB X7, X3 + SHA1NEXTE X3, X5 + VMOVDQA X0, X6 + SHA1RNDS4 $0x00, X5, X0 + SHA1MSG1 X3, X2 + PXOR X3, X1 + LOADM1(X3, 2, R13) + + // Rounds 12-15 + VMOVDQU 48(SI), X4 + PSHUFB X7, X4 + SHA1NEXTE X4, X6 + VMOVDQA X0, X5 + SHA1MSG2 X4, X1 + SHA1RNDS4 $0x00, X6, X0 + SHA1MSG1 X4, X3 + PXOR X4, X2 + LOADM1(X4, 3, R13) + + // Rounds 16-19 + SHA1NEXTE X1, X5 + VMOVDQA X0, X6 + SHA1MSG2 X1, X2 + SHA1RNDS4 $0x00, X5, X0 + SHA1MSG1 X1, X4 + PXOR X1, X3 + LOADM1(X1, 4, R13) + + // Rounds 20-23 + SHA1NEXTE X2, X6 + VMOVDQA X0, X5 + SHA1MSG2 X2, X3 + SHA1RNDS4 $0x01, X6, X0 + SHA1MSG1 X2, X1 + PXOR X2, X4 + LOADM1(X2, 5, R13) + + // Rounds 24-27 + SHA1NEXTE X3, X5 + VMOVDQA X0, X6 + SHA1MSG2 X3, X4 + SHA1RNDS4 $0x01, X5, X0 + SHA1MSG1 X3, X2 + PXOR X3, X1 + LOADM1(X3, 6, R13) + + // Rounds 28-31 + SHA1NEXTE X4, X6 + VMOVDQA X0, X5 + SHA1MSG2 X4, X1 + SHA1RNDS4 $0x01, X6, X0 + SHA1MSG1 X4, X3 + PXOR X4, X2 + LOADM1(X4, 7, R13) + + // Rounds 32-35 + SHA1NEXTE X1, X5 + VMOVDQA X0, X6 + SHA1MSG2 X1, X2 + SHA1RNDS4 $0x01, X5, X0 + SHA1MSG1 X1, X4 + PXOR X1, X3 + LOADM1(X1, 8, R13) + + // Rounds 36-39 + SHA1NEXTE X2, X6 + VMOVDQA X0, X5 + SHA1MSG2 X2, X3 + SHA1RNDS4 $0x01, X6, X0 + SHA1MSG1 X2, X1 + PXOR X2, X4 + LOADM1(X2, 9, R13) + + // Rounds 40-43 + SHA1NEXTE X3, X5 + VMOVDQA X0, X6 + SHA1MSG2 X3, X4 + SHA1RNDS4 $0x02, X5, X0 + SHA1MSG1 X3, X2 + PXOR X3, X1 + LOADM1(X3, 10, R13) + + // Rounds 44-47 + SHA1NEXTE X4, X6 + VMOVDQA X0, X5 + SHA1MSG2 X4, X1 + SHA1RNDS4 $0x02, X6, X0 + SHA1MSG1 X4, X3 + PXOR X4, X2 + LOADM1(X4, 11, R13) + + // Rounds 48-51 + SHA1NEXTE X1, X5 + VMOVDQA X0, X6 + SHA1MSG2 X1, X2 + SHA1RNDS4 $0x02, X5, X0 + VPEXTRD $0, X5, R12 + SHA1MSG1 X1, X4 + PXOR X1, X3 + LOADM1(X1, 12, R13) + + // derive pre-round 56's E out of round 51's A. + VPEXTRD $3, X0, R12 + ROLL $30, R12 + + // Rounds 52-55 + SHA1NEXTE X2, X6 + VMOVDQA X0, X5 + SHA1MSG2 X2, X3 + SHA1RNDS4 $0x02, X6, X0 + SHA1MSG1 X2, X1 + PXOR X2, X4 + LOADM1(X2, 13, R13) + + // LOAD CS 58 (gathers 56 which will be rectified in Go) + LOADCS(X0, R12, 1, R15) + + // Rounds 56-59 + SHA1NEXTE X3, X5 + VMOVDQA X0, X6 + SHA1MSG2 X3, X4 + SHA1RNDS4 $0x02, X5, X0 + VPEXTRD $0, X5, R12 + SHA1MSG1 X3, X2 + PXOR X3, X1 + LOADM1(X3, 14, R13) + + // derive pre-round 64's E out of round 59's A. + VPEXTRD $3, X0, R12 + ROLL $30, R12 + + // Rounds 60-63 + SHA1NEXTE X4, X6 + VMOVDQA X0, X5 + SHA1MSG2 X4, X1 + SHA1RNDS4 $0x03, X6, X0 + SHA1MSG1 X4, X3 + PXOR X4, X2 + LOADM1(X4, 15, R13) + + // LOAD CS 65 (gathers 64 which will be rectified in Go) + LOADCS(X0, R12, 2, R15) + + // Rounds 64-67 + SHA1NEXTE X1, X5 + VMOVDQA X0, X6 + SHA1MSG2 X1, X2 + SHA1RNDS4 $0x03, X5, X0 + SHA1MSG1 X1, X4 + PXOR X1, X3 + LOADM1(X1, 16, R13) + + // Rounds 68-71 + SHA1NEXTE X2, X6 + VMOVDQA X0, X5 + SHA1MSG2 X2, X3 + SHA1RNDS4 $0x03, X6, X0 + PXOR X2, X4 + LOADM1(X2, 17, R13) + + // Rounds 72-75 + SHA1NEXTE X3, X5 + VMOVDQA X0, X6 + SHA1MSG2 X3, X4 + SHA1RNDS4 $0x03, X5, X0 + LOADM1(X3, 18, R13) + + // Rounds 76-79 + SHA1NEXTE X4, X6 + VMOVDQA X0, X5 + SHA1RNDS4 $0x03, X6, X0 + LOADM1(X4, 19, R13) + + // Add saved E and ABCD + SHA1NEXTE (AX), X5 + PADDD 16(AX), X0 + + // Check if we are done, if not return to the loop + ADDQ $0x40, SI + CMPQ SI, DX + JNE loop + + // Write the hash state back to digest + PSHUFD $0x1b, X0, X0 + VMOVDQU X0, (DI) + PEXTRD $0x03, X5, 16(DI) + +done: RET + +DATA upper_mask<>+0(SB)/8, $0x0000000000000000 +DATA upper_mask<>+8(SB)/8, $0xffffffff00000000 +GLOBL upper_mask<>(SB), RODATA, $16 + +DATA shuffle_mask<>+0(SB)/8, $0x08090a0b0c0d0e0f +DATA shuffle_mask<>+8(SB)/8, $0x0001020304050607 +GLOBL shuffle_mask<>(SB), RODATA, $16 diff --git a/vendor/github.com/pjbgf/sha1cd/sha1cdblock_arm64.go b/vendor/github.com/pjbgf/sha1cd/sha1cdblock_arm64.go new file mode 100644 index 000000000..f44f22da4 --- /dev/null +++ b/vendor/github.com/pjbgf/sha1cd/sha1cdblock_arm64.go @@ -0,0 +1,48 @@ +//go:build !noasm && gc && arm64 && !amd64 +// +build !noasm,gc,arm64,!amd64 + +package sha1cd + +import ( + "runtime" + + "github.com/klauspost/cpuid/v2" + shared "github.com/pjbgf/sha1cd/internal" +) + +var hasSHA1 = (runtime.GOARCH == "arm64" && cpuid.CPU.Supports(cpuid.SHA1)) + +// blockARM64 hashes the message p into the current state in h. +// Both m1 and cs are used to store intermediate results which are used by the collision detection logic. +// +//go:noescape +func blockARM64(h []uint32, p []byte, m1 []uint32, cs [][5]uint32) + +func block(dig *digest, p []byte) { + if forceGeneric || !hasSHA1 { + blockGeneric(dig, p) + return + } + + m1 := [shared.Rounds]uint32{} + cs := [shared.PreStepState][shared.WordBuffers]uint32{} + + for len(p) >= shared.Chunk { + // The assembly code only supports processing a block at a time, + // so adjust the chunk accordingly. + chunk := p[:shared.Chunk] + + blockARM64(dig.h[:], chunk, m1[:], cs[:]) + + rectifyCompressionState(&m1, &cs) + col := checkCollision(&m1, &cs, &dig.h) + if col { + dig.col = true + + blockARM64(dig.h[:], chunk, m1[:], cs[:]) + blockARM64(dig.h[:], chunk, m1[:], cs[:]) + } + + p = p[shared.Chunk:] + } +} diff --git a/vendor/github.com/pjbgf/sha1cd/sha1cdblock_arm64.s b/vendor/github.com/pjbgf/sha1cd/sha1cdblock_arm64.s new file mode 100644 index 000000000..63762049a --- /dev/null +++ b/vendor/github.com/pjbgf/sha1cd/sha1cdblock_arm64.s @@ -0,0 +1,249 @@ +//go:build !noasm && gc && arm64 && !amd64 + +#include "textflag.h" + +// License information for the original SHA1 arm64 implemention: +// Copyright 2017 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found at: +// - https://github.com/golang/go/blob/master/LICENSE +// +// Reference implementations: +// - https://github.com/noloader/SHA-Intrinsics/blob/master/sha1-arm.c +// - https://github.com/golang/go/blob/master/src/crypto/sha1/sha1block_arm64.s + +#define HASHUPDATECHOOSE \ + SHA1C V16.S4, V1, V2 \ + SHA1H V3, V1 \ + VMOV V2.B16, V3.B16 + +#define HASHUPDATEPARITY \ + SHA1P V16.S4, V1, V2 \ + SHA1H V3, V1 \ + VMOV V2.B16, V3.B16 + +#define HASHUPDATEMAJ \ + SHA1M V16.S4, V1, V2 \ + SHA1H V3, V1 \ + VMOV V2.B16, V3.B16 + +// func blockARM64(h []uint32, p []byte, m1 []uint32, cs [][5]uint32) +TEXT ·blockARM64(SB), NOSPLIT, $80-96 + MOVD h_base+0(FP), R0 + MOVD p_base+24(FP), R1 + MOVD p_len+32(FP), R2 + MOVD m1_base+48(FP), R3 + MOVD cs_base+72(FP), R4 + + LSR $6, R2, R2 + LSL $6, R2, R2 + ADD R16, R2, R21 + + VLD1.P 16(R0), [V0.S4] + FMOVS (R0), F20 + SUB $16, R0, R0 + +loop: + CMP R16, R21 + BLS end + + // Load block (p) into 16-bytes vectors. + VLD1.P 16(R1), [V4.B16] + VLD1.P 16(R1), [V5.B16] + VLD1.P 16(R1), [V6.B16] + VLD1.P 16(R1), [V7.B16] + + // Load K constants to V19 + MOVD $·sha1Ks(SB), R22 + VLD1 (R22), [V19.S4] + + VMOV V0.B16, V2.B16 + VMOV V20.S[0], V1 + VMOV V2.B16, V3.B16 + VDUP V19.S[0], V17.S4 + + // Little Endian + VREV32 V4.B16, V4.B16 + VREV32 V5.B16, V5.B16 + VREV32 V6.B16, V6.B16 + VREV32 V7.B16, V7.B16 + + // LOAD M1 rounds 0-15 + VST1.P [V4.S4], (R3) + VST1.P [V5.S4], (R3) + VST1.P [V6.S4], (R3) + VST1.P [V7.S4], (R3) + + // LOAD CS 0 + VST1.P [V0.S4], (R4) // ABCD pre-round 0 + VST1.P V1.S[0], 4(R4) // E pre-round 0 + + // Rounds 0-3 + VDUP V19.S[1], V18.S4 + VADD V17.S4, V4.S4, V16.S4 + SHA1SU0 V6.S4, V5.S4, V4.S4 + HASHUPDATECHOOSE + SHA1SU1 V7.S4, V4.S4 + + // Rounds 4-7 + VADD V17.S4, V5.S4, V16.S4 + SHA1SU0 V7.S4, V6.S4, V5.S4 + HASHUPDATECHOOSE + SHA1SU1 V4.S4, V5.S4 + // LOAD M1 rounds 16-19 + VST1.P [V4.S4], (R3) + + // Rounds 8-11 + VADD V17.S4, V6.S4, V16.S4 + SHA1SU0 V4.S4, V7.S4, V6.S4 + HASHUPDATECHOOSE + SHA1SU1 V5.S4, V6.S4 + // LOAD M1 rounds 20-23 + VST1.P [V5.S4], (R3) + + // Rounds 12-15 + VADD V17.S4, V7.S4, V16.S4 + SHA1SU0 V5.S4, V4.S4, V7.S4 + HASHUPDATECHOOSE + SHA1SU1 V6.S4, V7.S4 + // LOAD M1 rounds 24-27 + VST1.P [V6.S4], (R3) + + // Rounds 16-19 + VADD V17.S4, V4.S4, V16.S4 + SHA1SU0 V6.S4, V5.S4, V4.S4 + HASHUPDATECHOOSE + SHA1SU1 V7.S4, V4.S4 + // LOAD M1 rounds 28-31 + VST1.P [V7.S4], (R3) + + // Rounds 20-23 + VDUP V19.S[2], V17.S4 + VADD V18.S4, V5.S4, V16.S4 + SHA1SU0 V7.S4, V6.S4, V5.S4 + HASHUPDATEPARITY + SHA1SU1 V4.S4, V5.S4 + // LOAD M1 rounds 32-35 + VST1.P [V4.S4], (R3) + + // Rounds 24-27 + VADD V18.S4, V6.S4, V16.S4 + SHA1SU0 V4.S4, V7.S4, V6.S4 + HASHUPDATEPARITY + SHA1SU1 V5.S4, V6.S4 + // LOAD M1 rounds 36-39 + VST1.P [V5.S4], (R3) + + // Rounds 28-31 + VADD V18.S4, V7.S4, V16.S4 + SHA1SU0 V5.S4, V4.S4, V7.S4 + HASHUPDATEPARITY + SHA1SU1 V6.S4, V7.S4 + // LOAD M1 rounds 40-43 + VST1.P [V6.S4], (R3) + + // Rounds 32-35 + VADD V18.S4, V4.S4, V16.S4 + SHA1SU0 V6.S4, V5.S4, V4.S4 + HASHUPDATEPARITY + SHA1SU1 V7.S4, V4.S4 + // LOAD M1 rounds 44-47 + VST1.P [V7.S4], (R3) + + // Rounds 36-39 + VADD V18.S4, V5.S4, V16.S4 + SHA1SU0 V7.S4, V6.S4, V5.S4 + HASHUPDATEPARITY + SHA1SU1 V4.S4, V5.S4 + // LOAD M1 rounds 48-51 + VST1.P [V4.S4], (R3) + + // Rounds 44-47 + VDUP V19.S[3], V18.S4 + VADD V17.S4, V6.S4, V16.S4 + SHA1SU0 V4.S4, V7.S4, V6.S4 + HASHUPDATEMAJ + SHA1SU1 V5.S4, V6.S4 + // LOAD M1 rounds 52-55 + VST1.P [V5.S4], (R3) + + // Rounds 44-47 + VADD V17.S4, V7.S4, V16.S4 + SHA1SU0 V5.S4, V4.S4, V7.S4 + HASHUPDATEMAJ + SHA1SU1 V6.S4, V7.S4 + // LOAD M1 rounds 56-59 + VST1.P [V6.S4], (R3) + + // Rounds 48-51 + VADD V17.S4, V4.S4, V16.S4 + SHA1SU0 V6.S4, V5.S4, V4.S4 + HASHUPDATEMAJ + SHA1SU1 V7.S4, V4.S4 + // LOAD M1 rounds 60-63 + VST1.P [V7.S4], (R3) + + // Rounds 52-55 + VADD V17.S4, V5.S4, V16.S4 + SHA1SU0 V7.S4, V6.S4, V5.S4 + HASHUPDATEMAJ + SHA1SU1 V4.S4, V5.S4 + + // LOAD CS 58 + VST1.P [V3.S4], (R4) // ABCD pre-round 56 + VST1.P V1.S[0], 4(R4) // E pre-round 56 + + // Rounds 56-59 + VADD V17.S4, V6.S4, V16.S4 + SHA1SU0 V4.S4, V7.S4, V6.S4 + HASHUPDATEMAJ + SHA1SU1 V5.S4, V6.S4 + + // Rounds 60-63 + VADD V18.S4, V7.S4, V16.S4 + SHA1SU0 V5.S4, V4.S4, V7.S4 + HASHUPDATEPARITY + SHA1SU1 V6.S4, V7.S4 + + // LOAD CS 65 + VST1.P [V3.S4], (R4) // ABCD pre-round 64 + VST1.P V1.S[0], 4(R4) // E pre-round 64 + + // Rounds 64-67 + VADD V18.S4, V4.S4, V16.S4 + HASHUPDATEPARITY + + // LOAD M1 rounds 68-79 + VST1.P [V4.S4], (R3) + VST1.P [V5.S4], (R3) + VST1.P [V6.S4], (R3) + VST1.P [V7.S4], (R3) + + // Rounds 68-71 + VADD V18.S4, V5.S4, V16.S4 + HASHUPDATEPARITY + + // Rounds 72-75 + VADD V18.S4, V6.S4, V16.S4 + HASHUPDATEPARITY + + // Rounds 76-79 + VADD V18.S4, V7.S4, V16.S4 + HASHUPDATEPARITY + + // Add working registers to hash state. + VADD V2.S4, V0.S4, V0.S4 + VADD V1.S4, V20.S4, V20.S4 + +end: + // Update h with final hash values. + VST1.P [V0.S4], (R0) + FMOVS F20, (R0) + + RET + +DATA ·sha1Ks+0(SB)/4, $0x5A827999 // K0 +DATA ·sha1Ks+4(SB)/4, $0x6ED9EBA1 // K1 +DATA ·sha1Ks+8(SB)/4, $0x8F1BBCDC // K2 +DATA ·sha1Ks+12(SB)/4, $0xCA62C1D6 // K3 +GLOBL ·sha1Ks(SB), RODATA, $16 diff --git a/vendor/github.com/pjbgf/sha1cd/sha1cdblock_generic.go b/vendor/github.com/pjbgf/sha1cd/sha1cdblock_generic.go index ba8b96e87..a80148eb9 100644 --- a/vendor/github.com/pjbgf/sha1cd/sha1cdblock_generic.go +++ b/vendor/github.com/pjbgf/sha1cd/sha1cdblock_generic.go @@ -15,6 +15,8 @@ import ( "github.com/pjbgf/sha1cd/ubc" ) +var forceGeneric bool + // blockGeneric is a portable, pure Go version of the SHA-1 block step. // It's used by sha1block_generic.go and tests. func blockGeneric(dig *digest, p []byte) { @@ -125,7 +127,8 @@ func blockGeneric(dig *digest, p []byte) { } if hi == 1 { - col := checkCollision(m1, cs, [shared.WordBuffers]uint32{h0, h1, h2, h3, h4}) + h := [shared.WordBuffers]uint32{h0, h1, h2, h3, h4} + col := checkCollision(&m1, &cs, &h) if col { dig.col = true hi++ @@ -139,24 +142,25 @@ func blockGeneric(dig *digest, p []byte) { dig.h[0], dig.h[1], dig.h[2], dig.h[3], dig.h[4] = h0, h1, h2, h3, h4 } +//go:noinline func checkCollision( - m1 [shared.Rounds]uint32, - cs [shared.PreStepState][shared.WordBuffers]uint32, - state [shared.WordBuffers]uint32) bool { - + m1 *[shared.Rounds]uint32, + cs *[shared.PreStepState][shared.WordBuffers]uint32, + h *[shared.WordBuffers]uint32, +) bool { if mask := ubc.CalculateDvMask(m1); mask != 0 { dvs := ubc.SHA1_dvs() for i := 0; dvs[i].DvType != 0; i++ { if (mask & ((uint32)(1) << uint32(dvs[i].MaskB))) != 0 { - var csState [shared.WordBuffers]uint32 + var csState *[shared.WordBuffers]uint32 switch dvs[i].TestT { case 58: - csState = cs[1] + csState = &cs[1] case 65: - csState = cs[2] + csState = &cs[2] case 0: - csState = cs[0] + csState = &cs[0] default: panic(fmt.Sprintf("dvs data is trying to use a testT that isn't available: %d", dvs[i].TestT)) } @@ -165,9 +169,9 @@ func checkCollision( dvs[i].TestT, // testT is the step number // m2 is a secondary message created XORing with // ubc's DM prior to the SHA recompression step. - m1, dvs[i].Dm, + m1, &dvs[i].Dm, csState, - state) + h) if col { return true @@ -178,8 +182,9 @@ func checkCollision( return false } -func hasCollided(step uint32, m1, dm [shared.Rounds]uint32, - state [shared.WordBuffers]uint32, h [shared.WordBuffers]uint32) bool { +//go:nosplit +func hasCollided(step uint32, m1, dm *[shared.Rounds]uint32, + state *[shared.WordBuffers]uint32, h *[shared.WordBuffers]uint32) bool { // Intermediary Hash Value. ihv := [shared.WordBuffers]uint32{} @@ -266,3 +271,42 @@ func hasCollided(step uint32, m1, dm [shared.Rounds]uint32, return false } + +// rectifyCompressionState fixes the compression state when using the +// SIMD implementations. +// +// Due to the way that hardware acceleration works, the rounds +// are executed 4 at a time. Therefore, the state for cs58 and cs65 +// are not available directly through the assembly logic. The states +// returned are for cs56 and cs64. This function updates indexes 1 and 2 +// of cs to contain the respective CS values for rounds 58 and 65. +// +//go:nosplit +func rectifyCompressionState( + m1 *[shared.Rounds]uint32, + cs *[shared.PreStepState][shared.WordBuffers]uint32, +) { + if cs == nil { + return + } + + func3 := func(state [shared.WordBuffers]uint32, i int) [shared.WordBuffers]uint32 { + a, b, c, d, e := state[0], state[1], state[2], state[3], state[4] + + f := ((b | c) & d) | (b & c) + t := bits.RotateLeft32(a, 5) + f + e + m1[i] + shared.K2 + a, b, c, d, e = t, a, bits.RotateLeft32(b, 30), c, d + return [shared.WordBuffers]uint32{a, b, c, d, e} + } + func4 := func(state [shared.WordBuffers]uint32, i int) [shared.WordBuffers]uint32 { + a, b, c, d, e := state[0], state[1], state[2], state[3], state[4] + f := b ^ c ^ d + t := bits.RotateLeft32(a, 5) + f + e + m1[i] + shared.K3 + a, b, c, d, e = t, a, bits.RotateLeft32(b, 30), c, d + return [shared.WordBuffers]uint32{a, b, c, d, e} + } + + cs57 := func3(cs[1], 56) + cs[1] = func3(cs57, 57) + cs[2] = func4(cs[2], 64) +} diff --git a/vendor/github.com/pjbgf/sha1cd/sha1cdblock_noasm.go b/vendor/github.com/pjbgf/sha1cd/sha1cdblock_noasm.go index 15bae5a7e..4444c7531 100644 --- a/vendor/github.com/pjbgf/sha1cd/sha1cdblock_noasm.go +++ b/vendor/github.com/pjbgf/sha1cd/sha1cdblock_noasm.go @@ -1,5 +1,4 @@ -//go:build !amd64 || noasm || !gc -// +build !amd64 noasm !gc +//go:build (!amd64 && !arm64) || noasm package sha1cd diff --git a/vendor/github.com/pjbgf/sha1cd/ubc/ubc.go b/vendor/github.com/pjbgf/sha1cd/ubc/ubc.go index b0b4d76e3..bd932051b 100644 --- a/vendor/github.com/pjbgf/sha1cd/ubc/ubc.go +++ b/vendor/github.com/pjbgf/sha1cd/ubc/ubc.go @@ -2,4 +2,375 @@ // Unavoidable Bit Conditions that arise from crypto analysis attacks. package ubc -//go:generate go run -C asm . -out ../ubc_amd64.s -pkg $GOPACKAGE +// Based on the C implementation from Marc Stevens and Dan Shumow. +// https://github.com/cr-marcstevens/sha1collisiondetection + +type DvInfo struct { + // DvType, DvK and DvB define the DV: I(K,B) or II(K,B) (see the paper). + // https://marc-stevens.nl/research/papers/C13-S.pdf + DvType uint32 + DvK uint32 + DvB uint32 + + // TestT is the step to do the recompression from for collision detection. + TestT uint32 + + // MaskI and MaskB define the bit to check for each DV in the dvmask returned by ubc_check. + MaskI uint32 + MaskB uint32 + + // Dm is the expanded message block XOR-difference defined by the DV. + Dm [80]uint32 +} + +// CalculateDvMask takes as input an expanded message block and +// verifies the unavoidable bitconditions for all listed DVs. It returns +// a dvmask where each bit belonging to a DV is set if all unavoidable +// bitconditions for that DV have been met. +// +//go:nosplit +func CalculateDvMask(W *[80]uint32) uint32 { + if W == nil { + return 0 + } + mask := uint32(0xFFFFFFFF) + mask &= (((((W[44] ^ W[45]) >> 29) & 1) - 1) | ^(DV_I_48_0_bit | DV_I_51_0_bit | DV_I_52_0_bit | DV_II_45_0_bit | DV_II_46_0_bit | DV_II_50_0_bit | DV_II_51_0_bit)) + mask &= (((((W[49] ^ W[50]) >> 29) & 1) - 1) | ^(DV_I_46_0_bit | DV_II_45_0_bit | DV_II_50_0_bit | DV_II_51_0_bit | DV_II_55_0_bit | DV_II_56_0_bit)) + mask &= (((((W[48] ^ W[49]) >> 29) & 1) - 1) | ^(DV_I_45_0_bit | DV_I_52_0_bit | DV_II_49_0_bit | DV_II_50_0_bit | DV_II_54_0_bit | DV_II_55_0_bit)) + mask &= ((((W[47] ^ (W[50] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_I_47_0_bit | DV_I_49_0_bit | DV_I_51_0_bit | DV_II_45_0_bit | DV_II_51_0_bit | DV_II_56_0_bit)) + mask &= (((((W[47] ^ W[48]) >> 29) & 1) - 1) | ^(DV_I_44_0_bit | DV_I_51_0_bit | DV_II_48_0_bit | DV_II_49_0_bit | DV_II_53_0_bit | DV_II_54_0_bit)) + mask &= (((((W[46] >> 4) ^ (W[49] >> 29)) & 1) - 1) | ^(DV_I_46_0_bit | DV_I_48_0_bit | DV_I_50_0_bit | DV_I_52_0_bit | DV_II_50_0_bit | DV_II_55_0_bit)) + mask &= (((((W[46] ^ W[47]) >> 29) & 1) - 1) | ^(DV_I_43_0_bit | DV_I_50_0_bit | DV_II_47_0_bit | DV_II_48_0_bit | DV_II_52_0_bit | DV_II_53_0_bit)) + mask &= (((((W[45] >> 4) ^ (W[48] >> 29)) & 1) - 1) | ^(DV_I_45_0_bit | DV_I_47_0_bit | DV_I_49_0_bit | DV_I_51_0_bit | DV_II_49_0_bit | DV_II_54_0_bit)) + mask &= (((((W[45] ^ W[46]) >> 29) & 1) - 1) | ^(DV_I_49_0_bit | DV_I_52_0_bit | DV_II_46_0_bit | DV_II_47_0_bit | DV_II_51_0_bit | DV_II_52_0_bit)) + mask &= (((((W[44] >> 4) ^ (W[47] >> 29)) & 1) - 1) | ^(DV_I_44_0_bit | DV_I_46_0_bit | DV_I_48_0_bit | DV_I_50_0_bit | DV_II_48_0_bit | DV_II_53_0_bit)) + mask &= (((((W[43] >> 4) ^ (W[46] >> 29)) & 1) - 1) | ^(DV_I_43_0_bit | DV_I_45_0_bit | DV_I_47_0_bit | DV_I_49_0_bit | DV_II_47_0_bit | DV_II_52_0_bit)) + mask &= (((((W[43] ^ W[44]) >> 29) & 1) - 1) | ^(DV_I_47_0_bit | DV_I_50_0_bit | DV_I_51_0_bit | DV_II_45_0_bit | DV_II_49_0_bit | DV_II_50_0_bit)) + mask &= (((((W[42] >> 4) ^ (W[45] >> 29)) & 1) - 1) | ^(DV_I_44_0_bit | DV_I_46_0_bit | DV_I_48_0_bit | DV_I_52_0_bit | DV_II_46_0_bit | DV_II_51_0_bit)) + mask &= (((((W[41] >> 4) ^ (W[44] >> 29)) & 1) - 1) | ^(DV_I_43_0_bit | DV_I_45_0_bit | DV_I_47_0_bit | DV_I_51_0_bit | DV_II_45_0_bit | DV_II_50_0_bit)) + mask &= (((((W[40] ^ W[41]) >> 29) & 1) - 1) | ^(DV_I_44_0_bit | DV_I_47_0_bit | DV_I_48_0_bit | DV_II_46_0_bit | DV_II_47_0_bit | DV_II_56_0_bit)) + mask &= (((((W[54] ^ W[55]) >> 29) & 1) - 1) | ^(DV_I_51_0_bit | DV_II_47_0_bit | DV_II_50_0_bit | DV_II_55_0_bit | DV_II_56_0_bit)) + mask &= (((((W[53] ^ W[54]) >> 29) & 1) - 1) | ^(DV_I_50_0_bit | DV_II_46_0_bit | DV_II_49_0_bit | DV_II_54_0_bit | DV_II_55_0_bit)) + mask &= (((((W[52] ^ W[53]) >> 29) & 1) - 1) | ^(DV_I_49_0_bit | DV_II_45_0_bit | DV_II_48_0_bit | DV_II_53_0_bit | DV_II_54_0_bit)) + mask &= ((((W[50] ^ (W[53] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_I_50_0_bit | DV_I_52_0_bit | DV_II_46_0_bit | DV_II_48_0_bit | DV_II_54_0_bit)) + mask &= (((((W[50] ^ W[51]) >> 29) & 1) - 1) | ^(DV_I_47_0_bit | DV_II_46_0_bit | DV_II_51_0_bit | DV_II_52_0_bit | DV_II_56_0_bit)) + mask &= ((((W[49] ^ (W[52] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_I_49_0_bit | DV_I_51_0_bit | DV_II_45_0_bit | DV_II_47_0_bit | DV_II_53_0_bit)) + mask &= ((((W[48] ^ (W[51] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_I_48_0_bit | DV_I_50_0_bit | DV_I_52_0_bit | DV_II_46_0_bit | DV_II_52_0_bit)) + mask &= (((((W[42] ^ W[43]) >> 29) & 1) - 1) | ^(DV_I_46_0_bit | DV_I_49_0_bit | DV_I_50_0_bit | DV_II_48_0_bit | DV_II_49_0_bit)) + mask &= (((((W[41] ^ W[42]) >> 29) & 1) - 1) | ^(DV_I_45_0_bit | DV_I_48_0_bit | DV_I_49_0_bit | DV_II_47_0_bit | DV_II_48_0_bit)) + mask &= (((((W[40] >> 4) ^ (W[43] >> 29)) & 1) - 1) | ^(DV_I_44_0_bit | DV_I_46_0_bit | DV_I_50_0_bit | DV_II_49_0_bit | DV_II_56_0_bit)) + mask &= (((((W[39] >> 4) ^ (W[42] >> 29)) & 1) - 1) | ^(DV_I_43_0_bit | DV_I_45_0_bit | DV_I_49_0_bit | DV_II_48_0_bit | DV_II_55_0_bit)) + + if (mask & (DV_I_44_0_bit | DV_I_48_0_bit | DV_II_47_0_bit | DV_II_54_0_bit | DV_II_56_0_bit)) != 0 { + mask &= (((((W[38] >> 4) ^ (W[41] >> 29)) & 1) - 1) | ^(DV_I_44_0_bit | DV_I_48_0_bit | DV_II_47_0_bit | DV_II_54_0_bit | DV_II_56_0_bit)) + } + mask &= (((((W[37] >> 4) ^ (W[40] >> 29)) & 1) - 1) | ^(DV_I_43_0_bit | DV_I_47_0_bit | DV_II_46_0_bit | DV_II_53_0_bit | DV_II_55_0_bit)) + if (mask & (DV_I_52_0_bit | DV_II_48_0_bit | DV_II_51_0_bit | DV_II_56_0_bit)) != 0 { + mask &= (((((W[55] ^ W[56]) >> 29) & 1) - 1) | ^(DV_I_52_0_bit | DV_II_48_0_bit | DV_II_51_0_bit | DV_II_56_0_bit)) + } + if (mask & (DV_I_52_0_bit | DV_II_48_0_bit | DV_II_50_0_bit | DV_II_56_0_bit)) != 0 { + mask &= ((((W[52] ^ (W[55] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_I_52_0_bit | DV_II_48_0_bit | DV_II_50_0_bit | DV_II_56_0_bit)) + } + if (mask & (DV_I_51_0_bit | DV_II_47_0_bit | DV_II_49_0_bit | DV_II_55_0_bit)) != 0 { + mask &= ((((W[51] ^ (W[54] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_I_51_0_bit | DV_II_47_0_bit | DV_II_49_0_bit | DV_II_55_0_bit)) + } + if (mask & (DV_I_48_0_bit | DV_II_47_0_bit | DV_II_52_0_bit | DV_II_53_0_bit)) != 0 { + mask &= (((((W[51] ^ W[52]) >> 29) & 1) - 1) | ^(DV_I_48_0_bit | DV_II_47_0_bit | DV_II_52_0_bit | DV_II_53_0_bit)) + } + if (mask & (DV_I_46_0_bit | DV_I_49_0_bit | DV_II_45_0_bit | DV_II_48_0_bit)) != 0 { + mask &= (((((W[36] >> 4) ^ (W[40] >> 29)) & 1) - 1) | ^(DV_I_46_0_bit | DV_I_49_0_bit | DV_II_45_0_bit | DV_II_48_0_bit)) + } + if (mask & (DV_I_52_0_bit | DV_II_48_0_bit | DV_II_49_0_bit)) != 0 { + mask &= ((0 - (((W[53] ^ W[56]) >> 29) & 1)) | ^(DV_I_52_0_bit | DV_II_48_0_bit | DV_II_49_0_bit)) + } + if (mask & (DV_I_50_0_bit | DV_II_46_0_bit | DV_II_47_0_bit)) != 0 { + mask &= ((0 - (((W[51] ^ W[54]) >> 29) & 1)) | ^(DV_I_50_0_bit | DV_II_46_0_bit | DV_II_47_0_bit)) + } + if (mask & (DV_I_49_0_bit | DV_I_51_0_bit | DV_II_45_0_bit)) != 0 { + mask &= ((0 - (((W[50] ^ W[52]) >> 29) & 1)) | ^(DV_I_49_0_bit | DV_I_51_0_bit | DV_II_45_0_bit)) + } + if (mask & (DV_I_48_0_bit | DV_I_50_0_bit | DV_I_52_0_bit)) != 0 { + mask &= ((0 - (((W[49] ^ W[51]) >> 29) & 1)) | ^(DV_I_48_0_bit | DV_I_50_0_bit | DV_I_52_0_bit)) + } + if (mask & (DV_I_47_0_bit | DV_I_49_0_bit | DV_I_51_0_bit)) != 0 { + mask &= ((0 - (((W[48] ^ W[50]) >> 29) & 1)) | ^(DV_I_47_0_bit | DV_I_49_0_bit | DV_I_51_0_bit)) + } + if (mask & (DV_I_46_0_bit | DV_I_48_0_bit | DV_I_50_0_bit)) != 0 { + mask &= ((0 - (((W[47] ^ W[49]) >> 29) & 1)) | ^(DV_I_46_0_bit | DV_I_48_0_bit | DV_I_50_0_bit)) + } + if (mask & (DV_I_45_0_bit | DV_I_47_0_bit | DV_I_49_0_bit)) != 0 { + mask &= ((0 - (((W[46] ^ W[48]) >> 29) & 1)) | ^(DV_I_45_0_bit | DV_I_47_0_bit | DV_I_49_0_bit)) + } + mask &= ((((W[45] ^ W[47]) & (1 << 6)) - (1 << 6)) | ^(DV_I_47_2_bit | DV_I_49_2_bit | DV_I_51_2_bit)) + if (mask & (DV_I_44_0_bit | DV_I_46_0_bit | DV_I_48_0_bit)) != 0 { + mask &= ((0 - (((W[45] ^ W[47]) >> 29) & 1)) | ^(DV_I_44_0_bit | DV_I_46_0_bit | DV_I_48_0_bit)) + } + mask &= (((((W[44] ^ W[46]) >> 6) & 1) - 1) | ^(DV_I_46_2_bit | DV_I_48_2_bit | DV_I_50_2_bit)) + if (mask & (DV_I_43_0_bit | DV_I_45_0_bit | DV_I_47_0_bit)) != 0 { + mask &= ((0 - (((W[44] ^ W[46]) >> 29) & 1)) | ^(DV_I_43_0_bit | DV_I_45_0_bit | DV_I_47_0_bit)) + } + mask &= ((0 - ((W[41] ^ (W[42] >> 5)) & (1 << 1))) | ^(DV_I_48_2_bit | DV_II_46_2_bit | DV_II_51_2_bit)) + mask &= ((0 - ((W[40] ^ (W[41] >> 5)) & (1 << 1))) | ^(DV_I_47_2_bit | DV_I_51_2_bit | DV_II_50_2_bit)) + if (mask & (DV_I_44_0_bit | DV_I_46_0_bit | DV_II_56_0_bit)) != 0 { + mask &= ((0 - (((W[40] ^ W[42]) >> 4) & 1)) | ^(DV_I_44_0_bit | DV_I_46_0_bit | DV_II_56_0_bit)) + } + mask &= ((0 - ((W[39] ^ (W[40] >> 5)) & (1 << 1))) | ^(DV_I_46_2_bit | DV_I_50_2_bit | DV_II_49_2_bit)) + if (mask & (DV_I_43_0_bit | DV_I_45_0_bit | DV_II_55_0_bit)) != 0 { + mask &= ((0 - (((W[39] ^ W[41]) >> 4) & 1)) | ^(DV_I_43_0_bit | DV_I_45_0_bit | DV_II_55_0_bit)) + } + if (mask & (DV_I_44_0_bit | DV_II_54_0_bit | DV_II_56_0_bit)) != 0 { + mask &= ((0 - (((W[38] ^ W[40]) >> 4) & 1)) | ^(DV_I_44_0_bit | DV_II_54_0_bit | DV_II_56_0_bit)) + } + if (mask & (DV_I_43_0_bit | DV_II_53_0_bit | DV_II_55_0_bit)) != 0 { + mask &= ((0 - (((W[37] ^ W[39]) >> 4) & 1)) | ^(DV_I_43_0_bit | DV_II_53_0_bit | DV_II_55_0_bit)) + } + mask &= ((0 - ((W[36] ^ (W[37] >> 5)) & (1 << 1))) | ^(DV_I_47_2_bit | DV_I_50_2_bit | DV_II_46_2_bit)) + if (mask & (DV_I_45_0_bit | DV_I_48_0_bit | DV_II_47_0_bit)) != 0 { + mask &= (((((W[35] >> 4) ^ (W[39] >> 29)) & 1) - 1) | ^(DV_I_45_0_bit | DV_I_48_0_bit | DV_II_47_0_bit)) + } + if (mask & (DV_I_48_0_bit | DV_II_48_0_bit)) != 0 { + mask &= ((0 - ((W[63] ^ (W[64] >> 5)) & (1 << 0))) | ^(DV_I_48_0_bit | DV_II_48_0_bit)) + } + if (mask & (DV_I_45_0_bit | DV_II_45_0_bit)) != 0 { + mask &= ((0 - ((W[63] ^ (W[64] >> 5)) & (1 << 1))) | ^(DV_I_45_0_bit | DV_II_45_0_bit)) + } + if (mask & (DV_I_47_0_bit | DV_II_47_0_bit)) != 0 { + mask &= ((0 - ((W[62] ^ (W[63] >> 5)) & (1 << 0))) | ^(DV_I_47_0_bit | DV_II_47_0_bit)) + } + if (mask & (DV_I_46_0_bit | DV_II_46_0_bit)) != 0 { + mask &= ((0 - ((W[61] ^ (W[62] >> 5)) & (1 << 0))) | ^(DV_I_46_0_bit | DV_II_46_0_bit)) + } + mask &= ((0 - ((W[61] ^ (W[62] >> 5)) & (1 << 2))) | ^(DV_I_46_2_bit | DV_II_46_2_bit)) + if (mask & (DV_I_45_0_bit | DV_II_45_0_bit)) != 0 { + mask &= ((0 - ((W[60] ^ (W[61] >> 5)) & (1 << 0))) | ^(DV_I_45_0_bit | DV_II_45_0_bit)) + } + if (mask & (DV_II_51_0_bit | DV_II_54_0_bit)) != 0 { + mask &= (((((W[58] ^ W[59]) >> 29) & 1) - 1) | ^(DV_II_51_0_bit | DV_II_54_0_bit)) + } + if (mask & (DV_II_50_0_bit | DV_II_53_0_bit)) != 0 { + mask &= (((((W[57] ^ W[58]) >> 29) & 1) - 1) | ^(DV_II_50_0_bit | DV_II_53_0_bit)) + } + if (mask & (DV_II_52_0_bit | DV_II_54_0_bit)) != 0 { + mask &= ((((W[56] ^ (W[59] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_II_52_0_bit | DV_II_54_0_bit)) + } + if (mask & (DV_II_51_0_bit | DV_II_52_0_bit)) != 0 { + mask &= ((0 - (((W[56] ^ W[59]) >> 29) & 1)) | ^(DV_II_51_0_bit | DV_II_52_0_bit)) + } + if (mask & (DV_II_49_0_bit | DV_II_52_0_bit)) != 0 { + mask &= (((((W[56] ^ W[57]) >> 29) & 1) - 1) | ^(DV_II_49_0_bit | DV_II_52_0_bit)) + } + if (mask & (DV_II_51_0_bit | DV_II_53_0_bit)) != 0 { + mask &= ((((W[55] ^ (W[58] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_II_51_0_bit | DV_II_53_0_bit)) + } + if (mask & (DV_II_50_0_bit | DV_II_52_0_bit)) != 0 { + mask &= ((((W[54] ^ (W[57] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_II_50_0_bit | DV_II_52_0_bit)) + } + if (mask & (DV_II_49_0_bit | DV_II_51_0_bit)) != 0 { + mask &= ((((W[53] ^ (W[56] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_II_49_0_bit | DV_II_51_0_bit)) + } + mask &= ((((W[51] ^ (W[50] >> 5)) & (1 << 1)) - (1 << 1)) | ^(DV_I_50_2_bit | DV_II_46_2_bit)) + mask &= ((((W[48] ^ W[50]) & (1 << 6)) - (1 << 6)) | ^(DV_I_50_2_bit | DV_II_46_2_bit)) + if (mask & (DV_I_51_0_bit | DV_I_52_0_bit)) != 0 { + mask &= ((0 - (((W[48] ^ W[55]) >> 29) & 1)) | ^(DV_I_51_0_bit | DV_I_52_0_bit)) + } + mask &= ((((W[47] ^ W[49]) & (1 << 6)) - (1 << 6)) | ^(DV_I_49_2_bit | DV_I_51_2_bit)) + mask &= ((((W[48] ^ (W[47] >> 5)) & (1 << 1)) - (1 << 1)) | ^(DV_I_47_2_bit | DV_II_51_2_bit)) + mask &= ((((W[46] ^ W[48]) & (1 << 6)) - (1 << 6)) | ^(DV_I_48_2_bit | DV_I_50_2_bit)) + mask &= ((((W[47] ^ (W[46] >> 5)) & (1 << 1)) - (1 << 1)) | ^(DV_I_46_2_bit | DV_II_50_2_bit)) + mask &= ((0 - ((W[44] ^ (W[45] >> 5)) & (1 << 1))) | ^(DV_I_51_2_bit | DV_II_49_2_bit)) + mask &= ((((W[43] ^ W[45]) & (1 << 6)) - (1 << 6)) | ^(DV_I_47_2_bit | DV_I_49_2_bit)) + mask &= (((((W[42] ^ W[44]) >> 6) & 1) - 1) | ^(DV_I_46_2_bit | DV_I_48_2_bit)) + mask &= ((((W[43] ^ (W[42] >> 5)) & (1 << 1)) - (1 << 1)) | ^(DV_II_46_2_bit | DV_II_51_2_bit)) + mask &= ((((W[42] ^ (W[41] >> 5)) & (1 << 1)) - (1 << 1)) | ^(DV_I_51_2_bit | DV_II_50_2_bit)) + mask &= ((((W[41] ^ (W[40] >> 5)) & (1 << 1)) - (1 << 1)) | ^(DV_I_50_2_bit | DV_II_49_2_bit)) + if (mask & (DV_I_52_0_bit | DV_II_51_0_bit)) != 0 { + mask &= ((((W[39] ^ (W[43] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_I_52_0_bit | DV_II_51_0_bit)) + } + if (mask & (DV_I_51_0_bit | DV_II_50_0_bit)) != 0 { + mask &= ((((W[38] ^ (W[42] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_I_51_0_bit | DV_II_50_0_bit)) + } + if (mask & (DV_I_48_2_bit | DV_I_51_2_bit)) != 0 { + mask &= ((0 - ((W[37] ^ (W[38] >> 5)) & (1 << 1))) | ^(DV_I_48_2_bit | DV_I_51_2_bit)) + } + if (mask & (DV_I_50_0_bit | DV_II_49_0_bit)) != 0 { + mask &= ((((W[37] ^ (W[41] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_I_50_0_bit | DV_II_49_0_bit)) + } + if (mask & (DV_II_52_0_bit | DV_II_54_0_bit)) != 0 { + mask &= ((0 - ((W[36] ^ W[38]) & (1 << 4))) | ^(DV_II_52_0_bit | DV_II_54_0_bit)) + } + mask &= ((0 - ((W[35] ^ (W[36] >> 5)) & (1 << 1))) | ^(DV_I_46_2_bit | DV_I_49_2_bit)) + if (mask & (DV_I_51_0_bit | DV_II_47_0_bit)) != 0 { + mask &= ((((W[35] ^ (W[39] >> 25)) & (1 << 3)) - (1 << 3)) | ^(DV_I_51_0_bit | DV_II_47_0_bit)) + } + + if mask != 0 { + if (mask & DV_I_43_0_bit) != 0 { + if not((W[61]^(W[62]>>5))&(1<<1)) != 0 || + not(not((W[59]^(W[63]>>25))&(1<<5))) != 0 || + not((W[58]^(W[63]>>30))&(1<<0)) != 0 { + mask &= ^DV_I_43_0_bit + } + } + if (mask & DV_I_44_0_bit) != 0 { + if not((W[62]^(W[63]>>5))&(1<<1)) != 0 || + not(not((W[60]^(W[64]>>25))&(1<<5))) != 0 || + not((W[59]^(W[64]>>30))&(1<<0)) != 0 { + mask &= ^DV_I_44_0_bit + } + } + if (mask & DV_I_46_2_bit) != 0 { + mask &= ((^((W[40] ^ W[42]) >> 2)) | ^DV_I_46_2_bit) + } + if (mask & DV_I_47_2_bit) != 0 { + if not((W[62]^(W[63]>>5))&(1<<2)) != 0 || + not(not((W[41]^W[43])&(1<<6))) != 0 { + mask &= ^DV_I_47_2_bit + } + } + if (mask & DV_I_48_2_bit) != 0 { + if not((W[63]^(W[64]>>5))&(1<<2)) != 0 || + not(not((W[48]^(W[49]<<5))&(1<<6))) != 0 { + mask &= ^DV_I_48_2_bit + } + } + if (mask & DV_I_49_2_bit) != 0 { + if not(not((W[49]^(W[50]<<5))&(1<<6))) != 0 || + not((W[42]^W[50])&(1<<1)) != 0 || + not(not((W[39]^(W[40]<<5))&(1<<6))) != 0 || + not((W[38]^W[40])&(1<<1)) != 0 { + mask &= ^DV_I_49_2_bit + } + } + if (mask & DV_I_50_0_bit) != 0 { + mask &= (((W[36] ^ W[37]) << 7) | ^DV_I_50_0_bit) + } + if (mask & DV_I_50_2_bit) != 0 { + mask &= (((W[43] ^ W[51]) << 11) | ^DV_I_50_2_bit) + } + if (mask & DV_I_51_0_bit) != 0 { + mask &= (((W[37] ^ W[38]) << 9) | ^DV_I_51_0_bit) + } + if (mask & DV_I_51_2_bit) != 0 { + if not(not((W[51]^(W[52]<<5))&(1<<6))) != 0 || + not(not((W[49]^W[51])&(1<<6))) != 0 || + not(not((W[37]^(W[37]>>5))&(1<<1))) != 0 || + not(not((W[35]^(W[39]>>25))&(1<<5))) != 0 { + mask &= ^DV_I_51_2_bit + } + } + if (mask & DV_I_52_0_bit) != 0 { + mask &= (((W[38] ^ W[39]) << 11) | ^DV_I_52_0_bit) + } + if (mask & DV_II_46_2_bit) != 0 { + mask &= (((W[47] ^ W[51]) << 17) | ^DV_II_46_2_bit) + } + if (mask & DV_II_48_0_bit) != 0 { + if not(not((W[36]^(W[40]>>25))&(1<<3))) != 0 || + not((W[35]^(W[40]<<2))&(1<<30)) != 0 { + mask &= ^DV_II_48_0_bit + } + } + if (mask & DV_II_49_0_bit) != 0 { + if not(not((W[37]^(W[41]>>25))&(1<<3))) != 0 || + not((W[36]^(W[41]<<2))&(1<<30)) != 0 { + mask &= ^DV_II_49_0_bit + } + } + if (mask & DV_II_49_2_bit) != 0 { + if not(not((W[53]^(W[54]<<5))&(1<<6))) != 0 || + not(not((W[51]^W[53])&(1<<6))) != 0 || + not((W[50]^W[54])&(1<<1)) != 0 || + not(not((W[45]^(W[46]<<5))&(1<<6))) != 0 || + not(not((W[37]^(W[41]>>25))&(1<<5))) != 0 || + not((W[36]^(W[41]>>30))&(1<<0)) != 0 { + mask &= ^DV_II_49_2_bit + } + } + if (mask & DV_II_50_0_bit) != 0 { + if not((W[55]^W[58])&(1<<29)) != 0 || + not(not((W[38]^(W[42]>>25))&(1<<3))) != 0 || + not((W[37]^(W[42]<<2))&(1<<30)) != 0 { + mask &= ^DV_II_50_0_bit + } + } + if (mask & DV_II_50_2_bit) != 0 { + if not(not((W[54]^(W[55]<<5))&(1<<6))) != 0 || + not(not((W[52]^W[54])&(1<<6))) != 0 || + not((W[51]^W[55])&(1<<1)) != 0 || + not((W[45]^W[47])&(1<<1)) != 0 || + not(not((W[38]^(W[42]>>25))&(1<<5))) != 0 || + not((W[37]^(W[42]>>30))&(1<<0)) != 0 { + mask &= ^DV_II_50_2_bit + } + } + if (mask & DV_II_51_0_bit) != 0 { + if not(not((W[39]^(W[43]>>25))&(1<<3))) != 0 || + not((W[38]^(W[43]<<2))&(1<<30)) != 0 { + mask &= ^DV_II_51_0_bit + } + } + if (mask & DV_II_51_2_bit) != 0 { + if not(not((W[55]^(W[56]<<5))&(1<<6))) != 0 || + not(not((W[53]^W[55])&(1<<6))) != 0 || + not((W[52]^W[56])&(1<<1)) != 0 || + not((W[46]^W[48])&(1<<1)) != 0 || + not(not((W[39]^(W[43]>>25))&(1<<5))) != 0 || + not((W[38]^(W[43]>>30))&(1<<0)) != 0 { + mask &= ^DV_II_51_2_bit + } + } + if (mask & DV_II_52_0_bit) != 0 { + if not(not((W[59]^W[60])&(1<<29))) != 0 || + not(not((W[40]^(W[44]>>25))&(1<<3))) != 0 || + not(not((W[40]^(W[44]>>25))&(1<<4))) != 0 || + not((W[39]^(W[44]<<2))&(1<<30)) != 0 { + mask &= ^DV_II_52_0_bit + } + } + if (mask & DV_II_53_0_bit) != 0 { + if not((W[58]^W[61])&(1<<29)) != 0 || + not(not((W[57]^(W[61]>>25))&(1<<4))) != 0 || + not(not((W[41]^(W[45]>>25))&(1<<3))) != 0 || + not(not((W[41]^(W[45]>>25))&(1<<4))) != 0 { + mask &= ^DV_II_53_0_bit + } + } + if (mask & DV_II_54_0_bit) != 0 { + if not(not((W[58]^(W[62]>>25))&(1<<4))) != 0 || + not(not((W[42]^(W[46]>>25))&(1<<3))) != 0 || + not(not((W[42]^(W[46]>>25))&(1<<4))) != 0 { + mask &= ^DV_II_54_0_bit + } + } + if (mask & DV_II_55_0_bit) != 0 { + if not(not((W[59]^(W[63]>>25))&(1<<4))) != 0 || + not(not((W[57]^(W[59]>>25))&(1<<4))) != 0 || + not(not((W[43]^(W[47]>>25))&(1<<3))) != 0 || + not(not((W[43]^(W[47]>>25))&(1<<4))) != 0 { + mask &= ^DV_II_55_0_bit + } + } + if (mask & DV_II_56_0_bit) != 0 { + if not(not((W[60]^(W[64]>>25))&(1<<4))) != 0 || + not(not((W[44]^(W[48]>>25))&(1<<3))) != 0 || + not(not((W[44]^(W[48]>>25))&(1<<4))) != 0 { + mask &= ^DV_II_56_0_bit + } + } + } + + return mask +} + +func not(x uint32) uint32 { + if x == 0 { + return 1 + } + + return 0 +} + +//go:nosplit +func SHA1_dvs() []DvInfo { + return sha1_dvs +} diff --git a/vendor/github.com/pjbgf/sha1cd/ubc/ubc_amd64.go b/vendor/github.com/pjbgf/sha1cd/ubc/ubc_amd64.go deleted file mode 100644 index 09159bb5b..000000000 --- a/vendor/github.com/pjbgf/sha1cd/ubc/ubc_amd64.go +++ /dev/null @@ -1,14 +0,0 @@ -//go:build !noasm && gc && amd64 -// +build !noasm,gc,amd64 - -package ubc - -func CalculateDvMaskAMD64(W [80]uint32) uint32 - -// Check takes as input an expanded message block and verifies the unavoidable bitconditions -// for all listed DVs. It returns a dvmask where each bit belonging to a DV is set if all -// unavoidable bitconditions for that DV have been met. -// Thus, one needs to do the recompression check for each DV that has its bit set. -func CalculateDvMask(W [80]uint32) uint32 { - return CalculateDvMaskAMD64(W) -} diff --git a/vendor/github.com/pjbgf/sha1cd/ubc/ubc_amd64.s b/vendor/github.com/pjbgf/sha1cd/ubc/ubc_amd64.s deleted file mode 100644 index c77ea77ec..000000000 --- a/vendor/github.com/pjbgf/sha1cd/ubc/ubc_amd64.s +++ /dev/null @@ -1,1897 +0,0 @@ -// Code generated by command: go run asm.go -out ../ubc_amd64.s -pkg ubc. DO NOT EDIT. - -//go:build !noasm && gc && amd64 - -#include "textflag.h" - -// func CalculateDvMaskAMD64(W [80]uint32) uint32 -TEXT ·CalculateDvMaskAMD64(SB), NOSPLIT, $0-324 - MOVL $0xffffffff, AX - - // (((((W[44] ^ W[45]) >> 29) & 1) - 1) | ^(DV_I_48_0_bit | DV_I_51_0_bit | DV_I_52_0_bit | DV_II_45_0_bit | DV_II_46_0_bit | DV_II_50_0_bit | DV_II_51_0_bit)) - MOVL W_44+176(FP), CX - MOVL W_45+180(FP), DX - XORL DX, CX - SHRL $0x1d, CX - ANDL $0x00000001, CX - DECL CX - ORL $0xfd7c5f7f, CX - ANDL CX, AX - - // mask &= (((((W[49] ^ W[50]) >> 29) & 1) - 1) | ^(DV_I_46_0_bit | DV_II_45_0_bit | DV_II_50_0_bit | DV_II_51_0_bit | DV_II_55_0_bit | DV_II_56_0_bit)) - MOVL W_49+196(FP), CX - MOVL W_50+200(FP), DX - XORL DX, CX - SHRL $0x1d, CX - ANDL $0x00000001, CX - DECL CX - ORL $0x3d7efff7, CX - ANDL CX, AX - - // mask &= (((((W[48] ^ W[49]) >> 29) & 1) - 1) | ^(DV_I_45_0_bit | DV_I_52_0_bit | DV_II_49_0_bit | DV_II_50_0_bit | DV_II_54_0_bit | DV_II_55_0_bit)) - MOVL W_48+192(FP), CX - MOVL W_49+196(FP), DX - XORL DX, CX - SHRL $0x1d, CX - ANDL $0x00000001, CX - DECL CX - ORL $0x9f5f7ffb, CX - ANDL CX, AX - - // mask &= ((((W[47] ^ (W[50] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_I_47_0_bit | DV_I_49_0_bit | DV_I_51_0_bit | DV_II_45_0_bit | DV_II_51_0_bit | DV_II_56_0_bit)) - MOVL W_47+188(FP), CX - MOVL W_50+200(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000010, CX - SUBL $0x00000010, CX - ORL $0x7dfedddf, CX - ANDL CX, AX - - // mask &= (((((W[47] ^ W[48]) >> 29) & 1) - 1) | ^(DV_I_44_0_bit | DV_I_51_0_bit | DV_II_48_0_bit | DV_II_49_0_bit | DV_II_53_0_bit | DV_II_54_0_bit)) - MOVL W_47+188(FP), CX - MOVL W_48+192(FP), DX - XORL DX, CX - SHRL $0x1d, CX - ANDL $0x00000001, CX - DECL CX - ORL $0xcfcfdffd, CX - ANDL CX, AX - - // mask &= (((((W[46] >> 4) ^ (W[49] >> 29)) & 1) - 1) | ^(DV_I_46_0_bit | DV_I_48_0_bit | DV_I_50_0_bit | DV_I_52_0_bit | DV_II_50_0_bit | DV_II_55_0_bit)) - MOVL W_46+184(FP), CX - SHRL $0x04, CX - MOVL W_49+196(FP), DX - SHRL $0x1d, DX - XORL DX, CX - ANDL $0x00000001, CX - DECL CX - ORL $0xbf7f7777, CX - ANDL CX, AX - - // mask &= (((((W[46] ^ W[47]) >> 29) & 1) - 1) | ^(DV_I_43_0_bit | DV_I_50_0_bit | DV_II_47_0_bit | DV_II_48_0_bit | DV_II_52_0_bit | DV_II_53_0_bit)) - MOVL W_46+184(FP), CX - MOVL W_47+188(FP), DX - XORL DX, CX - SHRL $0x1d, CX - ANDL $0x00000001, CX - DECL CX - ORL $0xe7e7f7fe, CX - ANDL CX, AX - - // mask &= (((((W[45] >> 4) ^ (W[48] >> 29)) & 1) - 1) | ^(DV_I_45_0_bit | DV_I_47_0_bit | DV_I_49_0_bit | DV_I_51_0_bit | DV_II_49_0_bit | DV_II_54_0_bit)) - MOVL W_45+180(FP), CX - SHRL $0x04, CX - MOVL W_48+192(FP), DX - SHRL $0x1d, DX - XORL DX, CX - ANDL $0x00000001, CX - DECL CX - ORL $0xdfdfdddb, CX - ANDL CX, AX - - // mask &= (((((W[45] ^ W[46]) >> 29) & 1) - 1) | ^(DV_I_49_0_bit | DV_I_52_0_bit | DV_II_46_0_bit | DV_II_47_0_bit | DV_II_51_0_bit | DV_II_52_0_bit)) - MOVL W_45+180(FP), CX - MOVL W_46+184(FP), DX - XORL DX, CX - SHRL $0x1d, CX - ANDL $0x00000001, CX - DECL CX - ORL $0xf5f57dff, CX - ANDL CX, AX - - // mask &= (((((W[44] >> 4) ^ (W[47] >> 29)) & 1) - 1) | ^(DV_I_44_0_bit | DV_I_46_0_bit | DV_I_48_0_bit | DV_I_50_0_bit | DV_II_48_0_bit | DV_II_53_0_bit)) - MOVL W_44+176(FP), CX - SHRL $0x04, CX - MOVL W_47+188(FP), DX - SHRL $0x1d, DX - XORL DX, CX - ANDL $0x00000001, CX - DECL CX - ORL $0xefeff775, CX - ANDL CX, AX - - // mask &= (((((W[43] >> 4) ^ (W[46] >> 29)) & 1) - 1) | ^(DV_I_43_0_bit | DV_I_45_0_bit | DV_I_47_0_bit | DV_I_49_0_bit | DV_II_47_0_bit | DV_II_52_0_bit)) - MOVL W_43+172(FP), CX - SHRL $0x04, CX - MOVL W_46+184(FP), DX - SHRL $0x1d, DX - XORL DX, CX - ANDL $0x00000001, CX - DECL CX - ORL $0xf7f7fdda, CX - ANDL CX, AX - - // mask &= (((((W[43] ^ W[44]) >> 29) & 1) - 1) | ^(DV_I_47_0_bit | DV_I_50_0_bit | DV_I_51_0_bit | DV_II_45_0_bit | DV_II_49_0_bit | DV_II_50_0_bit)) - MOVL W_43+172(FP), CX - MOVL W_44+176(FP), DX - XORL DX, CX - SHRL $0x1d, CX - ANDL $0x00000001, CX - DECL CX - ORL $0xff5ed7df, CX - ANDL CX, AX - - // mask &= (((((W[42] >> 4) ^ (W[45] >> 29)) & 1) - 1) | ^(DV_I_44_0_bit | DV_I_46_0_bit | DV_I_48_0_bit | DV_I_52_0_bit | DV_II_46_0_bit | DV_II_51_0_bit)) - MOVL W_42+168(FP), CX - SHRL $0x04, CX - MOVL W_45+180(FP), DX - SHRL $0x1d, DX - XORL DX, CX - ANDL $0x00000001, CX - DECL CX - ORL $0xfdfd7f75, CX - ANDL CX, AX - - // mask &= (((((W[41] >> 4) ^ (W[44] >> 29)) & 1) - 1) | ^(DV_I_43_0_bit | DV_I_45_0_bit | DV_I_47_0_bit | DV_I_51_0_bit | DV_II_45_0_bit | DV_II_50_0_bit)) - MOVL W_41+164(FP), CX - SHRL $0x04, CX - MOVL W_44+176(FP), DX - SHRL $0x1d, DX - XORL DX, CX - ANDL $0x00000001, CX - DECL CX - ORL $0xff7edfda, CX - ANDL CX, AX - - // mask &= (((((W[40] ^ W[41]) >> 29) & 1) - 1) | ^(DV_I_44_0_bit | DV_I_47_0_bit | DV_I_48_0_bit | DV_II_46_0_bit | DV_II_47_0_bit | DV_II_56_0_bit)) - MOVL W_40+160(FP), CX - MOVL W_41+164(FP), DX - XORL DX, CX - SHRL $0x1d, CX - ANDL $0x00000001, CX - DECL CX - ORL $0x7ff5ff5d, CX - ANDL CX, AX - - // mask &= (((((W[54] ^ W[55]) >> 29) & 1) - 1) | ^(DV_I_51_0_bit | DV_II_47_0_bit | DV_II_50_0_bit | DV_II_55_0_bit | DV_II_56_0_bit)) - MOVL W_54+216(FP), CX - MOVL W_55+220(FP), DX - XORL DX, CX - SHRL $0x1d, CX - ANDL $0x00000001, CX - DECL CX - ORL $0x3f77dfff, CX - ANDL CX, AX - - // mask &= (((((W[53] ^ W[54]) >> 29) & 1) - 1) | ^(DV_I_50_0_bit | DV_II_46_0_bit | DV_II_49_0_bit | DV_II_54_0_bit | DV_II_55_0_bit)) - MOVL W_53+212(FP), CX - MOVL W_54+216(FP), DX - XORL DX, CX - SHRL $0x1d, CX - ANDL $0x00000001, CX - DECL CX - ORL $0x9fddf7ff, CX - ANDL CX, AX - - // mask &= (((((W[52] ^ W[53]) >> 29) & 1) - 1) | ^(DV_I_49_0_bit | DV_II_45_0_bit | DV_II_48_0_bit | DV_II_53_0_bit | DV_II_54_0_bit)) - MOVL W_52+208(FP), CX - MOVL W_53+212(FP), DX - XORL DX, CX - SHRL $0x1d, CX - ANDL $0x00000001, CX - DECL CX - ORL $0xcfeefdff, CX - ANDL CX, AX - - // mask &= ((((W[50] ^ (W[53] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_I_50_0_bit | DV_I_52_0_bit | DV_II_46_0_bit | DV_II_48_0_bit | DV_II_54_0_bit)) - MOVL W_50+200(FP), CX - MOVL W_53+212(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000010, CX - SUBL $0x00000010, CX - ORL $0xdfed77ff, CX - ANDL CX, AX - - // mask &= (((((W[50] ^ W[51]) >> 29) & 1) - 1) | ^(DV_I_47_0_bit | DV_II_46_0_bit | DV_II_51_0_bit | DV_II_52_0_bit | DV_II_56_0_bit)) - MOVL W_50+200(FP), CX - MOVL W_51+204(FP), DX - XORL DX, CX - SHRL $0x1d, CX - ANDL $0x00000001, CX - DECL CX - ORL $0x75fdffdf, CX - ANDL CX, AX - - // mask &= ((((W[49] ^ (W[52] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_I_49_0_bit | DV_I_51_0_bit | DV_II_45_0_bit | DV_II_47_0_bit | DV_II_53_0_bit)) - MOVL W_49+196(FP), CX - MOVL W_52+208(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000010, CX - SUBL $0x00000010, CX - ORL $0xeff6ddff, CX - ANDL CX, AX - - // mask &= ((((W[48] ^ (W[51] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_I_48_0_bit | DV_I_50_0_bit | DV_I_52_0_bit | DV_II_46_0_bit | DV_II_52_0_bit)) - MOVL W_48+192(FP), CX - MOVL W_51+204(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000010, CX - SUBL $0x00000010, CX - ORL $0xf7fd777f, CX - ANDL CX, AX - - // mask &= (((((W[42] ^ W[43]) >> 29) & 1) - 1) | ^(DV_I_46_0_bit | DV_I_49_0_bit | DV_I_50_0_bit | DV_II_48_0_bit | DV_II_49_0_bit)) - MOVL W_42+168(FP), CX - MOVL W_43+172(FP), DX - XORL DX, CX - SHRL $0x1d, CX - ANDL $0x00000001, CX - DECL CX - ORL $0xffcff5f7, CX - ANDL CX, AX - - // mask &= (((((W[41] ^ W[42]) >> 29) & 1) - 1) | ^(DV_I_45_0_bit | DV_I_48_0_bit | DV_I_49_0_bit | DV_II_47_0_bit | DV_II_48_0_bit)) - MOVL W_41+164(FP), CX - MOVL W_42+168(FP), DX - XORL DX, CX - SHRL $0x1d, CX - ANDL $0x00000001, CX - DECL CX - ORL $0xffe7fd7b, CX - ANDL CX, AX - - // mask &= (((((W[40] >> 4) ^ (W[43] >> 29)) & 1) - 1) | ^(DV_I_44_0_bit | DV_I_46_0_bit | DV_I_50_0_bit | DV_II_49_0_bit | DV_II_56_0_bit)) - MOVL W_40+160(FP), CX - MOVL W_43+172(FP), DX - SHRL $0x04, CX - SHRL $0x1d, DX - XORL DX, CX - ANDL $0x00000001, CX - DECL CX - ORL $0x7fdff7f5, CX - ANDL CX, AX - - // mask &= (((((W[39] >> 4) ^ (W[42] >> 29)) & 1) - 1) | ^(DV_I_43_0_bit | DV_I_45_0_bit | DV_I_49_0_bit | DV_II_48_0_bit | DV_II_55_0_bit)) - MOVL W_39+156(FP), CX - MOVL W_42+168(FP), DX - SHRL $0x04, CX - SHRL $0x1d, DX - XORL DX, CX - ANDL $0x00000001, CX - DECL CX - ORL $0xbfeffdfa, CX - ANDL CX, AX - - // if (mask & (DV_I_44_0_bit | DV_I_48_0_bit | DV_II_47_0_bit | DV_II_54_0_bit | DV_II_56_0_bit)) != 0 { - // mask &= (((((W[38] >> 4) ^ (W[41] >> 29)) & 1) - 1) | ^(DV_I_44_0_bit | DV_I_48_0_bit | DV_II_47_0_bit | DV_II_54_0_bit | DV_II_56_0_bit)) - // } - TESTL $0xa0080082, AX - JE f1 - MOVL W_38+152(FP), CX - MOVL W_41+164(FP), DX - SHRL $0x04, CX - SHRL $0x1d, DX - XORL DX, CX - ANDL $0x00000001, CX - DECL CX - ORL $0x5ff7ff7d, CX - ANDL CX, AX - -f1: - // mask &= (((((W[37] >> 4) ^ (W[40] >> 29)) & 1) - 1) | ^(DV_I_43_0_bit | DV_I_47_0_bit | DV_II_46_0_bit | DV_II_53_0_bit | DV_II_55_0_bit)) - MOVL W_37+148(FP), CX - MOVL W_40+160(FP), DX - SHRL $0x04, CX - SHRL $0x1d, DX - XORL DX, CX - ANDL $0x00000001, CX - DECL CX - ORL $0xaffdffde, CX - ANDL CX, AX - - // if (mask & (DV_I_52_0_bit | DV_II_48_0_bit | DV_II_51_0_bit | DV_II_56_0_bit)) != 0 { - // mask &= (((((W[55] ^ W[56]) >> 29) & 1) - 1) | ^(DV_I_52_0_bit | DV_II_48_0_bit | DV_II_51_0_bit | DV_II_56_0_bit)) - // } - TESTL $0x82108000, AX - JE f2 - MOVL W_55+220(FP), CX - MOVL W_56+224(FP), DX - XORL DX, CX - SHRL $0x1d, CX - ANDL $0x00000001, CX - DECL CX - ORL $0x7def7fff, CX - ANDL CX, AX - -f2: - // if (mask & (DV_I_52_0_bit | DV_II_48_0_bit | DV_II_50_0_bit | DV_II_56_0_bit)) != 0 { - // mask &= ((((W[52] ^ (W[55] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_I_52_0_bit | DV_II_48_0_bit | DV_II_50_0_bit | DV_II_56_0_bit)) - // } - TESTL $0x80908000, AX - JE f3 - MOVL W_52+208(FP), CX - MOVL W_55+220(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000010, CX - SUBL $0x00000010, CX - ORL $0x7f6f7fff, CX - ANDL CX, AX - -f3: - // if (mask & (DV_I_51_0_bit | DV_II_47_0_bit | DV_II_49_0_bit | DV_II_55_0_bit)) != 0 { - // mask &= ((((W[51] ^ (W[54] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_I_51_0_bit | DV_II_47_0_bit | DV_II_49_0_bit | DV_II_55_0_bit)) - // } - TESTL $0x40282000, AX - JE f4 - MOVL W_51+204(FP), CX - MOVL W_54+216(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000010, CX - SUBL $0x00000010, CX - ORL $0xbfd7dfff, CX - ANDL CX, AX - -f4: - // if (mask & (DV_I_48_0_bit | DV_II_47_0_bit | DV_II_52_0_bit | DV_II_53_0_bit)) != 0 { - // mask &= (((((W[51] ^ W[52]) >> 29) & 1) - 1) | ^(DV_I_48_0_bit | DV_II_47_0_bit | DV_II_52_0_bit | DV_II_53_0_bit)) - // } - TESTL $0x18080080, AX - JE f5 - MOVL W_51+204(FP), CX - MOVL W_52+208(FP), DX - XORL DX, CX - SHRL $0x1d, CX - ANDL $0x00000001, CX - DECL CX - ORL $0xe7f7ff7f, CX - ANDL CX, AX - -f5: - // if (mask & (DV_I_46_0_bit | DV_I_49_0_bit | DV_II_45_0_bit | DV_II_48_0_bit)) != 0 { - // mask &= (((((W[36] >> 4) ^ (W[40] >> 29)) & 1) - 1) | ^(DV_I_46_0_bit | DV_I_49_0_bit | DV_II_45_0_bit | DV_II_48_0_bit)) - // } - TESTL $0x00110208, AX - JE f6 - MOVL W_36+144(FP), CX - SHRL $0x04, CX - MOVL W_40+160(FP), DX - SHRL $0x1d, DX - XORL DX, CX - ANDL $0x00000001, CX - DECL CX - ORL $0xffeefdf7, CX - ANDL CX, AX - -f6: - // if (mask & (DV_I_52_0_bit | DV_II_48_0_bit | DV_II_49_0_bit)) != 0 { - // mask &= ((0 - (((W[53] ^ W[56]) >> 29) & 1)) | ^(DV_I_52_0_bit | DV_II_48_0_bit | DV_II_49_0_bit)) - // } - TESTL $0x00308000, AX - JE f7 - MOVL W_53+212(FP), CX - MOVL W_56+224(FP), DX - XORL DX, CX - SHRL $0x1d, CX - ANDL $0x00000001, CX - NEGL CX - ORL $0xffcf7fff, CX - ANDL CX, AX - -f7: - // if (mask & (DV_I_50_0_bit | DV_II_46_0_bit | DV_II_47_0_bit)) != 0 { - // mask &= ((0 - (((W[51] ^ W[54]) >> 29) & 1)) | ^(DV_I_50_0_bit | DV_II_46_0_bit | DV_II_47_0_bit)) - // } - TESTL $0x000a0800, AX - JE f8 - MOVL W_51+204(FP), CX - MOVL W_54+216(FP), DX - XORL DX, CX - SHRL $0x1d, CX - ANDL $0x00000001, CX - NEGL CX - ORL $0xfff5f7ff, CX - ANDL CX, AX - -f8: - // if (mask & (DV_I_49_0_bit | DV_I_51_0_bit | DV_II_45_0_bit)) != 0 { - // mask &= ((0 - (((W[50] ^ W[52]) >> 29) & 1)) | ^(DV_I_49_0_bit | DV_I_51_0_bit | DV_II_45_0_bit)) - // } - TESTL $0x00012200, AX - JE f9 - MOVL W_50+200(FP), CX - MOVL W_52+208(FP), DX - XORL DX, CX - SHRL $0x1d, CX - ANDL $0x00000001, CX - NEGL CX - ORL $0xfffeddff, CX - ANDL CX, AX - -f9: - // if (mask & (DV_I_48_0_bit | DV_I_50_0_bit | DV_I_52_0_bit)) != 0 { - // mask &= ((0 - (((W[49] ^ W[51]) >> 29) & 1)) | ^(DV_I_48_0_bit | DV_I_50_0_bit | DV_I_52_0_bit)) - // } - TESTL $0x00008880, AX - JE f10 - MOVL W_49+196(FP), CX - MOVL W_51+204(FP), DX - XORL DX, CX - SHRL $0x1d, CX - ANDL $0x00000001, CX - NEGL CX - ORL $0xffff777f, CX - ANDL CX, AX - -f10: - // if (mask & (DV_I_47_0_bit | DV_I_49_0_bit | DV_I_51_0_bit)) != 0 { - // mask &= ((0 - (((W[48] ^ W[50]) >> 29) & 1)) | ^(DV_I_47_0_bit | DV_I_49_0_bit | DV_I_51_0_bit)) - // } - TESTL $0x00002220, AX - JE f11 - MOVL W_48+192(FP), CX - MOVL W_50+200(FP), DX - XORL DX, CX - SHRL $0x1d, CX - ANDL $0x00000001, CX - NEGL CX - ORL $0xffffdddf, CX - ANDL CX, AX - -f11: - // if (mask & (DV_I_46_0_bit | DV_I_48_0_bit | DV_I_50_0_bit)) != 0 { - // mask &= ((0 - (((W[47] ^ W[49]) >> 29) & 1)) | ^(DV_I_46_0_bit | DV_I_48_0_bit | DV_I_50_0_bit)) - // } - TESTL $0x00000888, AX - JE f12 - MOVL W_47+188(FP), CX - MOVL W_49+196(FP), DX - XORL DX, CX - SHRL $0x1d, CX - ANDL $0x00000001, CX - NEGL CX - ORL $0xfffff777, CX - ANDL CX, AX - -f12: - // if (mask & (DV_I_45_0_bit | DV_I_47_0_bit | DV_I_49_0_bit)) != 0 { - // mask &= ((0 - (((W[46] ^ W[48]) >> 29) & 1)) | ^(DV_I_45_0_bit | DV_I_47_0_bit | DV_I_49_0_bit)) - // } - TESTL $0x00000224, AX - JE f13 - MOVL W_46+184(FP), CX - MOVL W_48+192(FP), DX - XORL DX, CX - SHRL $0x1d, CX - ANDL $0x00000001, CX - NEGL CX - ORL $0xfffffddb, CX - ANDL CX, AX - -f13: - // mask &= ((((W[45] ^ W[47]) & (1 << 6)) - (1 << 6)) | ^(DV_I_47_2_bit | DV_I_49_2_bit | DV_I_51_2_bit)) - MOVL W_45+180(FP), CX - MOVL W_47+188(FP), DX - XORL DX, CX - ANDL $0x00000040, CX - SUBL $0x00000040, CX - ORL $0xffffbbbf, CX - ANDL CX, AX - - // if (mask & (DV_I_44_0_bit | DV_I_46_0_bit | DV_I_48_0_bit)) != 0 { - // mask &= ((0 - (((W[45] ^ W[47]) >> 29) & 1)) | ^(DV_I_44_0_bit | DV_I_46_0_bit | DV_I_48_0_bit)) - // } - TESTL $0x0000008a, AX - JE f14 - MOVL W_45+180(FP), CX - MOVL W_47+188(FP), DX - XORL DX, CX - SHRL $0x1d, CX - ANDL $0x00000001, CX - NEGL CX - ORL $0xffffff75, CX - ANDL CX, AX - -f14: - // mask &= (((((W[44] ^ W[46]) >> 6) & 1) - 1) | ^(DV_I_46_2_bit | DV_I_48_2_bit | DV_I_50_2_bit)) - MOVL W_44+176(FP), CX - MOVL W_46+184(FP), DX - XORL DX, CX - SHRL $0x06, CX - ANDL $0x00000001, CX - DECL CX - ORL $0xffffeeef, CX - ANDL CX, AX - - // if (mask & (DV_I_43_0_bit | DV_I_45_0_bit | DV_I_47_0_bit)) != 0 { - // mask &= ((0 - (((W[44] ^ W[46]) >> 29) & 1)) | ^(DV_I_43_0_bit | DV_I_45_0_bit | DV_I_47_0_bit)) - // } - TESTL $0x00000025, AX - JE f15 - MOVL W_44+176(FP), CX - MOVL W_46+184(FP), DX - XORL DX, CX - SHRL $0x1d, CX - ANDL $0x00000001, CX - NEGL CX - ORL $0xffffffda, CX - ANDL CX, AX - -f15: - // mask &= ((0 - ((W[41] ^ (W[42] >> 5)) & (1 << 1))) | ^(DV_I_48_2_bit | DV_II_46_2_bit | DV_II_51_2_bit)) - MOVL W_41+164(FP), CX - MOVL W_42+168(FP), DX - SHRL $0x05, DX - XORL DX, CX - ANDL $0x00000002, CX - NEGL CX - ORL $0xfbfbfeff, CX - ANDL CX, AX - - // mask &= ((0 - ((W[40] ^ (W[41] >> 5)) & (1 << 1))) | ^(DV_I_47_2_bit | DV_I_51_2_bit | DV_II_50_2_bit)) - MOVL W_40+160(FP), CX - MOVL W_41+164(FP), DX - SHRL $0x05, DX - XORL DX, CX - ANDL $0x00000002, CX - NEGL CX - ORL $0xfeffbfbf, CX - ANDL CX, AX - - // if (mask & (DV_I_44_0_bit | DV_I_46_0_bit | DV_II_56_0_bit)) != 0 { - // mask &= ((0 - (((W[40] ^ W[42]) >> 4) & 1)) | ^(DV_I_44_0_bit | DV_I_46_0_bit | DV_II_56_0_bit)) - // } - TESTL $0x8000000a, AX - JE f16 - MOVL W_40+160(FP), CX - MOVL W_42+168(FP), DX - XORL DX, CX - SHRL $0x04, CX - ANDL $0x00000001, CX - NEGL CX - ORL $0x7ffffff5, CX - ANDL CX, AX - -f16: - // mask &= ((0 - ((W[39] ^ (W[40] >> 5)) & (1 << 1))) | ^(DV_I_46_2_bit | DV_I_50_2_bit | DV_II_49_2_bit)) - MOVL W_39+156(FP), CX - MOVL W_40+160(FP), DX - SHRL $0x05, DX - XORL DX, CX - ANDL $0x00000002, CX - NEGL CX - ORL $0xffbfefef, CX - ANDL CX, AX - - // if (mask & (DV_I_43_0_bit | DV_I_45_0_bit | DV_II_55_0_bit)) != 0 { - // mask &= ((0 - (((W[39] ^ W[41]) >> 4) & 1)) | ^(DV_I_43_0_bit | DV_I_45_0_bit | DV_II_55_0_bit)) - // } - TESTL $0x40000005, AX - JE f17 - MOVL W_39+156(FP), CX - MOVL W_41+164(FP), DX - XORL DX, CX - SHRL $0x04, CX - ANDL $0x00000001, CX - NEGL CX - ORL $0xbffffffa, CX - ANDL CX, AX - -f17: - // if (mask & (DV_I_44_0_bit | DV_II_54_0_bit | DV_II_56_0_bit)) != 0 { - // mask &= ((0 - (((W[38] ^ W[40]) >> 4) & 1)) | ^(DV_I_44_0_bit | DV_II_54_0_bit | DV_II_56_0_bit)) - // } - TESTL $0xa0000002, AX - JE f18 - MOVL W_38+152(FP), CX - MOVL W_40+160(FP), DX - XORL DX, CX - SHRL $0x04, CX - ANDL $0x00000001, CX - NEGL CX - ORL $0x5ffffffd, CX - ANDL CX, AX - -f18: - // if (mask & (DV_I_43_0_bit | DV_II_53_0_bit | DV_II_55_0_bit)) != 0 { - // mask &= ((0 - (((W[37] ^ W[39]) >> 4) & 1)) | ^(DV_I_43_0_bit | DV_II_53_0_bit | DV_II_55_0_bit)) - // } - TESTL $0x50000001, AX - JE f19 - MOVL W_37+148(FP), CX - MOVL W_39+156(FP), DX - XORL DX, CX - SHRL $0x04, CX - ANDL $0x00000001, CX - NEGL CX - ORL $0xaffffffe, CX - ANDL CX, AX - -f19: - // mask &= ((0 - ((W[36] ^ (W[37] >> 5)) & (1 << 1))) | ^(DV_I_47_2_bit | DV_I_50_2_bit | DV_II_46_2_bit)) - MOVL W_36+144(FP), CX - MOVL W_37+148(FP), DX - SHRL $0x05, DX - XORL DX, CX - ANDL $0x00000002, CX - NEGL CX - ORL $0xfffbefbf, CX - ANDL CX, AX - - // if (mask & (DV_I_45_0_bit | DV_I_48_0_bit | DV_II_47_0_bit)) != 0 { - // mask &= (((((W[35] >> 4) ^ (W[39] >> 29)) & 1) - 1) | ^(DV_I_45_0_bit | DV_I_48_0_bit | DV_II_47_0_bit)) - // } - TESTL $0x00080084, AX - JE f20 - MOVL W_35+140(FP), CX - MOVL W_39+156(FP), DX - SHRL $0x04, CX - SHRL $0x1d, DX - XORL DX, CX - ANDL $0x00000001, CX - SUBL $0x00000001, CX - ORL $0xfff7ff7b, CX - ANDL CX, AX - -f20: - // if (mask & (DV_I_48_0_bit | DV_II_48_0_bit)) != 0 { - // mask &= ((0 - ((W[63] ^ (W[64] >> 5)) & (1 << 0))) | ^(DV_I_48_0_bit | DV_II_48_0_bit)) - // } - TESTL $0x00100080, AX - JE f21 - MOVL W_63+252(FP), CX - MOVL W_64+256(FP), DX - SHRL $0x05, DX - XORL DX, CX - ANDL $0x00000001, CX - NEGL CX - ORL $0xffefff7f, CX - ANDL CX, AX - -f21: - // if (mask & (DV_I_45_0_bit | DV_II_45_0_bit)) != 0 { - // mask &= ((0 - ((W[63] ^ (W[64] >> 5)) & (1 << 1))) | ^(DV_I_45_0_bit | DV_II_45_0_bit)) - // } - TESTL $0x00010004, AX - JE f22 - MOVL W_63+252(FP), CX - MOVL W_64+256(FP), DX - SHRL $0x05, DX - XORL DX, CX - ANDL $0x00000002, CX - NEGL CX - ORL $0xfffefffb, CX - ANDL CX, AX - -f22: - // if (mask & (DV_I_47_0_bit | DV_II_47_0_bit)) != 0 { - // mask &= ((0 - ((W[62] ^ (W[63] >> 5)) & (1 << 0))) | ^(DV_I_47_0_bit | DV_II_47_0_bit)) - // } - TESTL $0x00080020, AX - JE f23 - MOVL W_62+248(FP), CX - MOVL W_63+252(FP), DX - SHRL $0x05, DX - XORL DX, CX - ANDL $0x00000001, CX - NEGL CX - ORL $0xfff7ffdf, CX - ANDL CX, AX - -f23: - // if (mask & (DV_I_46_0_bit | DV_II_46_0_bit)) != 0 { - // mask &= ((0 - ((W[61] ^ (W[62] >> 5)) & (1 << 0))) | ^(DV_I_46_0_bit | DV_II_46_0_bit)) - // } - TESTL $0x00020008, AX - JE f24 - MOVL W_61+244(FP), CX - MOVL W_62+248(FP), DX - SHRL $0x05, DX - XORL DX, CX - ANDL $0x00000001, CX - NEGL CX - ORL $0xfffdfff7, CX - ANDL CX, AX - -f24: - // mask &= ((0 - ((W[61] ^ (W[62] >> 5)) & (1 << 2))) | ^(DV_I_46_2_bit | DV_II_46_2_bit)) - MOVL W_61+244(FP), CX - MOVL W_62+248(FP), DX - SHRL $0x05, DX - XORL DX, CX - ANDL $0x00000004, CX - NEGL CX - ORL $0xfffbffef, CX - ANDL CX, AX - - // if (mask & (DV_I_45_0_bit | DV_II_45_0_bit)) != 0 { - // mask &= ((0 - ((W[60] ^ (W[61] >> 5)) & (1 << 0))) | ^(DV_I_45_0_bit | DV_II_45_0_bit)) - // } - TESTL $0x00010004, AX - JE f25 - MOVL W_60+240(FP), CX - MOVL W_61+244(FP), DX - SHRL $0x05, DX - XORL DX, CX - ANDL $0x00000001, CX - NEGL CX - ORL $0xfffefffb, CX - ANDL CX, AX - -f25: - // if (mask & (DV_II_51_0_bit | DV_II_54_0_bit)) != 0 { - // mask &= (((((W[58] ^ W[59]) >> 29) & 1) - 1) | ^(DV_II_51_0_bit | DV_II_54_0_bit)) - // } - TESTL $0x22000000, AX - JE f26 - MOVL W_58+232(FP), CX - MOVL W_59+236(FP), DX - XORL DX, CX - SHRL $0x1d, CX - ANDL $0x00000001, CX - SUBL $0x00000001, CX - ORL $0xddffffff, CX - ANDL CX, AX - -f26: - // if (mask & (DV_II_50_0_bit | DV_II_53_0_bit)) != 0 { - // mask &= (((((W[57] ^ W[58]) >> 29) & 1) - 1) | ^(DV_II_50_0_bit | DV_II_53_0_bit)) - // } - TESTL $0x10800000, AX - JE f27 - MOVL W_57+228(FP), CX - MOVL W_58+232(FP), DX - XORL DX, CX - SHRL $0x1d, CX - ANDL $0x00000001, CX - SUBL $0x00000001, CX - ORL $0xef7fffff, CX - ANDL CX, AX - -f27: - // if (mask & (DV_II_52_0_bit | DV_II_54_0_bit)) != 0 { - // mask &= ((((W[56] ^ (W[59] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_II_52_0_bit | DV_II_54_0_bit)) - // } - TESTL $0x28000000, AX - JE f28 - MOVL W_56+224(FP), CX - MOVL W_59+236(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000010, CX - SUBL $0x00000010, CX - ORL $0xd7ffffff, CX - ANDL CX, AX - -f28: - // if (mask & (DV_II_51_0_bit | DV_II_52_0_bit)) != 0 { - // mask &= ((0 - (((W[56] ^ W[59]) >> 29) & 1)) | ^(DV_II_51_0_bit | DV_II_52_0_bit)) - // } - TESTL $0x0a000000, AX - JE f29 - MOVL W_56+224(FP), CX - MOVL W_59+236(FP), DX - XORL DX, CX - SHRL $0x1d, CX - ANDL $0x00000001, CX - NEGL CX - ORL $0xf5ffffff, CX - ANDL CX, AX - -f29: - // if (mask & (DV_II_49_0_bit | DV_II_52_0_bit)) != 0 { - // mask &= (((((W[56] ^ W[57]) >> 29) & 1) - 1) | ^(DV_II_49_0_bit | DV_II_52_0_bit)) - // } - TESTL $0x08200000, AX - JE f30 - MOVL W_56+224(FP), CX - MOVL W_57+228(FP), DX - XORL DX, CX - SHRL $0x1d, CX - ANDL $0x00000001, CX - SUBL $0x00000001, CX - ORL $0xf7dfffff, CX - ANDL CX, AX - -f30: - // if (mask & (DV_II_51_0_bit | DV_II_53_0_bit)) != 0 { - // mask &= ((((W[55] ^ (W[58] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_II_51_0_bit | DV_II_53_0_bit)) - // } - TESTL $0x12000000, AX - JE f31 - MOVL W_55+220(FP), CX - MOVL W_58+232(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000010, CX - SUBL $0x00000010, CX - ORL $0xedffffff, CX - ANDL CX, AX - -f31: - // if (mask & (DV_II_50_0_bit | DV_II_52_0_bit)) != 0 { - // mask &= ((((W[54] ^ (W[57] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_II_50_0_bit | DV_II_52_0_bit)) - // } - TESTL $0x08800000, AX - JE f32 - MOVL W_54+216(FP), CX - MOVL W_57+228(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000010, CX - SUBL $0x00000010, CX - ORL $0xf77fffff, CX - ANDL CX, AX - -f32: - // if (mask & (DV_II_49_0_bit | DV_II_51_0_bit)) != 0 { - // mask &= ((((W[53] ^ (W[56] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_II_49_0_bit | DV_II_51_0_bit)) - // } - TESTL $0x02200000, AX - JE f33 - MOVL W_53+212(FP), CX - MOVL W_56+224(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000010, CX - SUBL $0x00000010, CX - ORL $0xfddfffff, CX - ANDL CX, AX - -f33: - // mask &= ((((W[51] ^ (W[50] >> 5)) & (1 << 1)) - (1 << 1)) | ^(DV_I_50_2_bit | DV_II_46_2_bit)) - MOVL W_51+204(FP), CX - MOVL W_50+200(FP), DX - SHRL $0x05, DX - XORL DX, CX - ANDL $0x00000002, CX - SUBL $0x00000002, CX - ORL $0xfffbefff, CX - ANDL CX, AX - - // mask &= ((((W[48] ^ W[50]) & (1 << 6)) - (1 << 6)) | ^(DV_I_50_2_bit | DV_II_46_2_bit)) - MOVL