From fad0cc4828370308fee03df136f7501bc44334a7 Mon Sep 17 00:00:00 2001 From: Ralf Haferkamp Date: Mon, 16 Mar 2026 14:32:19 +0100 Subject: [PATCH 1/9] Use filter to avoid including space membership in the sharedWithMe response --- services/gateway/pkg/revaconfig/config.go | 3 ++- .../v0/api_driveitem_permissions_test.go | 19 +++++++++++++++++++ services/graph/pkg/service/v0/base.go | 1 + 3 files changed, 22 insertions(+), 1 deletion(-) diff --git a/services/gateway/pkg/revaconfig/config.go b/services/gateway/pkg/revaconfig/config.go index 8bd8e2080..f851d3199 100644 --- a/services/gateway/pkg/revaconfig/config.go +++ b/services/gateway/pkg/revaconfig/config.go @@ -51,7 +51,8 @@ func GatewayConfigFromStruct(cfg *config.Config, logger log.Logger) map[string]i "ocminvitemanagersvc": cfg.OCMEndpoint, "ocmproviderauthorizersvc": cfg.OCMEndpoint, "ocmcoresvc": cfg.OCMEndpoint, - "commit_share_to_storage_grant": cfg.CommitShareToStorageGrant, + "use_common_space_root_share_logic": true, + "commit_share_to_storage_grant": cfg.CommitShareToStorageGrant, "share_folder": cfg.ShareFolder, // ShareFolder is the location where to create shares in the recipient's storage provider. // other "disable_home_creation_on_login": cfg.DisableHomeCreationOnLogin, diff --git a/services/graph/pkg/service/v0/api_driveitem_permissions_test.go b/services/graph/pkg/service/v0/api_driveitem_permissions_test.go index 3adb5b2dc..1c7f70385 100644 --- a/services/graph/pkg/service/v0/api_driveitem_permissions_test.go +++ b/services/graph/pkg/service/v0/api_driveitem_permissions_test.go @@ -391,6 +391,25 @@ var _ = Describe("DriveItemPermissionsService", func() { Expect(len(permissions.LibreGraphPermissionsActionsAllowedValues)).ToNot(BeZero()) Expect(len(permissions.LibreGraphPermissionsRolesAllowedValues)).ToNot(BeZero()) }) + It("sends SpaceRootFilter(false) when listing shares for a non-space-root item", func() { + gatewayClient.On("Stat", mock.Anything, mock.Anything).Return(statResponse, nil) + gatewayClient.On("ListPublicShares", mock.Anything, mock.Anything).Return(listPublicSharesResponse, nil) + gatewayClient.On("ListShares", + mock.Anything, + mock.MatchedBy(func(req *collaboration.ListSharesRequest) bool { + for _, f := range req.Filters { + if f.Type == collaboration.Filter_TYPE_SPACE_ROOT && !f.GetSpaceRoot() { + return true + } + } + return false + }), + ).Return(listSharesResponse, nil) + + _, err := driveItemPermissionsService.ListPermissions(context.Background(), itemID, svc.ListPermissionsQueryOptions{}) + Expect(err).ToNot(HaveOccurred()) + gatewayClient.AssertExpectations(GinkgoT()) + }) It("returns one permission per share", func() { statResponse.Info.PermissionSet = roleconversions.NewEditorRole().CS3ResourcePermissions() listSharesResponse.Shares = []*collaboration.Share{ diff --git a/services/graph/pkg/service/v0/base.go b/services/graph/pkg/service/v0/base.go index 4b2c8edd2..643348473 100644 --- a/services/graph/pkg/service/v0/base.go +++ b/services/graph/pkg/service/v0/base.go @@ -278,6 +278,7 @@ func (g BaseGraphService) listUserShares(ctx context.Context, filters []*collabo concreteFilters := []*collaboration.Filter{ share.UserGranteeFilter(), share.GroupGranteeFilter(), + share.SpaceRootFilter(false), } concreteFilters = append(concreteFilters, filters...) From ec8733ac52d76b579a961e63f174bdf0f8519a5d Mon Sep 17 00:00:00 2001 From: Ralf Haferkamp Date: Tue, 17 Mar 2026 13:18:17 +0100 Subject: [PATCH 2/9] graph: use share manager for managing space permissions This gets us rid of quite a bit of special casing for space permission. Also provides us with "real" permission IDs instead of those faked "u:" ones. --- .../service/v0/api_driveitem_permissions.go | 14 +-- .../v0/api_driveitem_permissions_test.go | 50 +++++--- services/graph/pkg/service/v0/base.go | 116 ++++-------------- services/graph/pkg/service/v0/driveitems.go | 49 ++------ services/graph/pkg/service/v0/sharedwithme.go | 7 +- 5 files changed, 83 insertions(+), 153 deletions(-) diff --git a/services/graph/pkg/service/v0/api_driveitem_permissions.go b/services/graph/pkg/service/v0/api_driveitem_permissions.go index aa68e8d0f..f55ad2717 100644 --- a/services/graph/pkg/service/v0/api_driveitem_permissions.go +++ b/services/graph/pkg/service/v0/api_driveitem_permissions.go @@ -245,10 +245,6 @@ func (s DriveItemPermissionsService) Invite(ctx context.Context, resourceId *sto if shareid != "" { permission.Id = conversions.ToPointer(shareid) - } else if IsSpaceRoot(statResponse.GetInfo().GetId()) { - // permissions on a space root are not handled by a share manager so - // they don't get a share-id - permission.SetId(identitySetToSpacePermissionID(permission.GetGrantedToV2())) } if expiration != nil { @@ -414,12 +410,12 @@ func (s DriveItemPermissionsService) ListPermissions(ctx context.Context, itemID var permissionsCount int if IsSpaceRoot(statResponse.GetInfo().GetId()) { - var permissions []libregraph.Permission - permissions, permissionsCount, err = s.getSpaceRootPermissions(ctx, statResponse.GetInfo().GetSpace().GetId(), queryOptions.NoValues) + driveItems, err = s.listSpaceRootUserShares(ctx, []*collaboration.Filter{ + share.ResourceIDFilter(itemID), + }, driveItems) if err != nil { return collectionOfPermissions, err } - collectionOfPermissions.Value = permissions } else { // "normal" driveItem, populate user permissions via share providers driveItems, err = s.listUserShares(ctx, []*collaboration.Filter{ @@ -535,12 +531,10 @@ func (s DriveItemPermissionsService) DeletePermission(ctx context.Context, itemI } switch permissionType { - case User: + case User, Space: return s.removeUserShare(ctx, permissionID) case Public: return s.removePublicShare(ctx, permissionID) - case Space: - return s.removeSpacePermission(ctx, permissionID, sharedResourceID) case OCM: return s.removeOCMPermission(ctx, permissionID) default: diff --git a/services/graph/pkg/service/v0/api_driveitem_permissions_test.go b/services/graph/pkg/service/v0/api_driveitem_permissions_test.go index 1c7f70385..4a088664d 100644 --- a/services/graph/pkg/service/v0/api_driveitem_permissions_test.go +++ b/services/graph/pkg/service/v0/api_driveitem_permissions_test.go @@ -24,7 +24,6 @@ import ( "github.com/opencloud-eu/opencloud/services/graph/pkg/config" "github.com/stretchr/testify/mock" "github.com/tidwall/gjson" - "google.golang.org/grpc" roleconversions "github.com/opencloud-eu/reva/v2/pkg/conversions" revactx "github.com/opencloud-eu/reva/v2/pkg/ctx" @@ -461,6 +460,8 @@ var _ = Describe("DriveItemPermissionsService", func() { }) It("returns role denied", func() { statResponse.Info.PermissionSet = roleconversions.NewManagerRole().CS3ResourcePermissions() + statResponse.Info.Type = provider.ResourceType_RESOURCE_TYPE_CONTAINER + listSharesResponse.Shares = []*collaboration.Share{ { Id: &collaboration.ShareId{OpaqueId: "1"}, @@ -685,6 +686,7 @@ var _ = Describe("DriveItemPermissionsService", func() { } gatewayClient.On("ListStorageSpaces", mock.Anything, mock.Anything).Return(listSpacesResponse, nil) + gatewayClient.On("ListShares", mock.Anything, mock.Anything).Return(&collaboration.ListSharesResponse{Status: status.NewOK(ctx)}, nil) gatewayClient.On("ListPublicShares", mock.Anything, mock.Anything).Return(listPublicSharesResponse, nil) statResponse.Info.Id = listSpacesResponse.StorageSpaces[0].Root gatewayClient.On("Stat", mock.Anything, mock.Anything).Return(statResponse, nil) @@ -784,12 +786,10 @@ var _ = Describe("DriveItemPermissionsService", func() { gatewayClient.On("RemoveShare", mock.Anything, - mock.Anything, - ).Return(func(ctx context.Context, in *collaboration.RemoveShareRequest, opts ...grpc.CallOption) (*collaboration.RemoveShareResponse, error) { - Expect(in.Ref.GetKey()).ToNot(BeNil()) - Expect(in.Ref.GetKey().GetGrantee().GetUserId().GetOpaqueId()).To(Equal("userid")) - return &collaboration.RemoveShareResponse{Status: status.NewOK(ctx)}, nil - }) + mock.MatchedBy(func(req *collaboration.RemoveShareRequest) bool { + return req.GetRef().GetId().GetOpaqueId() == "shareid" + }), + ).Return(&collaboration.RemoveShareResponse{Status: status.NewOK(ctx)}, nil) err := driveItemPermissionsService.DeletePermission(context.Background(), &provider.ResourceId{ @@ -797,7 +797,7 @@ var _ = Describe("DriveItemPermissionsService", func() { SpaceId: "2", OpaqueId: "2", }, - "u:userid", + "shareid", ) Expect(err).ToNot(HaveOccurred()) }) @@ -1064,24 +1064,40 @@ var _ = Describe("DriveItemPermissionsService", func() { Expect(res).To(BeZero()) }) It("fails to update the space permissions for a space share when setting a file specific role", func() { - gatewayClient.On("Stat", mock.Anything, mock.Anything).Return(statResponse, nil) getPublicShareMockResponse.Share = nil getPublicShareMockResponse.Status = status.NewNotFound(ctx, "not found") gatewayClient.On("GetPublicShare", mock.Anything, mock.Anything).Return(getPublicShareMockResponse, nil) - gatewayClient.On("ListStorageSpaces", mock.Anything, mock.Anything).Return(listSpacesResponse, nil) - - statResponse.Info.Id = listSpacesResponse.StorageSpaces[0].Root - gatewayClient.On("Stat", mock.Anything, mock.Anything).Return(statResponse, nil) - gatewayClient.On("GetUser", mock.Anything, mock.Anything).Return(getUserResponse, nil) - - driveItemPermission.SetRoles([]string{unifiedrole.UnifiedRoleFileEditorID}) spaceId := &provider.ResourceId{ StorageId: "1", SpaceId: "2", OpaqueId: "2", } - res, err := driveItemPermissionsService.UpdatePermission(ctx, spaceId, "u:userid", driveItemPermission) + statResponse.Info.Id = spaceId + gatewayClient.On("Stat", mock.Anything, mock.Anything).Return(statResponse, nil) + + gatewayClient.On("ListShares", mock.Anything, mock.Anything).Return(&collaboration.ListSharesResponse{ + Status: status.NewOK(ctx), + Shares: []*collaboration.Share{ + { + Id: &collaboration.ShareId{OpaqueId: "spaceShareId"}, + ResourceId: spaceId, + Grantee: &provider.Grantee{ + Type: provider.GranteeType_GRANTEE_TYPE_USER, + Id: &provider.Grantee_UserId{ + UserId: &userpb.UserId{OpaqueId: "userid"}, + }, + }, + Permissions: &collaboration.SharePermissions{ + Permissions: roleconversions.NewSpaceViewerRole().CS3ResourcePermissions(), + }, + }, + }, + }, nil) + gatewayClient.On("GetUser", mock.Anything, mock.Anything).Return(getUserResponse, nil) + + driveItemPermission.SetRoles([]string{unifiedrole.UnifiedRoleFileEditorID}) + res, err := driveItemPermissionsService.UpdatePermission(ctx, spaceId, "spaceShareId", driveItemPermission) Expect(err).To(MatchError(errorcode.New(errorcode.InvalidRequest, "role not applicable to this resource"))) Expect(res).To(BeZero()) }) diff --git a/services/graph/pkg/service/v0/base.go b/services/graph/pkg/service/v0/base.go index 643348473..fbbfa1edf 100644 --- a/services/graph/pkg/service/v0/base.go +++ b/services/graph/pkg/service/v0/base.go @@ -51,22 +51,6 @@ type BaseGraphService struct { availableRoles []*libregraph.UnifiedRoleDefinition } -func (g BaseGraphService) getSpaceRootPermissions(ctx context.Context, spaceID *storageprovider.StorageSpaceId, countOnly bool) ([]libregraph.Permission, int, error) { - gatewayClient, err := g.gatewaySelector.Next() - - if err != nil { - g.logger.Debug().Err(err).Msg("selecting gatewaySelector failed") - return nil, 0, err - } - space, err := utils.GetSpace(ctx, spaceID.GetOpaqueId(), gatewayClient) - if err != nil { - return nil, 0, errorcode.FromUtilsStatusCodeError(err) - } - - perm, count := g.cs3SpacePermissionsToLibreGraph(ctx, space, countOnly, APIVersion_1_Beta_1) - return perm, count, nil -} - func (g BaseGraphService) getDriveItem(ctx context.Context, ref *storageprovider.Reference) (*libregraph.DriveItem, error) { gatewayClient, err := g.gatewaySelector.Next() if err != nil { @@ -269,6 +253,17 @@ func (g BaseGraphService) libreGraphPermissionFromCS3PublicShare(createdLink *li } func (g BaseGraphService) listUserShares(ctx context.Context, filters []*collaboration.Filter, driveItems driveItemsByResourceID) (driveItemsByResourceID, error) { + return g.listSharesWithSpaceRootFilter(ctx, false, filters, driveItems) +} + +// listSpaceRootUserShares lists user/group shares whose resource is a space root (i.e. space +// memberships). It uses SpaceRootFilter(true) so only space-root shares are returned, mirroring +// how listUserShares works for regular file/folder shares. +func (g BaseGraphService) listSpaceRootUserShares(ctx context.Context, filters []*collaboration.Filter, driveItems driveItemsByResourceID) (driveItemsByResourceID, error) { + return g.listSharesWithSpaceRootFilter(ctx, true, filters, driveItems) +} + +func (g BaseGraphService) listSharesWithSpaceRootFilter(ctx context.Context, spaceRoot bool, filters []*collaboration.Filter, driveItems driveItemsByResourceID) (driveItemsByResourceID, error) { gatewayClient, err := g.gatewaySelector.Next() if err != nil { g.logger.Error().Err(err).Msg("could not select next gateway client") @@ -278,7 +273,7 @@ func (g BaseGraphService) listUserShares(ctx context.Context, filters []*collabo concreteFilters := []*collaboration.Filter{ share.UserGranteeFilter(), share.GroupGranteeFilter(), - share.SpaceRootFilter(false), + share.SpaceRootFilter(spaceRoot), } concreteFilters = append(concreteFilters, filters...) @@ -563,9 +558,7 @@ func (g BaseGraphService) cs3OCMSharesToDriveItems(ctx context.Context, shares [ func (g BaseGraphService) cs3UserShareToPermission(ctx context.Context, share *collaboration.Share, roleCondition string) (*libregraph.Permission, error) { perm := libregraph.Permission{} perm.SetRoles([]string{}) - if roleCondition != unifiedrole.UnifiedRoleConditionDrive { - perm.SetId(share.GetId().GetOpaqueId()) - } + perm.SetId(share.GetId().GetOpaqueId()) grantedTo := libregraph.SharePointIdentitySet{} switch share.GetGrantee().GetType() { case storageprovider.GranteeType_GRANTEE_TYPE_USER: @@ -579,9 +572,6 @@ func (g BaseGraphService) cs3UserShareToPermission(ctx context.Context, share *c return nil, errorcode.New(errorcode.GeneralException, err.Error()) default: grantedTo.SetUser(user) - if roleCondition == unifiedrole.UnifiedRoleConditionDrive { - perm.SetId("u:" + user.GetId()) - } } case storageprovider.GranteeType_GRANTEE_TYPE_GROUP: group, err := groupIdToIdentity(ctx, g.identityCache, share.Grantee.GetGroupId().GetOpaqueId()) @@ -594,9 +584,6 @@ func (g BaseGraphService) cs3UserShareToPermission(ctx context.Context, share *c return nil, errorcode.New(errorcode.GeneralException, err.Error()) default: grantedTo.SetGroup(group) - if roleCondition == unifiedrole.UnifiedRoleConditionDrive { - perm.SetId("g:" + group.GetId()) - } } } @@ -927,35 +914,6 @@ func (g BaseGraphService) removeUserShare(ctx context.Context, permissionID stri return nil } -func (g BaseGraphService) removeSpacePermission(ctx context.Context, permissionID string, resourceId *storageprovider.ResourceId) error { - grantee, err := spacePermissionIdToCS3Grantee(permissionID) - if err != nil { - return err - } - - gatewayClient, err := g.gatewaySelector.Next() - if err != nil { - g.logger.Debug().Err(err).Msg("selecting gatewaySelector failed") - return err - } - removeShareResp, err := gatewayClient.RemoveShare(ctx, &collaboration.RemoveShareRequest{ - Ref: &collaboration.ShareReference{ - Spec: &collaboration.ShareReference_Key{ - Key: &collaboration.ShareKey{ - ResourceId: resourceId, - Grantee: &grantee, - }, - }, - }, - }) - if err := errorcode.FromCS3Status(removeShareResp.GetStatus(), err); err != nil { - return err - } - - // We need to return an untyped nil here otherwise the error==nil check won't work - return nil -} - func (g BaseGraphService) getOCMPermissionResourceID(ctx context.Context, permissionID string) (*storageprovider.ResourceId, error) { cs3Share, err := g.getCS3OCMShareByID(ctx, permissionID) if err != nil { @@ -1071,20 +1029,19 @@ func (g BaseGraphService) getPermissionByID(ctx context.Context, permissionID st } return permission, publicShare.GetResourceId(), nil case IsSpaceRoot(itemID): - // itemID is referencing a spaceroot this is a space permission. Handle - // that here and get space id - resourceInfo, err := utils.GetResourceByID(ctx, itemID, gatewayClient) + // itemID is referencing a space root — use the share manager to look up the permission + driveItems := make(driveItemsByResourceID) + driveItems, err = g.listSpaceRootUserShares(ctx, []*collaboration.Filter{ + share.ResourceIDFilter(itemID), + }, driveItems) if err != nil { return nil, nil, err } - - perms, _, err := g.getSpaceRootPermissions(ctx, resourceInfo.GetSpace().GetId(), false) - if err != nil { - return nil, nil, err - } - for _, p := range perms { - if p.GetId() == permissionID { - return &p, itemID, nil + for _, item := range driveItems { + for i := range item.Permissions { + if item.Permissions[i].GetId() == permissionID { + return &item.Permissions[i], itemID, nil + } } } case errors.As(err, &errcode) && errcode.GetCode() == errorcode.ItemNotFound: @@ -1239,29 +1196,10 @@ func (g BaseGraphService) updateUserShare(ctx context.Context, permissionID stri } var