W_48+192(FP), CX - MOVL W_50+200(FP), DX - XORL DX, CX - ANDL $0x00000040, CX - SUBL $0x00000040, CX - ORL $0xfffbefff, CX - ANDL CX, AX - - // if (mask & (DV_I_51_0_bit | DV_I_52_0_bit)) != 0 { - // mask &= ((0 - (((W[48] ^ W[55]) >> 29) & 1)) | ^(DV_I_51_0_bit | DV_I_52_0_bit)) - // } - TESTL $0x0000a000, AX - JE f34 - MOVL W_48+192(FP), CX - MOVL W_55+220(FP), DX - XORL DX, CX - SHRL $0x1d, CX - ANDL $0x00000001, CX - NEGL CX - ORL $0xffff5fff, CX - ANDL CX, AX - -f34: - // mask &= ((((W[47] ^ W[49]) & (1 << 6)) - (1 << 6)) | ^(DV_I_49_2_bit | DV_I_51_2_bit)) - MOVL W_47+188(FP), CX - MOVL W_49+196(FP), DX - XORL DX, CX - ANDL $0x00000040, CX - SUBL $0x00000040, CX - ORL $0xffffbbff, CX - ANDL CX, AX - - // mask &= ((((W[48] ^ (W[47] >> 5)) & (1 << 1)) - (1 << 1)) | ^(DV_I_47_2_bit | DV_II_51_2_bit)) - MOVL W_48+192(FP), CX - MOVL W_47+188(FP), DX - SHRL $0x05, DX - XORL DX, CX - ANDL $0x00000002, CX - SUBL $0x00000002, CX - ORL $0xfbffffbf, CX - ANDL CX, AX - - // mask &= ((((W[46] ^ W[48]) & (1 << 6)) - (1 << 6)) | ^(DV_I_48_2_bit | DV_I_50_2_bit)) - MOVL W_46+184(FP), CX - MOVL W_48+192(FP), DX - XORL DX, CX - ANDL $0x00000040, CX - SUBL $0x00000040, CX - ORL $0xffffeeff, CX - ANDL CX, AX - - // mask &= ((((W[47] ^ (W[46] >> 5)) & (1 << 1)) - (1 << 1)) | ^(DV_I_46_2_bit | DV_II_50_2_bit)) - MOVL W_47+188(FP), CX - MOVL W_46+184(FP), DX - SHRL $0x05, DX - XORL DX, CX - ANDL $0x00000002, CX - SUBL $0x00000002, CX - ORL $0xfeffffef, CX - ANDL CX, AX - - // mask &= ((0 - ((W[44] ^ (W[45] >> 5)) & (1 << 1))) | ^(DV_I_51_2_bit | DV_II_49_2_bit)) - MOVL W_44+176(FP), CX - MOVL W_45+180(FP), DX - SHRL $0x05, DX - XORL DX, CX - ANDL $0x00000002, CX - NEGL CX - ORL $0xffbfbfff, CX - ANDL CX, AX - - // mask &= ((((W[43] ^ W[45]) & (1 << 6)) - (1 << 6)) | ^(DV_I_47_2_bit | DV_I_49_2_bit)) - MOVL W_43+172(FP), CX - MOVL W_45+180(FP), DX - XORL DX, CX - ANDL $0x00000040, CX - SUBL $0x00000040, CX - ORL $0xfffffbbf, CX - ANDL CX, AX - - // mask &= (((((W[42] ^ W[44]) >> 6) & 1) - 1) | ^(DV_I_46_2_bit | DV_I_48_2_bit)) - MOVL W_42+168(FP), CX - MOVL W_44+176(FP), DX - XORL DX, CX - SHRL $0x06, CX - ANDL $0x00000001, CX - SUBL $0x00000001, CX - ORL $0xfffffeef, CX - ANDL CX, AX - - // mask &= ((((W[43] ^ (W[42] >> 5)) & (1 << 1)) - (1 << 1)) | ^(DV_II_46_2_bit | DV_II_51_2_bit)) - MOVL W_43+172(FP), CX - MOVL W_42+168(FP), DX - SHRL $0x05, DX - XORL DX, CX - ANDL $0x00000002, CX - SUBL $0x00000002, CX - ORL $0xfbfbffff, CX - ANDL CX, AX - - // mask &= ((((W[42] ^ (W[41] >> 5)) & (1 << 1)) - (1 << 1)) | ^(DV_I_51_2_bit | DV_II_50_2_bit)) - MOVL W_42+168(FP), CX - MOVL W_41+164(FP), DX - SHRL $0x05, DX - XORL DX, CX - ANDL $0x00000002, CX - SUBL $0x00000002, CX - ORL $0xfeffbfff, CX - ANDL CX, AX - - // mask &= ((((W[41] ^ (W[40] >> 5)) & (1 << 1)) - (1 << 1)) | ^(DV_I_50_2_bit | DV_II_49_2_bit)) - MOVL W_41+164(FP), CX - MOVL W_40+160(FP), DX - SHRL $0x05, DX - XORL DX, CX - ANDL $0x00000002, CX - SUBL $0x00000002, CX - ORL $0xffbfefff, CX - ANDL CX, AX - - // if (mask & (DV_I_52_0_bit | DV_II_51_0_bit)) != 0 { - // mask &= ((((W[39] ^ (W[43] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_I_52_0_bit | DV_II_51_0_bit)) - // } - TESTL $0x02008000, AX - JE f35 - MOVL W_39+156(FP), CX - MOVL W_43+172(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000010, CX - SUBL $0x00000010, CX - ORL $0xfdff7fff, CX - ANDL CX, AX - -f35: - // if (mask & (DV_I_51_0_bit | DV_II_50_0_bit)) != 0 { - // mask &= ((((W[38] ^ (W[42] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_I_51_0_bit | DV_II_50_0_bit)) - // } - TESTL $0x00802000, AX - JE f36 - MOVL W_38+152(FP), CX - MOVL W_42+168(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000010, CX - SUBL $0x00000010, CX - ORL $0xff7fdfff, CX - ANDL CX, AX - -f36: - // if (mask & (DV_I_48_2_bit | DV_I_51_2_bit)) != 0 { - // mask &= ((0 - ((W[37] ^ (W[38] >> 5)) & (1 << 1))) | ^(DV_I_48_2_bit | DV_I_51_2_bit)) - // } - TESTL $0x00004100, AX - JE f37 - MOVL W_37+148(FP), CX - MOVL W_38+152(FP), DX - SHRL $0x05, DX - XORL DX, CX - ANDL $0x00000002, CX - NEGL CX - ORL $0xffffbeff, CX - ANDL CX, AX - -f37: - // if (mask & (DV_I_50_0_bit | DV_II_49_0_bit)) != 0 { - // mask &= ((((W[37] ^ (W[41] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_I_50_0_bit | DV_II_49_0_bit)) - // } - TESTL $0x00200800, AX - JE f38 - MOVL W_37+148(FP), CX - MOVL W_41+164(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000010, CX - SUBL $0x00000010, CX - ORL $0xffdff7ff, CX - ANDL CX, AX - -f38: - // if (mask & (DV_II_52_0_bit | DV_II_54_0_bit)) != 0 { - // mask &= ((0 - ((W[36] ^ W[38]) & (1 << 4))) | ^(DV_II_52_0_bit | DV_II_54_0_bit)) - // } - TESTL $0x28000000, AX - JE f39 - MOVL W_36+144(FP), CX - MOVL W_38+152(FP), DX - XORL DX, CX - ANDL $0x00000010, CX - NEGL CX - ORL $0xd7ffffff, CX - ANDL CX, AX - -f39: - // mask &= ((0 - ((W[35] ^ (W[36] >> 5)) & (1 << 1))) | ^(DV_I_46_2_bit | DV_I_49_2_bit)) - MOVL W_35+140(FP), CX - MOVL W_36+144(FP), DX - SHRL $0x05, DX - XORL DX, CX - ANDL $0x00000002, CX - NEGL CX - ORL $0xfffffbef, CX - ANDL CX, AX - - // if (mask & (DV_I_51_0_bit | DV_II_47_0_bit)) != 0 { - // mask &= ((((W[35] ^ (W[39] >> 25)) & (1 << 3)) - (1 << 3)) | ^(DV_I_51_0_bit | DV_II_47_0_bit)) - // } - TESTL $0x00082000, AX - JE f40 - MOVL W_35+140(FP), CX - MOVL W_39+156(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000008, CX - SUBL $0x00000008, CX - ORL $0xfff7dfff, CX - ANDL CX, AX - -f40: - // if mask != 0 - TESTL $0x00000000, AX - JNE end - - // if (mask & DV_I_43_0_bit) != 0 { - // if not((W[61]^(W[62]>>5))&(1<<1)) != 0 || - // not(not((W[59]^(W[63]>>25))&(1<<5))) != 0 || - // not((W[58]^(W[63]>>30))&(1<<0)) != 0 { - // mask &= ^DV_I_43_0_bit - // } - // } - BTL $0x00, AX - JNC f41_skip - MOVL W_61+244(FP), CX - MOVL W_62+248(FP), DX - SHRL $0x05, DX - XORL DX, CX - ANDL $0x00000002, CX - NEGL CX - CMPL CX, $0x00000000 - JE f41_in - MOVL W_59+236(FP), CX - MOVL W_63+252(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000020, CX - CMPL CX, $0x00000000 - JNE f41_in - MOVL W_58+232(FP), CX - MOVL W_63+252(FP), DX - SHRL $0x1e, DX - XORL DX, CX - ANDL $0x00000001, CX - NEGL CX - CMPL CX, $0x00000000 - JE f41_in - JMP f41_skip - -f41_in: - ANDL $0xfffffffe, AX - -f41_skip: - // if (mask & DV_I_44_0_bit) != 0 { - // if not((W[62]^(W[63]>>5))&(1<<1)) != 0 || - // not(not((W[60]^(W[64]>>25))&(1<<5))) != 0 || - // not((W[59]^(W[64]>>30))&(1<<0)) != 0 { - // mask &= ^DV_I_44_0_bit - // } - // } - BTL $0x01, AX - JNC f42_skip - MOVL W_62+248(FP), CX - MOVL W_63+252(FP), DX - SHRL $0x05, DX - XORL DX, CX - ANDL $0x00000002, CX - NEGL CX - CMPL CX, $0x00000000 - JE f42_in - MOVL W_60+240(FP), CX - MOVL W_64+256(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000020, CX - CMPL CX, $0x00000000 - JNE f42_in - MOVL W_59+236(FP), CX - MOVL W_64+256(FP), DX - SHRL $0x1e, DX - XORL DX, CX - ANDL $0x00000001, CX - NEGL CX - CMPL CX, $0x00000000 - JE f42_in - JMP f42_skip - -f42_in: - ANDL $0xfffffffd, AX - -f42_skip: - // if (mask & DV_I_46_2_bit) != 0 { - // mask &= ((^((W[40] ^ W[42]) >> 2)) | ^DV_I_46_2_bit) - // } - BTL $0x04, AX - JNC f43 - MOVL W_40+160(FP), CX - MOVL W_42+168(FP), DX - XORL DX, CX - SHRL $0x02, CX - NOTL CX - ORL $0xffffffef, CX - ANDL CX, AX - -f43: - // if (mask & DV_I_47_2_bit) != 0 { - // if not((W[62]^(W[63]>>5))&(1<<2)) != 0 || - // not(not((W[41]^W[43])&(1<<6))) != 0 { - // mask &= ^DV_I_47_2_bit - // } - // } - BTL $0x06, AX - JNC f44_skip - MOVL W_62+248(FP), CX - MOVL W_63+252(FP), DX - SHRL $0x05, DX - XORL DX, CX - ANDL $0x00000004, CX - NEGL CX - CMPL CX, $0x00000000 - JE f44_in - MOVL W_41+164(FP), CX - MOVL W_43+172(FP), DX - XORL DX, CX - ANDL $0x00000040, CX - CMPL CX, $0x00000000 - JNE f44_in - JMP f44_skip - -f44_in: - ANDL $0xffffffbf, AX - -f44_skip: - // if (mask & DV_I_48_2_bit) != 0 { - // if not((W[63]^(W[64]>>5))&(1<<2)) != 0 || - // not(not((W[48]^(W[49]<<5))&(1<<6))) != 0 { - // mask &= ^DV_I_48_2_bit - // } - // } - BTL $0x08, AX - JNC f45_skip - MOVL W_63+252(FP), CX - MOVL W_64+256(FP), DX - SHRL $0x05, DX - XORL DX, CX - ANDL $0x00000004, CX - NEGL CX - CMPL CX, $0x00000000 - JE f45_in - MOVL W_48+192(FP), CX - MOVL W_49+196(FP), DX - SHLL $0x05, DX - XORL DX, CX - ANDL $0x00000040, CX - CMPL CX, $0x00000000 - JNE f45_in - JMP f45_skip - -f45_in: - ANDL $0xfffffeff, AX - -f45_skip: - // if (mask & DV_I_49_2_bit) != 0 { - // if not(not((W[49]^(W[50]<<5))&(1<<6))) != 0 || - // not((W[42]^W[50])&(1<<1)) != 0 || - // not(not((W[39]^(W[40]<<5))&(1<<6))) != 0 || - // not((W[38]^W[40])&(1<<1)) != 0 { - // mask &= ^DV_I_49_2_bit - // } - // } - BTL $0x0a, AX - JNC f46_skip - MOVL W_49+196(FP), CX - MOVL W_50+200(FP), DX - SHLL $0x05, DX - XORL DX, CX - ANDL $0x00000040, CX - CMPL CX, $0x00000000 - JNE f46_in - MOVL W_42+168(FP), CX - MOVL W_50+200(FP), DX - XORL DX, CX - ANDL $0x00000002, CX - CMPL CX, $0x00000000 - JE f46_in - MOVL W_39+156(FP), CX - MOVL W_40+160(FP), DX - SHLL $0x05, DX - XORL DX, CX - ANDL $0x00000040, CX - CMPL CX, $0x00000000 - JNE f46_in - MOVL W_38+152(FP), CX - MOVL W_40+160(FP), DX - XORL DX, CX - ANDL $0x00000002, CX - CMPL CX, $0x00000000 - JE f46_in - JMP f46_skip - -f46_in: - ANDL $0xfffffbff, AX - -f46_skip: - // if (mask & DV_I_50_0_bit) != 0 { - // mask &= (((W[36] ^ W[37]) << 7) | ^DV_I_50_0_bit) - // } - BTL $0x0b, AX - JNC f47 - MOVL W_36+144(FP), CX - MOVL W_37+148(FP), DX - XORL DX, CX - SHLL $0x07, CX - ORL $0xfffff7ff, CX - ANDL CX, AX - -f47: - // if (mask & DV_I_50_2_bit) != 0 { - // mask &= (((W[43] ^ W[51]) << 11) | ^DV_I_50_2_bit) - // } - BTL $0x0c, AX - JNC f48 - MOVL W_43+172(FP), CX - MOVL W_51+204(FP), DX - XORL DX, CX - SHLL $0x0b, CX - ORL $0xffffefff, CX - ANDL CX, AX - -f48: - // if (mask & DV_I_51_0_bit) != 0 { - // mask &= (((W[37] ^ W[38]) << 9) | ^DV_I_51_0_bit) - // } - BTL $0x0d, AX - JNC f49 - MOVL W_37+148(FP), CX - MOVL W_38+152(FP), DX - XORL DX, CX - SHLL $0x09, CX - ORL $0xffffdfff, CX - ANDL CX, AX - -f49: - // if (mask & DV_I_51_2_bit) != 0 { - // if not(not((W[51]^(W[52]<<5))&(1<<6))) != 0 || - // not(not((W[49]^W[51])&(1<<6))) != 0 || - // not(not((W[37]^(W[37]>>5))&(1<<1))) != 0 || - // not(not((W[35]^(W[39]>>25))&(1<<5))) != 0 { - // mask &= ^DV_I_51_2_bit - // } - // } - BTL $0x0e, AX - JNC f50_skip - MOVL W_51+204(FP), CX - MOVL W_52+208(FP), DX - SHLL $0x05, DX - XORL DX, CX - ANDL $0x00000040, CX - CMPL CX, $0x00000000 - JNE f50_in - MOVL W_49+196(FP), CX - MOVL W_51+204(FP), DX - XORL DX, CX - ANDL $0x00000040, CX - CMPL CX, $0x00000000 - JNE f50_in - MOVL W_37+148(FP), CX - MOVL W_37+148(FP), DX - SHRL $0x05, DX - XORL DX, CX - ANDL $0x00000002, CX - CMPL CX, $0x00000000 - JNE f50_in - MOVL W_35+140(FP), CX - MOVL W_39+156(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000020, CX - CMPL CX, $0x00000000 - JNE f50_in - JMP f50_skip - -f50_in: - ANDL $0xffffbfff, AX - -f50_skip: - // if (mask & DV_I_52_0_bit) != 0 { - // mask &= (((W[38] ^ W[39]) << 11) | ^DV_I_52_0_bit) - // } - BTL $0x0f, AX - JNC f51 - MOVL W_38+152(FP), CX - MOVL W_39+156(FP), DX - XORL DX, CX - SHLL $0x0b, CX - ORL $0xffff7fff, CX - ANDL CX, AX - -f51: - // if (mask & DV_II_46_2_bit) != 0 { - // mask &= (((W[47] ^ W[51]) << 17) | ^DV_II_46_2_bit) - // } - TESTL $0x00040000, AX - BTL $0x12, AX - JNC f52 - MOVL W_47+188(FP), CX - MOVL W_51+204(FP), DX - XORL DX, CX - SHLL $0x11, CX - ORL $0xfffbffff, CX - ANDL CX, AX - -f52: - // if (mask & DV_II_48_0_bit) != 0 { - // if not(not((W[36]^(W[40]>>25))&(1<<3))) != 0 || - // not((W[35]^(W[40]<<2))&(1<<30)) != 0 { - // mask &= ^DV_II_48_0_bit - // } - // } - BTL $0x14, AX - JNC f53_skip - MOVL W_36+144(FP), CX - MOVL W_40+160(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000008, CX - CMPL CX, $0x00000000 - JNE f53_in - MOVL W_35+140(FP), CX - MOVL W_40+160(FP), DX - SHLL $0x02, DX - XORL DX, CX - ANDL $0x40000000, CX - CMPL CX, $0x00000000 - JNE f53_in - JMP f53_skip - -f53_in: - ANDL $0xffefffff, AX - -f53_skip: - // if (mask & DV_II_49_0_bit) != 0 { - // if not(not((W[37]^(W[41]>>25))&(1<<3))) != 0 || - // not((W[36]^(W[41]<<2))&(1<<30)) != 0 { - // mask &= ^DV_II_49_0_bit - // } - // } - BTL $0x15, AX - JNC f54_skip - MOVL W_37+148(FP), CX - MOVL W_41+164(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000008, CX - CMPL CX, $0x00000000 - JNE f54_in - MOVL W_36+144(FP), CX - MOVL W_41+164(FP), DX - SHLL $0x02, DX - XORL DX, CX - ANDL $0x40000000, CX - CMPL CX, $0x00000000 - JNE f54_in - JMP f54_skip - -f54_in: - ANDL $0xffdfffff, AX - -f54_skip: - // if (mask & DV_II_49_2_bit) != 0 { - // if not(not((W[53]^(W[54]<<5))&(1<<6))) != 0 || - // not(not((W[51]^W[53])&(1<<6))) != 0 || - // not((W[50]^W[54])&(1<<1)) != 0 || - // not(not((W[45]^(W[46]<<5))&(1<<6))) != 0 || - // not(not((W[37]^(W[41]>>25))&(1<<5))) != 0 || - // not((W[36]^(W[41]>>30))&(1<<0)) != 0 { - // mask &= ^DV_II_49_2_bit - // } - // } - BTL $0x16, AX - JNC f55_skip - MOVL W_53+212(FP), CX - MOVL W_54+216(FP), DX - SHLL $0x05, DX - XORL DX, CX - ANDL $0x00000040, CX - CMPL CX, $0x00000000 - JNE f55_in - MOVL W_51+204(FP), CX - MOVL W_53+212(FP), DX - XORL DX, CX - ANDL $0x00000040, CX - CMPL CX, $0x00000000 - JNE f55_in - MOVL W_50+200(FP), CX - MOVL W_54+216(FP), DX - XORL DX, CX - ANDL $0x00000002, CX - NEGL CX - CMPL CX, $0x00000000 - JE f55_in - MOVL W_45+180(FP), CX - MOVL W_46+184(FP), DX - SHLL $0x05, DX - XORL DX, CX - ANDL $0x00000040, CX - CMPL CX, $0x00000000 - JNE f55_in - MOVL W_37+148(FP), CX - MOVL W_41+164(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000020, CX - CMPL CX, $0x00000000 - JNE f55_in - MOVL W_36+144(FP), CX - MOVL W_41+164(FP), DX - SHRL $0x1e, DX - XORL DX, CX - ANDL $0x00000001, CX - NEGL CX - CMPL CX, $0x00000000 - JE f55_in - JMP f55_skip - -f55_in: - ANDL $0xffbfffff, AX - -f55_skip: - // if (mask & DV_II_50_0_bit) != 0 { - // if not((W[55]^W[58])&(1<<29)) != 0 || - // not(not((W[38]^(W[42]>>25))&(1<<3))) != 0 || - // not((W[37]^(W[42]<<2))&(1<<30)) != 0 { - // mask &= ^DV_II_50_0_bit - // } - // } - BTL $0x17, AX - JNC f56_skip - MOVL W_55+220(FP), CX - MOVL W_58+232(FP), DX - XORL DX, CX - ANDL $0x20000000, CX - NEGL CX - CMPL CX, $0x00000000 - JE f56_in - MOVL W_38+152(FP), CX - MOVL W_42+168(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000008, CX - CMPL CX, $0x00000000 - JNE f56_in - MOVL W_37+148(FP), CX - MOVL W_42+168(FP), DX - SHRL $0x02, DX - XORL DX, CX - ANDL $0x40000000, CX - NEGL CX - CMPL CX, $0x00000000 - JE f56_in - JMP f56_skip - -f56_in: - ANDL $0xff7fffff, AX - -f56_skip: - // if (mask & DV_II_50_2_bit) != 0 { - // if not(not((W[54]^(W[55]<<5))&(1<<6))) != 0 || - // not(not((W[52]^W[54])&(1<<6))) != 0 || - // not((W[51]^W[55])&(1<<1)) != 0 || - // not((W[45]^W[47])&(1<<1)) != 0 || - // not(not((W[38]^(W[42]>>25))&(1<<5))) != 0 || - // not((W[37]^(W[42]>>30))&(1<<0)) != 0 { - // mask &= ^DV_II_50_2_bit - // } - // } - BTL $0x18, AX - JNC f57_skip - MOVL W_54+216(FP), CX - MOVL W_55+220(FP), DX - SHLL $0x05, DX - XORL DX, CX - ANDL $0x00000040, CX - CMPL CX, $0x00000000 - JNE f57_in - MOVL W_52+208(FP), CX - MOVL W_54+216(FP), DX - XORL DX, CX - ANDL $0x00000040, CX - CMPL CX, $0x00000000 - JNE f57_in - MOVL W_51+204(FP), CX - MOVL W_55+220(FP), DX - XORL DX, CX - ANDL $0x00000002, CX - NEGL CX - CMPL CX, $0x00000000 - JE f57_in - MOVL W_45+180(FP), CX - MOVL W_47+188(FP), DX - XORL DX, CX - ANDL $0x00000002, CX - NEGL CX - CMPL CX, $0x00000000 - JE f57_in - MOVL W_38+152(FP), CX - MOVL W_42+168(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000020, CX - CMPL CX, $0x00000000 - JNE f57_in - MOVL W_37+148(FP), CX - MOVL W_42+168(FP), DX - SHRL $0x1e, DX - XORL DX, CX - ANDL $0x00000001, CX - NEGL CX - CMPL CX, $0x00000000 - JE f57_in - JMP f57_skip - -f57_in: - ANDL $0xfeffffff, AX - -f57_skip: - // if (mask & DV_II_51_0_bit) != 0 { - // if not(not((W[39]^(W[43]>>25))&(1<<3))) != 0 || - // not((W[38]^(W[43]<<2))&(1<<30)) != 0 { - // mask &= ^DV_II_51_0_bit - // } - // } - BTL $0x19, AX - JNC f58_skip - MOVL W_39+156(FP), CX - MOVL W_43+172(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000008, CX - CMPL CX, $0x00000000 - JNE f58_in - MOVL W_38+152(FP), CX - MOVL W_43+172(FP), DX - SHLL $0x02, DX - XORL DX, CX - ANDL $0x40000000, CX - NEGL CX - CMPL CX, $0x00000000 - JE f58_in - JMP f58_skip - -f58_in: - ANDL $0xfdffffff, AX - -f58_skip: - // if (mask & DV_II_51_2_bit) != 0 { - // if not(not((W[55]^(W[56]<<5))&(1<<6))) != 0 || - // not(not((W[53]^W[55])&(1<<6))) != 0 || - // not((W[52]^W[56])&(1<<1)) != 0 || - // not((W[46]^W[48])&(1<<1)) != 0 || - // not(not((W[39]^(W[43]>>25))&(1<<5))) != 0 || - // not((W[38]^(W[43]>>30))&(1<<0)) != 0 { - // mask &= ^DV_II_51_2_bit - // } - // } - BTL $0x1a, AX - JNC f59_skip - MOVL W_55+220(FP), CX - MOVL W_56+224(FP), DX - SHLL $0x05, DX - XORL DX, CX - ANDL $0x00000040, CX - CMPL CX, $0x00000000 - JNE f59_in - MOVL W_53+212(FP), CX - MOVL W_55+220(FP), DX - XORL DX, CX - ANDL $0x00000040, CX - CMPL CX, $0x00000000 - JNE f59_in - MOVL W_52+208(FP), CX - MOVL W_56+224(FP), DX - XORL DX, CX - ANDL $0x00000002, CX - NEGL CX - CMPL CX, $0x00000000 - JE f59_in - MOVL W_46+184(FP), CX - MOVL W_48+192(FP), DX - XORL DX, CX - ANDL $0x00000002, CX - NEGL CX - CMPL CX, $0x00000000 - JE f59_in - MOVL W_39+156(FP), CX - MOVL W_43+172(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000020, CX - CMPL CX, $0x00000000 - JNE f59_in - MOVL W_38+152(FP), CX - MOVL W_43+172(FP), DX - SHRL $0x1e, DX - XORL DX, CX - ANDL $0x00000001, CX - NEGL CX - CMPL CX, $0x00000000 - JE f59_in - JMP f59_skip - -f59_in: - ANDL $0xfbffffff, AX - -f59_skip: - // if (mask & DV_II_52_0_bit) != 0 { - // if not(not((W[59]^W[60])&(1<<29))) != 0 || - // not(not((W[40]^(W[44]>>25))&(1<<3))) != 0 || - // not(not((W[40]^(W[44]>>25))&(1<<4))) != 0 || - // not((W[39]^(W[44]<<2))&(1<<30)) != 0 { - // mask &= ^DV_II_52_0_bit - // } - // } - BTL $0x1b, AX - JNC f60_skip - MOVL W_59+236(FP), CX - MOVL W_60+240(FP), DX - XORL DX, CX - ANDL $0x20000000, CX - CMPL CX, $0x00000000 - JNE f60_in - MOVL W_40+160(FP), CX - MOVL W_44+176(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000008, CX - CMPL CX, $0x00000000 - JNE f60_in - MOVL W_40+160(FP), CX - MOVL W_44+176(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000010, CX - CMPL CX, $0x00000000 - JNE f60_in - MOVL W_39+156(FP), CX - MOVL W_44+176(FP), DX - SHLL $0x02, DX - XORL DX, CX - ANDL $0x40000000, CX - NEGL CX - CMPL CX, $0x00000000 - JE f60_in - JMP f60_skip - -f60_in: - ANDL $0xf7ffffff, AX - -f60_skip: - // if (mask & DV_II_53_0_bit) != 0 { - // if not((W[58]^W[61])&(1<<29)) != 0 || - // not(not((W[57]^(W[61]>>25))&(1<<4))) != 0 || - // not(not((W[41]^(W[45]>>25))&(1<<3))) != 0 || - // not(not((W[41]^(W[45]>>25))&(1<<4))) != 0 { - // mask &= ^DV_II_53_0_bit - // } - // } - BTL $0x1c, AX - JNC f61_skip - MOVL W_58+232(FP), CX - MOVL W_61+244(FP), DX - XORL DX, CX - ANDL $0x20000000, CX - NEGL CX - CMPL CX, $0x00000000 - JE f61_in - MOVL W_57+228(FP), CX - MOVL W_61+244(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000010, CX - CMPL CX, $0x00000000 - JNE f61_in - MOVL W_41+164(FP), CX - MOVL W_45+180(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000008, CX - CMPL CX, $0x00000000 - JNE f61_in - MOVL W_41+164(FP), CX - MOVL W_45+180(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000010, CX - CMPL CX, $0x00000000 - JNE f61_in - JMP f61_skip - -f61_in: - ANDL $0xefffffff, AX - -f61_skip: - // if (mask & DV_II_54_0_bit) != 0 { - // if not(not((W[58]^(W[62]>>25))&(1<<4))) != 0 || - // not(not((W[42]^(W[46]>>25))&(1<<3))) != 0 || - // not(not((W[42]^(W[46]>>25))&(1<<4))) != 0 { - // mask &= ^DV_II_54_0_bit - // } - // } - BTL $0x1d, AX - JNC f62_skip - MOVL W_58+232(FP), CX - MOVL W_62+248(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000010, CX - CMPL CX, $0x00000000 - JNE f62_in - MOVL W_42+168(FP), CX - MOVL W_46+184(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000008, CX - CMPL CX, $0x00000000 - JNE f62_in - MOVL W_42+168(FP), CX - MOVL W_46+184(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000010, CX - CMPL CX, $0x00000000 - JNE f62_in - JMP f62_skip - -f62_in: - ANDL $0xdfffffff, AX - -f62_skip: - // if (mask & DV_II_55_0_bit) != 0 { - // if not(not((W[59]^(W[63]>>25))&(1<<4))) != 0 || - // not(not((W[57]^(W[59]>>25))&(1<<4))) != 0 || - // not(not((W[43]^(W[47]>>25))&(1<<3))) != 0 || - // not(not((W[43]^(W[47]>>25))&(1<<4))) != 0 { - // mask &= ^DV_II_55_0_bit - // } - // } - BTL $0x1e, AX - JNC f63_skip - MOVL W_59+236(FP), CX - MOVL W_63+252(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000010, CX - CMPL CX, $0x00000000 - JNE f63_in - MOVL W_57+228(FP), CX - MOVL W_59+236(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000010, CX - CMPL CX, $0x00000000 - JNE f63_in - MOVL W_43+172(FP), CX - MOVL W_47+188(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000008, CX - CMPL CX, $0x00000000 - JNE f63_in - MOVL W_43+172(FP), CX - MOVL W_47+188(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000010, CX - CMPL CX, $0x00000000 - JNE f63_in - JMP f63_skip - -f63_in: - ANDL $0xbfffffff, AX - -f63_skip: - // if (mask & DV_II_56_0_bit) != 0 { - // if not(not((W[60]^(W[64]>>25))&(1<<4))) != 0 || - // not(not((W[44]^(W[48]>>25))&(1<<3))) != 0 || - // not(not((W[44]^(W[48]>>25))&(1<<4))) != 0 { - // mask &= ^DV_II_56_0_bit - // } - // } - BTL $0x1f, AX - JNC f64_skip - MOVL W_60+240(FP), CX - MOVL W_64+256(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000010, CX - CMPL CX, $0x00000000 - JNE f64_in - MOVL W_44+176(FP), CX - MOVL W_48+192(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000008, CX - CMPL CX, $0x00000000 - JNE f64_in - MOVL W_44+176(FP), CX - MOVL W_48+192(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000010, CX - CMPL CX, $0x00000000 - JNE f64_in - JMP f64_skip - -f64_in: - ANDL $0x7fffffff, AX - -f64_skip: -end: - MOVL AX, ret+320(FP) - RET diff --git a/vendor/github.com/pjbgf/sha1cd/ubc/ubc_generic.go b/vendor/github.com/pjbgf/sha1cd/ubc/ubc_generic.go deleted file mode 100644 index ee95bd52d..000000000 --- a/vendor/github.com/pjbgf/sha1cd/ubc/ubc_generic.go +++ /dev/null @@ -1,368 +0,0 @@ -// Based on the C implementation from Marc Stevens and Dan Shumow. -// https://github.com/cr-marcstevens/sha1collisiondetection - -package ubc - -type DvInfo struct { - // DvType, DvK and DvB define the DV: I(K,B) or II(K,B) (see the paper). - // https://marc-stevens.nl/research/papers/C13-S.pdf - DvType uint32 - DvK uint32 - DvB uint32 - - // TestT is the step to do the recompression from for collision detection. - TestT uint32 - - // MaskI and MaskB define the bit to check for each DV in the dvmask returned by ubc_check. - MaskI uint32 - MaskB uint32 - - // Dm is the expanded message block XOR-difference defined by the DV. - Dm [80]uint32 -} - -// CalculateDvMask takes as input an expanded message block and verifies the unavoidable bitconditions -// for all listed DVs. It returns a dvmask where each bit belonging to a DV is set if all -// unavoidable bitconditions for that DV have been met. -// Thus, one needs to do the recompression check for each DV that has its bit set. -func CalculateDvMaskGeneric(W [80]uint32) uint32 { - mask := uint32(0xFFFFFFFF) - mask &= (((((W[44] ^ W[45]) >> 29) & 1) - 1) | ^(DV_I_48_0_bit | DV_I_51_0_bit | DV_I_52_0_bit | DV_II_45_0_bit | DV_II_46_0_bit | DV_II_50_0_bit | DV_II_51_0_bit)) - mask &= (((((W[49] ^ W[50]) >> 29) & 1) - 1) | ^(DV_I_46_0_bit | DV_II_45_0_bit | DV_II_50_0_bit | DV_II_51_0_bit | DV_II_55_0_bit | DV_II_56_0_bit)) - mask &= (((((W[48] ^ W[49]) >> 29) & 1) - 1) | ^(DV_I_45_0_bit | DV_I_52_0_bit | DV_II_49_0_bit | DV_II_50_0_bit | DV_II_54_0_bit | DV_II_55_0_bit)) - mask &= ((((W[47] ^ (W[50] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_I_47_0_bit | DV_I_49_0_bit | DV_I_51_0_bit | DV_II_45_0_bit | DV_II_51_0_bit | DV_II_56_0_bit)) - mask &= (((((W[47] ^ W[48]) >> 29) & 1) - 1) | ^(DV_I_44_0_bit | DV_I_51_0_bit | DV_II_48_0_bit | DV_II_49_0_bit | DV_II_53_0_bit | DV_II_54_0_bit)) - mask &= (((((W[46] >> 4) ^ (W[49] >> 29)) & 1) - 1) | ^(DV_I_46_0_bit | DV_I_48_0_bit | DV_I_50_0_bit | DV_I_52_0_bit | DV_II_50_0_bit | DV_II_55_0_bit)) - mask &= (((((W[46] ^ W[47]) >> 29) & 1) - 1) | ^(DV_I_43_0_bit | DV_I_50_0_bit | DV_II_47_0_bit | DV_II_48_0_bit | DV_II_52_0_bit | DV_II_53_0_bit)) - mask &= (((((W[45] >> 4) ^ (W[48] >> 29)) & 1) - 1) | ^(DV_I_45_0_bit | DV_I_47_0_bit | DV_I_49_0_bit | DV_I_51_0_bit | DV_II_49_0_bit | DV_II_54_0_bit)) - mask &= (((((W[45] ^ W[46]) >> 29) & 1) - 1) | ^(DV_I_49_0_bit | DV_I_52_0_bit | DV_II_46_0_bit | DV_II_47_0_bit | DV_II_51_0_bit | DV_II_52_0_bit)) - mask &= (((((W[44] >> 4) ^ (W[47] >> 29)) & 1) - 1) | ^(DV_I_44_0_bit | DV_I_46_0_bit | DV_I_48_0_bit | DV_I_50_0_bit | DV_II_48_0_bit | DV_II_53_0_bit)) - mask &= (((((W[43] >> 4) ^ (W[46] >> 29)) & 1) - 1) | ^(DV_I_43_0_bit | DV_I_45_0_bit | DV_I_47_0_bit | DV_I_49_0_bit | DV_II_47_0_bit | DV_II_52_0_bit)) - mask &= (((((W[43] ^ W[44]) >> 29) & 1) - 1) | ^(DV_I_47_0_bit | DV_I_50_0_bit | DV_I_51_0_bit | DV_II_45_0_bit | DV_II_49_0_bit | DV_II_50_0_bit)) - mask &= (((((W[42] >> 4) ^ (W[45] >> 29)) & 1) - 1) | ^(DV_I_44_0_bit | DV_I_46_0_bit | DV_I_48_0_bit | DV_I_52_0_bit | DV_II_46_0_bit | DV_II_51_0_bit)) - mask &= (((((W[41] >> 4) ^ (W[44] >> 29)) & 1) - 1) | ^(DV_I_43_0_bit | DV_I_45_0_bit | DV_I_47_0_bit | DV_I_51_0_bit | DV_II_45_0_bit | DV_II_50_0_bit)) - mask &= (((((W[40] ^ W[41]) >> 29) & 1) - 1) | ^(DV_I_44_0_bit | DV_I_47_0_bit | DV_I_48_0_bit | DV_II_46_0_bit | DV_II_47_0_bit | DV_II_56_0_bit)) - mask &= (((((W[54] ^ W[55]) >> 29) & 1) - 1) | ^(DV_I_51_0_bit | DV_II_47_0_bit | DV_II_50_0_bit | DV_II_55_0_bit | DV_II_56_0_bit)) - mask &= (((((W[53] ^ W[54]) >> 29) & 1) - 1) | ^(DV_I_50_0_bit | DV_II_46_0_bit | DV_II_49_0_bit | DV_II_54_0_bit | DV_II_55_0_bit)) - mask &= (((((W[52] ^ W[53]) >> 29) & 1) - 1) | ^(DV_I_49_0_bit | DV_II_45_0_bit | DV_II_48_0_bit | DV_II_53_0_bit | DV_II_54_0_bit)) - mask &= ((((W[50] ^ (W[53] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_I_50_0_bit | DV_I_52_0_bit | DV_II_46_0_bit | DV_II_48_0_bit | DV_II_54_0_bit)) - mask &= (((((W[50] ^ W[51]) >> 29) & 1) - 1) | ^(DV_I_47_0_bit | DV_II_46_0_bit | DV_II_51_0_bit | DV_II_52_0_bit | DV_II_56_0_bit)) - mask &= ((((W[49] ^ (W[52] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_I_49_0_bit | DV_I_51_0_bit | DV_II_45_0_bit | DV_II_47_0_bit | DV_II_53_0_bit)) - mask &= ((((W[48] ^ (W[51] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_I_48_0_bit | DV_I_50_0_bit | DV_I_52_0_bit | DV_II_46_0_bit | DV_II_52_0_bit)) - mask &= (((((W[42] ^ W[43]) >> 29) & 1) - 1) | ^(DV_I_46_0_bit | DV_I_49_0_bit | DV_I_50_0_bit | DV_II_48_0_bit | DV_II_49_0_bit)) - mask &= (((((W[41] ^ W[42]) >> 29) & 1) - 1) | ^(DV_I_45_0_bit | DV_I_48_0_bit | DV_I_49_0_bit | DV_II_47_0_bit | DV_II_48_0_bit)) - mask &= (((((W[40] >> 4) ^ (W[43] >> 29)) & 1) - 1) | ^(DV_I_44_0_bit | DV_I_46_0_bit | DV_I_50_0_bit | DV_II_49_0_bit | DV_II_56_0_bit)) - mask &= (((((W[39] >> 4) ^ (W[42] >> 29)) & 1) - 1) | ^(DV_I_43_0_bit | DV_I_45_0_bit | DV_I_49_0_bit | DV_II_48_0_bit | DV_II_55_0_bit)) - - if (mask & (DV_I_44_0_bit | DV_I_48_0_bit | DV_II_47_0_bit | DV_II_54_0_bit | DV_II_56_0_bit)) != 0 { - mask &= (((((W[38] >> 4) ^ (W[41] >> 29)) & 1) - 1) | ^(DV_I_44_0_bit | DV_I_48_0_bit | DV_II_47_0_bit | DV_II_54_0_bit | DV_II_56_0_bit)) - } - mask &= (((((W[37] >> 4) ^ (W[40] >> 29)) & 1) - 1) | ^(DV_I_43_0_bit | DV_I_47_0_bit | DV_II_46_0_bit | DV_II_53_0_bit | DV_II_55_0_bit)) - if (mask & (DV_I_52_0_bit | DV_II_48_0_bit | DV_II_51_0_bit | DV_II_56_0_bit)) != 0 { - mask &= (((((W[55] ^ W[56]) >> 29) & 1) - 1) | ^(DV_I_52_0_bit | DV_II_48_0_bit | DV_II_51_0_bit | DV_II_56_0_bit)) - } - if (mask & (DV_I_52_0_bit | DV_II_48_0_bit | DV_II_50_0_bit | DV_II_56_0_bit)) != 0 { - mask &= ((((W[52] ^ (W[55] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_I_52_0_bit | DV_II_48_0_bit | DV_II_50_0_bit | DV_II_56_0_bit)) - } - if (mask & (DV_I_51_0_bit | DV_II_47_0_bit | DV_II_49_0_bit | DV_II_55_0_bit)) != 0 { - mask &= ((((W[51] ^ (W[54] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_I_51_0_bit | DV_II_47_0_bit | DV_II_49_0_bit | DV_II_55_0_bit)) - } - if (mask & (DV_I_48_0_bit | DV_II_47_0_bit | DV_II_52_0_bit | DV_II_53_0_bit)) != 0 { - mask &= (((((W[51] ^ W[52]) >> 29) & 1) - 1) | ^(DV_I_48_0_bit | DV_II_47_0_bit | DV_II_52_0_bit | DV_II_53_0_bit)) - } - if (mask & (DV_I_46_0_bit | DV_I_49_0_bit | DV_II_45_0_bit | DV_II_48_0_bit)) != 0 { - mask &= (((((W[36] >> 4) ^ (W[40] >> 29)) & 1) - 1) | ^(DV_I_46_0_bit | DV_I_49_0_bit | DV_II_45_0_bit | DV_II_48_0_bit)) - } - if (mask & (DV_I_52_0_bit | DV_II_48_0_bit | DV_II_49_0_bit)) != 0 { - mask &= ((0 - (((W[53] ^ W[56]) >> 29) & 1)) | ^(DV_I_52_0_bit | DV_II_48_0_bit | DV_II_49_0_bit)) - } - if (mask & (DV_I_50_0_bit | DV_II_46_0_bit | DV_II_47_0_bit)) != 0 { - mask &= ((0 - (((W[51] ^ W[54]) >> 29) & 1)) | ^(DV_I_50_0_bit | DV_II_46_0_bit | DV_II_47_0_bit)) - } - if (mask & (DV_I_49_0_bit | DV_I_51_0_bit | DV_II_45_0_bit)) != 0 { - mask &= ((0 - (((W[50] ^ W[52]) >> 29) & 1)) | ^(DV_I_49_0_bit | DV_I_51_0_bit | DV_II_45_0_bit)) - } - if (mask & (DV_I_48_0_bit | DV_I_50_0_bit | DV_I_52_0_bit)) != 0 { - mask &= ((0 - (((W[49] ^ W[51]) >> 29) & 1)) | ^(DV_I_48_0_bit | DV_I_50_0_bit | DV_I_52_0_bit)) - } - if (mask & (DV_I_47_0_bit | DV_I_49_0_bit | DV_I_51_0_bit)) != 0 { - mask &= ((0 - (((W[48] ^ W[50]) >> 29) & 1)) | ^(DV_I_47_0_bit | DV_I_49_0_bit | DV_I_51_0_bit)) - } - if (mask & (DV_I_46_0_bit | DV_I_48_0_bit | DV_I_50_0_bit)) != 0 { - mask &= ((0 - (((W[47] ^ W[49]) >> 29) & 1)) | ^(DV_I_46_0_bit | DV_I_48_0_bit | DV_I_50_0_bit)) - } - if (mask & (DV_I_45_0_bit | DV_I_47_0_bit | DV_I_49_0_bit)) != 0 { - mask &= ((0 - (((W[46] ^ W[48]) >> 29) & 1)) | ^(DV_I_45_0_bit | DV_I_47_0_bit | DV_I_49_0_bit)) - } - mask &= ((((W[45] ^ W[47]) & (1 << 6)) - (1 << 6)) | ^(DV_I_47_2_bit | DV_I_49_2_bit | DV_I_51_2_bit)) - if (mask & (DV_I_44_0_bit | DV_I_46_0_bit | DV_I_48_0_bit)) != 0 { - mask &= ((0 - (((W[45] ^ W[47]) >> 29) & 1)) | ^(DV_I_44_0_bit | DV_I_46_0_bit | DV_I_48_0_bit)) - } - mask &= (((((W[44] ^ W[46]) >> 6) & 1) - 1) | ^(DV_I_46_2_bit | DV_I_48_2_bit | DV_I_50_2_bit)) - if (mask & (DV_I_43_0_bit | DV_I_45_0_bit | DV_I_47_0_bit)) != 0 { - mask &= ((0 - (((W[44] ^ W[46]) >> 29) & 1)) | ^(DV_I_43_0_bit | DV_I_45_0_bit | DV_I_47_0_bit)) - } - mask &= ((0 - ((W[41] ^ (W[42] >> 5)) & (1 << 1))) | ^(DV_I_48_2_bit | DV_II_46_2_bit | DV_II_51_2_bit)) - mask &= ((0 - ((W[40] ^ (W[41] >> 5)) & (1 << 1))) | ^(DV_I_47_2_bit | DV_I_51_2_bit | DV_II_50_2_bit)) - if (mask & (DV_I_44_0_bit | DV_I_46_0_bit | DV_II_56_0_bit)) != 0 { - mask &= ((0 - (((W[40] ^ W[42]) >> 4) & 1)) | ^(DV_I_44_0_bit | DV_I_46_0_bit | DV_II_56_0_bit)) - } - mask &= ((0 - ((W[39] ^ (W[40] >> 5)) & (1 << 1))) | ^(DV_I_46_2_bit | DV_I_50_2_bit | DV_II_49_2_bit)) - if (mask & (DV_I_43_0_bit | DV_I_45_0_bit | DV_II_55_0_bit)) != 0 { - mask &= ((0 - (((W[39] ^ W[41]) >> 4) & 1)) | ^(DV_I_43_0_bit | DV_I_45_0_bit | DV_II_55_0_bit)) - } - if (mask & (DV_I_44_0_bit | DV_II_54_0_bit | DV_II_56_0_bit)) != 0 { - mask &= ((0 - (((W[38] ^ W[40]) >> 4) & 1)) | ^(DV_I_44_0_bit | DV_II_54_0_bit | DV_II_56_0_bit)) - } - if (mask & (DV_I_43_0_bit | DV_II_53_0_bit | DV_II_55_0_bit)) != 0 { - mask &= ((0 - (((W[37] ^ W[39]) >> 4) & 1)) | ^(DV_I_43_0_bit | DV_II_53_0_bit | DV_II_55_0_bit)) - } - mask &= ((0 - ((W[36] ^ (W[37] >> 5)) & (1 << 1))) | ^(DV_I_47_2_bit | DV_I_50_2_bit | DV_II_46_2_bit)) - if (mask & (DV_I_45_0_bit | DV_I_48_0_bit | DV_II_47_0_bit)) != 0 { - mask &= (((((W[35] >> 4) ^ (W[39] >> 29)) & 1) - 1) | ^(DV_I_45_0_bit | DV_I_48_0_bit | DV_II_47_0_bit)) - } - if (mask & (DV_I_48_0_bit | DV_II_48_0_bit)) != 0 { - mask &= ((0 - ((W[63] ^ (W[64] >> 5)) & (1 << 0))) | ^(DV_I_48_0_bit | DV_II_48_0_bit)) - } - if (mask & (DV_I_45_0_bit | DV_II_45_0_bit)) != 0 { - mask &= ((0 - ((W[63] ^ (W[64] >> 5)) & (1 << 1))) | ^(DV_I_45_0_bit | DV_II_45_0_bit)) - } - if (mask & (DV_I_47_0_bit | DV_II_47_0_bit)) != 0 { - mask &= ((0 - ((W[62] ^ (W[63] >> 5)) & (1 << 0))) | ^(DV_I_47_0_bit | DV_II_47_0_bit)) - } - if (mask & (DV_I_46_0_bit | DV_II_46_0_bit)) != 0 { - mask &= ((0 - ((W[61] ^ (W[62] >> 5)) & (1 << 0))) | ^(DV_I_46_0_bit | DV_II_46_0_bit)) - } - mask &= ((0 - ((W[61] ^ (W[62] >> 5)) & (1 << 2))) | ^(DV_I_46_2_bit | DV_II_46_2_bit)) - if (mask & (DV_I_45_0_bit | DV_II_45_0_bit)) != 0 { - mask &= ((0 - ((W[60] ^ (W[61] >> 5)) & (1 << 0))) | ^(DV_I_45_0_bit | DV_II_45_0_bit)) - } - if (mask & (DV_II_51_0_bit | DV_II_54_0_bit)) != 0 { - mask &= (((((W[58] ^ W[59]) >> 29) & 1) - 1) | ^(DV_II_51_0_bit | DV_II_54_0_bit)) - } - if (mask & (DV_II_50_0_bit | DV_II_53_0_bit)) != 0 { - mask &= (((((W[57] ^ W[58]) >> 29) & 1) - 1) | ^(DV_II_50_0_bit | DV_II_53_0_bit)) - } - if (mask & (DV_II_52_0_bit | DV_II_54_0_bit)) != 0 { - mask &= ((((W[56] ^ (W[59] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_II_52_0_bit | DV_II_54_0_bit)) - } - if (mask & (DV_II_51_0_bit | DV_II_52_0_bit)) != 0 { - mask &= ((0 - (((W[56] ^ W[59]) >> 29) & 1)) | ^(DV_II_51_0_bit | DV_II_52_0_bit)) - } - if (mask & (DV_II_49_0_bit | DV_II_52_0_bit)) != 0 { - mask &= (((((W[56] ^ W[57]) >> 29) & 1) - 1) | ^(DV_II_49_0_bit | DV_II_52_0_bit)) - } - if (mask & (DV_II_51_0_bit | DV_II_53_0_bit)) != 0 { - mask &= ((((W[55] ^ (W[58] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_II_51_0_bit | DV_II_53_0_bit)) - } - if (mask & (DV_II_50_0_bit | DV_II_52_0_bit)) != 0 { - mask &= ((((W[54] ^ (W[57] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_II_50_0_bit | DV_II_52_0_bit)) - } - if (mask & (DV_II_49_0_bit | DV_II_51_0_bit)) != 0 { - mask &= ((((W[53] ^ (W[56] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_II_49_0_bit | DV_II_51_0_bit)) - } - mask &= ((((W[51] ^ (W[50] >> 5)) & (1 << 1)) - (1 << 1)) | ^(DV_I_50_2_bit | DV_II_46_2_bit)) - mask &= ((((W[48] ^ W[50]) & (1 << 6)) - (1 << 6)) | ^(DV_I_50_2_bit | DV_II_46_2_bit)) - if (mask & (DV_I_51_0_bit | DV_I_52_0_bit)) != 0 { - mask &= ((0 - (((W[48] ^ W[55]) >> 29) & 1)) | ^(DV_I_51_0_bit | DV_I_52_0_bit)) - } - mask &= ((((W[47] ^ W[49]) & (1 << 6)) - (1 << 6)) | ^(DV_I_49_2_bit | DV_I_51_2_bit)) - mask &= ((((W[48] ^ (W[47] >> 5)) & (1 << 1)) - (1 << 1)) | ^(DV_I_47_2_bit | DV_II_51_2_bit)) - mask &= ((((W[46] ^ W[48]) & (1 << 6)) - (1 << 6)) | ^(DV_I_48_2_bit | DV_I_50_2_bit)) - mask &= ((((W[47] ^ (W[46] >> 5)) & (1 << 1)) - (1 << 1)) | ^(DV_I_46_2_bit | DV_II_50_2_bit)) - mask &= ((0 - ((W[44] ^ (W[45] >> 5)) & (1 << 1))) | ^(DV_I_51_2_bit | DV_II_49_2_bit)) - mask &= ((((W[43] ^ W[45]) & (1 << 6)) - (1 << 6)) | ^(DV_I_47_2_bit | DV_I_49_2_bit)) - mask &= (((((W[42] ^ W[44]) >> 6) & 1) - 1) | ^(DV_I_46_2_bit | DV_I_48_2_bit)) - mask &= ((((W[43] ^ (W[42] >> 5)) & (1 << 1)) - (1 << 1)) | ^(DV_II_46_2_bit | DV_II_51_2_bit)) - mask &= ((((W[42] ^ (W[41] >> 5)) & (1 << 1)) - (1 << 1)) | ^(DV_I_51_2_bit | DV_II_50_2_bit)) - mask &= ((((W[41] ^ (W[40] >> 5)) & (1 << 1)) - (1 << 1)) | ^(DV_I_50_2_bit | DV_II_49_2_bit)) - if (mask & (DV_I_52_0_bit | DV_II_51_0_bit)) != 0 { - mask &= ((((W[39] ^ (W[43] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_I_52_0_bit | DV_II_51_0_bit)) - } - if (mask & (DV_I_51_0_bit | DV_II_50_0_bit)) != 0 { - mask &= ((((W[38] ^ (W[42] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_I_51_0_bit | DV_II_50_0_bit)) - } - if (mask & (DV_I_48_2_bit | DV_I_51_2_bit)) != 0 { - mask &= ((0 - ((W[37] ^ (W[38] >> 5)) & (1 << 1))) | ^(DV_I_48_2_bit | DV_I_51_2_bit)) - } - if (mask & (DV_I_50_0_bit | DV_II_49_0_bit)) != 0 { - mask &= ((((W[37] ^ (W[41] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_I_50_0_bit | DV_II_49_0_bit)) - } - if (mask & (DV_II_52_0_bit | DV_II_54_0_bit)) != 0 { - mask &= ((0 - ((W[36] ^ W[38]) & (1 << 4))) | ^(DV_II_52_0_bit | DV_II_54_0_bit)) - } - mask &= ((0 - ((W[35] ^ (W[36] >> 5)) & (1 << 1))) | ^(DV_I_46_2_bit | DV_I_49_2_bit)) - if (mask & (DV_I_51_0_bit | DV_II_47_0_bit)) != 0 { - mask &= ((((W[35] ^ (W[39] >> 25)) & (1 << 3)) - (1 << 3)) | ^(DV_I_51_0_bit | DV_II_47_0_bit)) - } - - if mask != 0 { - if (mask & DV_I_43_0_bit) != 0 { - if not((W[61]^(W[62]>>5))&(1<<1)) != 0 || - not(not((W[59]^(W[63]>>25))&(1<<5))) != 0 || - not((W[58]^(W[63]>>30))&(1<<0)) != 0 { - mask &= ^DV_I_43_0_bit - } - } - if (mask & DV_I_44_0_bit) != 0 { - if not((W[62]^(W[63]>>5))&(1<<1)) != 0 || - not(not((W[60]^(W[64]>>25))&(1<<5))) != 0 || - not((W[59]^(W[64]>>30))&(1<<0)) != 0 { - mask &= ^DV_I_44_0_bit - } - } - if (mask & DV_I_46_2_bit) != 0 { - mask &= ((^((W[40] ^ W[42]) >> 2)) | ^DV_I_46_2_bit) - } - if (mask & DV_I_47_2_bit) != 0 { - if not((W[62]^(W[63]>>5))&(1<<2)) != 0 || - not(not((W[41]^W[43])&(1<<6))) != 0 { - mask &= ^DV_I_47_2_bit - } - } - if (mask & DV_I_48_2_bit) != 0 { - if not((W[63]^(W[64]>>5))&(1<<2)) != 0 || - not(not((W[48]^(W[49]<<5))&(1<<6))) != 0 { - mask &= ^DV_I_48_2_bit - } - } - if (mask & DV_I_49_2_bit) != 0 { - if not(not((W[49]^(W[50]<<5))&(1<<6))) != 0 || - not((W[42]^W[50])&(1<<1)) != 0 || - not(not((W[39]^(W[40]<<5))&(1<<6))) != 0 || - not((W[38]^W[40])&(1<<1)) != 0 { - mask &= ^DV_I_49_2_bit - } - } - if (mask & DV_I_50_0_bit) != 0 { - mask &= (((W[36] ^ W[37]) << 7) | ^DV_I_50_0_bit) - } - if (mask & DV_I_50_2_bit) != 0 { - mask &= (((W[43] ^ W[51]) << 11) | ^DV_I_50_2_bit) - } - if (mask & DV_I_51_0_bit) != 0 { - mask &= (((W[37] ^ W[38]) << 9) | ^DV_I_51_0_bit) - } - if (mask & DV_I_51_2_bit) != 0 { - if not(not((W[51]^(W[52]<<5))&(1<<6))) != 0 || - not(not((W[49]^W[51])&(1<<6))) != 0 || - not(not((W[37]^(W[37]>>5))&(1<<1))) != 0 || - not(not((W[35]^(W[39]>>25))&(1<<5))) != 0 { - mask &= ^DV_I_51_2_bit - } - } - if (mask & DV_I_52_0_bit) != 0 { - mask &= (((W[38] ^ W[39]) << 11) | ^DV_I_52_0_bit) - } - if (mask & DV_II_46_2_bit) != 0 { - mask &= (((W[47] ^ W[51]) << 17) | ^DV_II_46_2_bit) - } - if (mask & DV_II_48_0_bit) != 0 { - if not(not((W[36]^(W[40]>>25))&(1<<3))) != 0 || - not((W[35]^(W[40]<<2))&(1<<30)) != 0 { - mask &= ^DV_II_48_0_bit - } - } - if (mask & DV_II_49_0_bit) != 0 { - if not(not((W[37]^(W[41]>>25))&(1<<3))) != 0 || - not((W[36]^(W[41]<<2))&(1<<30)) != 0 { - mask &= ^DV_II_49_0_bit - } - } - if (mask & DV_II_49_2_bit) != 0 { - if not(not((W[53]^(W[54]<<5))&(1<<6))) != 0 || - not(not((W[51]^W[53])&(1<<6))) != 0 || - not((W[50]^W[54])&(1<<1)) != 0 || - not(not((W[45]^(W[46]<<5))&(1<<6))) != 0 || - not(not((W[37]^(W[41]>>25))&(1<<5))) != 0 || - not((W[36]^(W[41]>>30))&(1<<0)) != 0 { - mask &= ^DV_II_49_2_bit - } - } - if (mask & DV_II_50_0_bit) != 0 { - if not((W[55]^W[58])&(1<<29)) != 0 || - not(not((W[38]^(W[42]>>25))&(1<<3))) != 0 || - not((W[37]^(W[42]<<2))&(1<<30)) != 0 { - mask &= ^DV_II_50_0_bit - } - } - if (mask & DV_II_50_2_bit) != 0 { - if not(not((W[54]^(W[55]<<5))&(1<<6))) != 0 || - not(not((W[52]^W[54])&(1<<6))) != 0 || - not((W[51]^W[55])&(1<<1)) != 0 || - not((W[45]^W[47])&(1<<1)) != 0 || - not(not((W[38]^(W[42]>>25))&(1<<5))) != 0 || - not((W[37]^(W[42]>>30))&(1<<0)) != 0 { - mask &= ^DV_II_50_2_bit - } - } - if (mask & DV_II_51_0_bit) != 0 { - if not(not((W[39]^(W[43]>>25))&(1<<3))) != 0 || - not((W[38]^(W[43]<<2))&(1<<30)) != 0 { - mask &= ^DV_II_51_0_bit - } - } - if (mask & DV_II_51_2_bit) != 0 { - if not(not((W[55]^(W[56]<<5))&(1<<6))) != 0 || - not(not((W[53]^W[55])&(1<<6))) != 0 || - not((W[52]^W[56])&(1<<1)) != 0 || - not((W[46]^W[48])&(1<<1)) != 0 || - not(not((W[39]^(W[43]>>25))&(1<<5))) != 0 || - not((W[38]^(W[43]>>30))&(1<<0)) != 0 { - mask &= ^DV_II_51_2_bit - } - } - if (mask & DV_II_52_0_bit) != 0 { - if not(not((W[59]^W[60])&(1<<29))) != 0 || - not(not((W[40]^(W[44]>>25))&(1<<3))) != 0 || - not(not((W[40]^(W[44]>>25))&(1<<4))) != 0 || - not((W[39]^(W[44]<<2))&(1<<30)) != 0 { - mask &= ^DV_II_52_0_bit - } - } - if (mask & DV_II_53_0_bit) != 0 { - if not((W[58]^W[61])&(1<<29)) != 0 || - not(not((W[57]^(W[61]>>25))&(1<<4))) != 0 || - not(not((W[41]^(W[45]>>25))&(1<<3))) != 0 || - not(not((W[41]^(W[45]>>25))&(1<<4))) != 0 { - mask &= ^DV_II_53_0_bit - } - } - if (mask & DV_II_54_0_bit) != 0 { - if not(not((W[58]^(W[62]>>25))&(1<<4))) != 0 || - not(not((W[42]^(W[46]>>25))&(1<<3))) != 0 || - not(not((W[42]^(W[46]>>25))&(1<<4))) != 0 { - mask &= ^DV_II_54_0_bit - } - } - if (mask & DV_II_55_0_bit) != 0 { - if not(not((W[59]^(W[63]>>25))&(1<<4))) != 0 || - not(not((W[57]^(W[59]>>25))&(1<<4))) != 0 || - not(not((W[43]^(W[47]>>25))&(1<<3))) != 0 || - not(not((W[43]^(W[47]>>25))&(1<<4))) != 0 { - mask &= ^DV_II_55_0_bit - } - } - if (mask & DV_II_56_0_bit) != 0 { - if not(not((W[60]^(W[64]>>25))&(1<<4))) != 0 || - not(not((W[44]^(W[48]>>25))&(1<<3))) != 0 || - not(not((W[44]^(W[48]>>25))&(1<<4))) != 0 { - mask &= ^DV_II_56_0_bit - } - } - } - - return mask -} - -func not(x uint32) uint32 { - if x == 0 { - return 1 - } - - return 0 -} - -func SHA1_dvs() []DvInfo { - return sha1_dvs -} diff --git a/vendor/github.com/pjbgf/sha1cd/ubc/ubc_noasm.go b/vendor/github.com/pjbgf/sha1cd/ubc/ubc_noasm.go deleted file mode 100644 index 48d6dff16..000000000 --- a/vendor/github.com/pjbgf/sha1cd/ubc/ubc_noasm.go +++ /dev/null @@ -1,12 +0,0 @@ -//go:build !amd64 || noasm || !gc -// +build !amd64 noasm !gc - -package ubc - -// Check takes as input an expanded message block and verifies the unavoidable bitconditions -// for all listed DVs. It returns a dvmask where each bit belonging to a DV is set if all -// unavoidable bitconditions for that DV have been met. -// Thus, one needs to do the recompression check for each DV that has its bit set. -func CalculateDvMask(W [80]uint32) uint32 { - return CalculateDvMaskGeneric(W) -} diff --git a/vendor/golang.org/x/exp/maps/maps.go b/vendor/golang.org/x/exp/maps/maps.go index c25939b92..4a9747ef4 100644 --- a/vendor/golang.org/x/exp/maps/maps.go +++ b/vendor/golang.org/x/exp/maps/maps.go @@ -7,17 +7,13 @@ package maps import "maps" -// TODO(adonovan): when https://go.dev/issue/32816 is accepted, all of -// these functions except Keys and Values should be annotated -// (provisionally with "//go:fix inline") so that tools can safely and -// automatically replace calls to exp/maps with calls to std maps by -// inlining them. - // Keys returns the keys of the map m. // The keys will be in an indeterminate order. +// +// The simplest true equivalent using the standard library is: +// +// slices.AppendSeq(make([]K, 0, len(m)), maps.Keys(m)) func Keys[M ~map[K]V, K comparable, V any](m M) []K { - // The simplest true equivalent using std is: - // return slices.AppendSeq(make([]K, 0, len(m)), maps.Keys(m)). r := make([]K, 0, len(m)) for k := range m { @@ -28,9 +24,11 @@ func Keys[M ~map[K]V, K comparable, V any](m M) []K { // Values returns the values of the map m. // The values will be in an indeterminate order. +// +// The simplest true equivalent using the standard library is: +// +// slices.AppendSeq(make([]V, 0, len(m)), maps.Values(m)) func Values[M ~map[K]V, K comparable, V any](m M) []V { - // The simplest true equivalent using std is: - // return slices.AppendSeq(make([]V, 0, len(m)), maps.Values(m)). r := make([]V, 0, len(m)) for _, v := range m { @@ -41,23 +39,31 @@ func Values[M ~map[K]V, K comparable, V any](m M) []V { // Equal reports whether two maps contain the same key/value pairs. // Values are compared using ==. +// +//go:fix inline func Equal[M1, M2 ~map[K]V, K, V comparable](m1 M1, m2 M2) bool { return maps.Equal(m1, m2) } // EqualFunc is like Equal, but compares values using eq. // Keys are still compared with ==. +// +//go:fix inline func EqualFunc[M1 ~map[K]V1, M2 ~map[K]V2, K comparable, V1, V2 any](m1 M1, m2 M2, eq func(V1, V2) bool) bool { return maps.EqualFunc(m1, m2, eq) } // Clear removes all entries from m, leaving it empty. +// +//go:fix inline func Clear[M ~map[K]V, K comparable, V any](m M) { clear(m) } // Clone returns a copy of m. This is a shallow clone: // the new keys and values are set using ordinary assignment. +// +//go:fix inline func Clone[M ~map[K]V, K comparable, V any](m M) M { return maps.Clone(m) } @@ -66,11 +72,15 @@ func Clone[M ~map[K]V, K comparable, V any](m M) M { // When a key in src is already present in dst, // the value in dst will be overwritten by the value associated // with the key in src. +// +//go:fix inline func Copy[M1 ~map[K]V, M2 ~map[K]V, K comparable, V any](dst M1, src M2) { maps.Copy(dst, src) } // DeleteFunc deletes any key/value pairs from m for which del returns true. +// +//go:fix inline func DeleteFunc[M ~map[K]V, K comparable, V any](m M, del func(K, V) bool) { maps.DeleteFunc(m, del) } diff --git a/vendor/golang.org/x/exp/slices/slices.go b/vendor/golang.org/x/exp/slices/slices.go index 757383ea1..da0df370d 100644 --- a/vendor/golang.org/x/exp/slices/slices.go +++ b/vendor/golang.org/x/exp/slices/slices.go @@ -10,16 +10,13 @@ import ( "slices" ) -// TODO(adonovan): when https://go.dev/issue/32816 is accepted, all of -// these functions should be annotated (provisionally with "//go:fix -// inline") so that tools can safely and automatically replace calls -// to exp/slices with calls to std slices by inlining them. - // Equal reports whether two slices are equal: the same length and all // elements equal. If the lengths are different, Equal returns false. // Otherwise, the elements are compared in increasing index order, and the // comparison stops at the first unequal pair. // Floating point NaNs are not considered equal. +// +//go:fix inline func Equal[S ~[]E, E comparable](s1, s2 S) bool { return slices.Equal(s1, s2) } @@ -29,6 +26,8 @@ func Equal[S ~[]E, E comparable](s1, s2 S) bool { // EqualFunc returns false. Otherwise, the elements are compared in // increasing index order, and the comparison stops at the first index // for which eq returns false. +// +//go:fix inline func EqualFunc[S1 ~[]E1, S2 ~[]E2, E1, E2 any](s1 S1, s2 S2, eq func(E1, E2) bool) bool { return slices.EqualFunc(s1, s2, eq) } @@ -40,6 +39,8 @@ func EqualFunc[S1 ~[]E1, S2 ~[]E2, E1, E2 any](s1 S1, s2 S2, eq func(E1, E2) boo // If both slices are equal until one of them ends, the shorter slice is // considered less than the longer one. // The result is 0 if s1 == s2, -1 if s1 < s2, and +1 if s1 > s2. +// +//go:fix inline func Compare[S ~[]E, E cmp.Ordered](s1, s2 S) int { return slices.Compare(s1, s2) } @@ -49,29 +50,39 @@ func Compare[S ~[]E, E cmp.Ordered](s1, s2 S) int { // The result is the first non-zero result of cmp; if cmp always // returns 0 the result is 0 if len(s1) == len(s2), -1 if len(s1) < len(s2), // and +1 if len(s1) > len(s2). +// +//go:fix inline func CompareFunc[S1 ~[]E1, S2 ~[]E2, E1, E2 any](s1 S1, s2 S2, cmp func(E1, E2) int) int { return slices.CompareFunc(s1, s2, cmp) } // Index returns the index of the first occurrence of v in s, // or -1 if not present. +// +//go:fix inline func Index[S ~[]E, E comparable](s S, v E) int { return slices.Index(s, v) } // IndexFunc returns the first index i satisfying f(s[i]), // or -1 if none do. +// +//go:fix inline func IndexFunc[S ~[]E, E any](s S, f func(E) bool) int { return slices.IndexFunc(s, f) } // Contains reports whether v is present in s. +// +//go:fix inline func Contains[S ~[]E, E comparable](s S, v E) bool { return slices.Contains(s, v) } // ContainsFunc reports whether at least one // element e of s satisfies f(e). +// +//go:fix inline func ContainsFunc[S ~[]E, E any](s S, f func(E) bool) bool { return slices.ContainsFunc(s, f) } @@ -83,6 +94,8 @@ func ContainsFunc[S ~[]E, E any](s S, f func(E) bool) bool { // and r[i+len(v)] == value originally at r[i]. // Insert panics if i is out of range. // This function is O(len(s) + len(v)). +// +//go:fix inline func Insert[S ~[]E, E any](s S, i int, v ...E) S { return slices.Insert(s, i, v...) } @@ -92,6 +105,8 @@ func Insert[S ~[]E, E any](s S, i int, v ...E) S { // Delete is O(len(s)-i), so if many items must be deleted, it is better to // make a single call deleting them all together than to delete one at a time. // Delete zeroes the elements s[len(s)-(j-i):len(s)]. +// +//go:fix inline func Delete[S ~[]E, E any](s S, i, j int) S { return slices.Delete(s, i, j) } @@ -99,6 +114,8 @@ func Delete[S ~[]E, E any](s S, i, j int) S { // DeleteFunc removes any elements from s for which del returns true, // returning the modified slice. // DeleteFunc zeroes the elements between the new length and the original length. +// +//go:fix inline func DeleteFunc[S ~[]E, E any](s S, del func(E) bool) S { return slices.DeleteFunc(s, del) } @@ -106,12 +123,16 @@ func DeleteFunc[S ~[]E, E any](s S, del func(E) bool) S { // Replace replaces the elements s[i:j] by the given v, and returns the // modified slice. Replace panics if s[i:j] is not a valid slice of s. // When len(v) < (j-i), Replace zeroes the elements between the new length and the original length. +// +//go:fix inline func Replace[S ~[]E, E any](s S, i, j int, v ...E) S { return slices.Replace(s, i, j, v...) } // Clone returns a copy of the slice. // The elements are copied using assignment, so this is a shallow clone. +// +//go:fix inline func Clone[S ~[]E, E any](s S) S { return slices.Clone(s) } @@ -121,6 +142,8 @@ func Clone[S ~[]E, E any](s S) S { // Compact modifies the contents of the slice s and returns the modified slice, // which may have a smaller length. // Compact zeroes the elements between the new length and the original length. +// +//go:fix inline func Compact[S ~[]E, E comparable](s S) S { return slices.Compact(s) } @@ -128,6 +151,8 @@ func Compact[S ~[]E, E comparable](s S) S { // CompactFunc is like [Compact] but uses an equality function to compare elements. // For runs of elements that compare equal, CompactFunc keeps the first one. // CompactFunc zeroes the elements between the new length and the original length. +// +//go:fix inline func CompactFunc[S ~[]E, E any](s S, eq func(E, E) bool) S { return slices.CompactFunc(s, eq) } @@ -136,16 +161,22 @@ func CompactFunc[S ~[]E, E any](s S, eq func(E, E) bool) S { // another n elements. After Grow(n), at least n elements can be appended // to the slice without another allocation. If n is negative or too large to // allocate the memory, Grow panics. +// +//go:fix inline func Grow[S ~[]E, E any](s S, n int) S { return slices.Grow(s, n) } // Clip removes unused capacity from the slice, returning s[:len(s):len(s)]. +// +//go:fix inline func Clip[S ~[]E, E any](s S) S { return slices.Clip(s) } // Reverse reverses the elements of the slice in place. +// +//go:fix inline func Reverse[S ~[]E, E any](s S) { slices.Reverse(s) } diff --git a/vendor/golang.org/x/exp/slices/sort.go b/vendor/golang.org/x/exp/slices/sort.go index e270a7465..bd91a8d40 100644 --- a/vendor/golang.org/x/exp/slices/sort.go +++ b/vendor/golang.org/x/exp/slices/sort.go @@ -9,11 +9,10 @@ import ( "slices" ) -// TODO(adonovan): add a "//go:fix inline" annotation to each function -// in this file; see https://go.dev/issue/32816. - // Sort sorts a slice of any ordered type in ascending order. // When sorting floating-point numbers, NaNs are ordered before other values. +// +//go:fix inline func Sort[S ~[]E, E cmp.Ordered](x S) { slices.Sort(x) } @@ -27,23 +26,31 @@ func Sort[S ~[]E, E cmp.Ordered](x S) { // SortFunc requires that cmp is a strict weak ordering. // See https://en.wikipedia.org/wiki/Weak_ordering#Strict_weak_orderings. // To indicate 'uncomparable', return 0 from the function. +// +//go:fix inline func SortFunc[S ~[]E, E any](x S, cmp func(a, b E) int) { slices.SortFunc(x, cmp) } // SortStableFunc sorts the slice x while keeping the original order of equal // elements, using cmp to compare elements in the same way as [SortFunc]. +// +//go:fix inline func SortStableFunc[S ~[]E, E any](x S, cmp func(a, b E) int) { slices.SortStableFunc(x, cmp) } // IsSorted reports whether x is sorted in ascending order. +// +//go:fix inline func IsSorted[S ~[]E, E cmp.Ordered](x S) bool { return slices.IsSorted(x) } // IsSortedFunc reports whether x is sorted in ascending order, with cmp as the // comparison function as defined by [SortFunc]. +// +//go:fix inline func IsSortedFunc[S ~[]E, E any](x S, cmp func(a, b E) int) bool { return slices.IsSortedFunc(x, cmp) } @@ -51,6 +58,8 @@ func IsSortedFunc[S ~[]E, E any](x S, cmp func(a, b E) int) bool { // Min returns the minimal value in x. It panics if x is empty. // For floating-point numbers, Min propagates NaNs (any NaN value in x // forces the output to be NaN). +// +//go:fix inline func Min[S ~[]E, E cmp.Ordered](x S) E { return slices.Min(x) } @@ -58,6 +67,8 @@ func Min[S ~[]E, E cmp.Ordered](x S) E { // MinFunc returns the minimal value in x, using cmp to compare elements. // It panics if x is empty. If there is more than one minimal element // according to the cmp function, MinFunc returns the first one. +// +//go:fix inline func MinFunc[S ~[]E, E any](x S, cmp func(a, b E) int) E { return slices.MinFunc(x, cmp) } @@ -65,6 +76,8 @@ func MinFunc[S ~[]E, E any](x S, cmp func(a, b E) int) E { // Max returns the maximal value in x. It panics if x is empty. // For floating-point E, Max propagates NaNs (any NaN value in x // forces the output to be NaN). +// +//go:fix inline func Max[S ~[]E, E cmp.Ordered](x S) E { return slices.Max(x) } @@ -72,6 +85,8 @@ func Max[S ~[]E, E cmp.Ordered](x S) E { // MaxFunc returns the maximal value in x, using cmp to compare elements. // It panics if x is empty. If there is more than one maximal element // according to the cmp function, MaxFunc returns the first one. +// +//go:fix inline func MaxFunc[S ~[]E, E any](x S, cmp func(a, b E) int) E { return slices.MaxFunc(x, cmp) } @@ -80,6 +95,8 @@ func MaxFunc[S ~[]E, E any](x S, cmp func(a, b E) int) E { // where target is found, or the position where target would appear in the // sort order; it also returns a bool saying whether the target is really found // in the slice. The slice must be sorted in increasing order. +// +//go:fix inline func BinarySearch[S ~[]E, E cmp.Ordered](x S, target E) (int, bool) { return slices.BinarySearch(x, target) } @@ -91,6 +108,8 @@ func BinarySearch[S ~[]E, E cmp.Ordered](x S, target E) (int, bool) { // or a positive number if the slice element follows the target. // cmp must implement the same ordering as the slice, such that if // cmp(a, t) < 0 and cmp(b, t) >= 0, then a must precede b in the slice. +// +//go:fix inline func BinarySearchFunc[S ~[]E, E, T any](x S, target T, cmp func(E, T) int) (int, bool) { return slices.BinarySearchFunc(x, target, cmp) } diff --git a/vendor/modules.txt b/vendor/modules.txt index 689910f30..f4ceb38be 100644 --- a/vendor/modules.txt +++ b/vendor/modules.txt @@ -341,19 +341,10 @@ github.com/cs3org/go-cs3apis/cs3/storage/provider/v1beta1 github.com/cs3org/go-cs3apis/cs3/storage/registry/v1beta1 github.com/cs3org/go-cs3apis/cs3/tx/v1beta1 github.com/cs3org/go-cs3apis/cs3/types/v1beta1 -# github.com/cyphar/filepath-securejoin v0.5.1 +# github.com/cyphar/filepath-securejoin v0.6.1 ## explicit; go 1.18 github.com/cyphar/filepath-securejoin github.com/cyphar/filepath-securejoin/internal/consts -github.com/cyphar/filepath-securejoin/pathrs-lite -github.com/cyphar/filepath-securejoin/pathrs-lite/internal -github.com/cyphar/filepath-securejoin/pathrs-lite/internal/assert -github.com/cyphar/filepath-securejoin/pathrs-lite/internal/fd -github.com/cyphar/filepath-securejoin/pathrs-lite/internal/gocompat -github.com/cyphar/filepath-securejoin/pathrs-lite/internal/kernelversion -github.com/cyphar/filepath-securejoin/pathrs-lite/internal/linux -github.com/cyphar/filepath-securejoin/pathrs-lite/internal/procfs -github.com/cyphar/filepath-securejoin/pathrs-lite/procfs # github.com/davecgh/go-spew v1.1.2-0.20180830191138-d8f796af33cc ## explicit github.com/davecgh/go-spew/spew @@ -471,16 +462,16 @@ github.com/go-git/gcfg github.com/go-git/gcfg/scanner github.com/go-git/gcfg/token github.com/go-git/gcfg/types -# github.com/go-git/go-billy/v5 v5.8.0 -## explicit; go 1.24.0 +# github.com/go-git/go-billy/v5 v5.9.0 +## explicit; go 1.25.0 github.com/go-git/go-billy/v5 github.com/go-git/go-billy/v5/helper/chroot github.com/go-git/go-billy/v5/helper/polyfill github.com/go-git/go-billy/v5/memfs github.com/go-git/go-billy/v5/osfs github.com/go-git/go-billy/v5/util -# github.com/go-git/go-git/v5 v5.18.0 -## explicit; go 1.24.0 +# github.com/go-git/go-git/v5 v5.19.0 +## explicit; go 1.25.0 github.com/go-git/go-git/v5 github.com/go-git/go-git/v5/config github.com/go-git/go-git/v5/internal/path_util @@ -868,7 +859,7 @@ github.com/klauspost/compress/s2 github.com/klauspost/compress/snappy github.com/klauspost/compress/zstd github.com/klauspost/compress/zstd/internal/xxhash -# github.com/klauspost/cpuid/v2 v2.2.11 +# github.com/klauspost/cpuid/v2 v2.3.0 ## explicit; go 1.22 github.com/klauspost/cpuid/v2 # github.com/klauspost/crc32 v1.3.0 @@ -1371,7 +1362,7 @@ github.com/opencloud-eu/icap-client # github.com/opencloud-eu/libre-graph-api-go v1.0.8-0.20260310090739-853d972b282d ## explicit; go 1.18 github.com/opencloud-eu/libre-graph-api-go -# github.com/opencloud-eu/reva/v2 v2.44.0 +# github.com/opencloud-eu/reva/v2 v2.44.1-0.20260513122109-583a11875721 ## explicit; go 1.25.0 github.com/opencloud-eu/reva/v2/cmd/revad/internal/grace github.com/opencloud-eu/reva/v2/cmd/revad/runtime @@ -1606,6 +1597,7 @@ github.com/opencloud-eu/reva/v2/pkg/share/cache github.com/opencloud-eu/reva/v2/pkg/share/cache/warmup/loader github.com/opencloud-eu/reva/v2/pkg/share/cache/warmup/registry github.com/opencloud-eu/reva/v2/pkg/share/manager/jsoncs3 +github.com/opencloud-eu/reva/v2/pkg/share/manager/jsoncs3/migrations github.com/opencloud-eu/reva/v2/pkg/share/manager/jsoncs3/providercache github.com/opencloud-eu/reva/v2/pkg/share/manager/jsoncs3/receivedsharecache github.com/opencloud-eu/reva/v2/pkg/share/manager/jsoncs3/sharecache @@ -1797,8 +1789,8 @@ github.com/pierrec/lz4/v4/internal/lz4block github.com/pierrec/lz4/v4/internal/lz4errors github.com/pierrec/lz4/v4/internal/lz4stream github.com/pierrec/lz4/v4/internal/xxh32 -# github.com/pjbgf/sha1cd v0.3.2 -## explicit; go 1.21 +# github.com/pjbgf/sha1cd v0.6.0 +## explicit; go 1.22 github.com/pjbgf/sha1cd github.com/pjbgf/sha1cd/internal github.com/pjbgf/sha1cd/ubc @@ -2445,8 +2437,8 @@ golang.org/x/crypto/ssh golang.org/x/crypto/ssh/agent golang.org/x/crypto/ssh/internal/bcrypt_pbkdf golang.org/x/crypto/ssh/knownhosts -# golang.org/x/exp v0.0.0-20250210185358-939b2ce775ac -## explicit; go 1.22.0 +# golang.org/x/exp v0.0.0-20260410095643-746e56fc9e2f +## explicit; go 1.25.0 golang.org/x/exp/maps golang.org/x/exp/slices golang.org/x/exp/slog