cs3UpdateShareReq collaboration.UpdateShareRequest - // When updating a space root we need to reference the share by resourceId and grantee - if IsSpaceRoot(itemID) { - grantee, err := spacePermissionIdToCS3Grantee(permissionID) - if err != nil { - g.logger.Debug().Err(err).Str("permissionid", permissionID).Msg("failed to parse space permission id") - return nil, err - } - cs3UpdateShareReq.Share = &collaboration.Share{ - ResourceId: itemID, - Grantee: &grantee, - } - cs3UpdateShareReq.Opaque = &types.Opaque{ - Map: map[string]*types.OpaqueEntry{ - "spacegrant": {}, - }, - } - cs3UpdateShareReq.Opaque = utils.AppendPlainToOpaque(cs3UpdateShareReq.Opaque, "spacetype", _spaceTypeProject) - } else { - cs3UpdateShareReq.Share = &collaboration.Share{ - Id: &collaboration.ShareId{ - OpaqueId: permissionID, - }, - } + cs3UpdateShareReq.Share = &collaboration.Share{ + Id: &collaboration.ShareId{ + OpaqueId: permissionID, + }, } fieldmask := []string{} if expiration, ok := newPermission.GetExpirationDateTimeOk(); ok { diff --git a/services/graph/pkg/service/v0/driveitems.go b/services/graph/pkg/service/v0/driveitems.go index da89e25ba..7a6615173 100644 --- a/services/graph/pkg/service/v0/driveitems.go +++ b/services/graph/pkg/service/v0/driveitems.go @@ -15,8 +15,6 @@ import ( "time" gateway "github.com/cs3org/go-cs3apis/cs3/gateway/v1beta1" - grouppb "github.com/cs3org/go-cs3apis/cs3/identity/group/v1beta1" - userpb "github.com/cs3org/go-cs3apis/cs3/identity/user/v1beta1" cs3rpc "github.com/cs3org/go-cs3apis/cs3/rpc/v1beta1" storageprovider "github.com/cs3org/go-cs3apis/cs3/storage/provider/v1beta1" types "github.com/cs3org/go-cs3apis/cs3/types/v1beta1" @@ -349,35 +347,6 @@ func (g Graph) GetDriveItemChildren(w http.ResponseWriter, r *http.Request) { render.JSON(w, r, &ListResponse{Value: files}) } -func spacePermissionIdToCS3Grantee(permissionID string) (storageprovider.Grantee, error) { - // the permission ID for space permission is made of two parts - // the grantee type ('u' or user, 'g' for group) and the user or group id - var grantee storageprovider.Grantee - parts := strings.SplitN(permissionID, ":", 2) - if len(parts) != 2 { - return grantee, errorcode.New(errorcode.InvalidRequest, "invalid space permission id") - } - switch parts[0] { - case "u": - grantee.Type = storageprovider.GranteeType_GRANTEE_TYPE_USER - grantee.Id = &storageprovider.Grantee_UserId{ - UserId: &userpb.UserId{ - OpaqueId: parts[1], - }, - } - case "g": - grantee.Type = storageprovider.GranteeType_GRANTEE_TYPE_GROUP - grantee.Id = &storageprovider.Grantee_GroupId{ - GroupId: &grouppb.GroupId{ - OpaqueId: parts[1], - }, - } - default: - return grantee, errorcode.New(errorcode.InvalidRequest, "invalid space permission id") - } - return grantee, nil -} - func (g Graph) getRemoteItem(ctx context.Context, root *storageprovider.ResourceId, baseURL *url.URL) (*libregraph.RemoteItem, error) { gatewayClient, err := g.gatewaySelector.Next() if err != nil { @@ -461,14 +430,22 @@ func cs3ResourceToDriveItem(logger *log.Logger, res *storageprovider.ResourceInf parentRef.SetPath(path.Dir(res.GetPath())) driveItem.ParentReference = parentRef } - if res.GetType() == storageprovider.ResourceType_RESOURCE_TYPE_FILE && res.GetMimeType() != "" { + switch res.GetType() { + case storageprovider.ResourceType_RESOURCE_TYPE_FILE: + mimeType := res.GetMimeType() + if mimeType == "" { + mimeType = "application/octet-stream" + } // We cannot use a libregraph.File here because the openapi codegenerator autodetects 'File' as a go type ... driveItem.File = &libregraph.OpenGraphFile{ - MimeType: &res.MimeType, + MimeType: &mimeType, + } + case storageprovider.ResourceType_RESOURCE_TYPE_CONTAINER: + if IsSpaceRoot(res.GetId()) { + driveItem.SetRoot(map[string]any{}) + } else { + driveItem.SetFolder(libregraph.Folder{}) } - } - if res.GetType() == storageprovider.ResourceType_RESOURCE_TYPE_CONTAINER { - driveItem.Folder = &libregraph.Folder{} } if res.GetArbitraryMetadata() != nil { diff --git a/services/graph/pkg/service/v0/sharedwithme.go b/services/graph/pkg/service/v0/sharedwithme.go index f6e645e19..c9d1ca92c 100644 --- a/services/graph/pkg/service/v0/sharedwithme.go +++ b/services/graph/pkg/service/v0/sharedwithme.go @@ -10,6 +10,7 @@ import ( ocm "github.com/cs3org/go-cs3apis/cs3/sharing/ocm/v1beta1" "github.com/go-chi/render" libregraph "github.com/opencloud-eu/libre-graph-api-go" + "github.com/opencloud-eu/reva/v2/pkg/share" "github.com/opencloud-eu/opencloud/services/graph/pkg/errorcode" "github.com/opencloud-eu/opencloud/services/thumbnails/pkg/thumbnail" @@ -41,7 +42,11 @@ func (g Graph) listSharedWithMe(ctx context.Context, expandThumbnails bool) ([]l return nil, err } - listReceivedSharesResponse, err := gatewayClient.ListReceivedShares(ctx, &collaboration.ListReceivedSharesRequest{}) + listReceivedSharesResponse, err := gatewayClient.ListReceivedShares(ctx, &collaboration.ListReceivedSharesRequest{ + Filters: []*collaboration.Filter{ + share.SpaceRootFilter(false), + }, + }) if err := errorcode.FromCS3Status(listReceivedSharesResponse.GetStatus(), err); err != nil { g.logger.Error().Err(err).Msg("listing shares failed") return nil, err From 44bbc07273d5a323c6d9c96ba5a4954fb02ae9df Mon Sep 17 00:00:00 2001 From: Ralf Haferkamp Date: Wed, 25 Mar 2026 18:45:22 +0100 Subject: [PATCH 3/9] tests: Adjust acceptance test for recent Space sharing changes The `id` property of the `permissions` on a space root does not longer have that special `u:` format any. It now has the same format as the permission id on "normal" driveItems. --- .../acceptance/bootstrap/SharingNgContext.php | 23 +++++++----------- .../apiSharingNg1/listPermissions.feature | 10 ++++---- .../features/apiSharingNg1/sharedByMe.feature | 4 ++-- .../shareInvitations.feature | 2 +- .../updateShareInvitations.feature | 24 +++++++++---------- 5 files changed, 29 insertions(+), 34 deletions(-) diff --git a/tests/acceptance/bootstrap/SharingNgContext.php b/tests/acceptance/bootstrap/SharingNgContext.php index 7f9be3b01..df64e47e9 100644 --- a/tests/acceptance/bootstrap/SharingNgContext.php +++ b/tests/acceptance/bootstrap/SharingNgContext.php @@ -420,7 +420,7 @@ class SharingNgContext implements Context { $expirationDateTime = (\array_key_exists('expirationDateTime', $rows)) ? \date(DATE_RFC3339, \strtotime($rows['expirationDateTime'])) : null; - return GraphHelper::sendSharingInvitationForDrive( + $response = GraphHelper::sendSharingInvitationForDrive( $this->featureContext->getBaseUrl(), $this->featureContext->getStepLineRef(), $user, @@ -432,6 +432,10 @@ class SharingNgContext implements Context { $permissionsAction, $expirationDateTime ); + if ($response->getStatusCode() === 200) { + $this->featureContext->shareNgAddToCreatedUserGroupShares($response); + } + return $response; } /** @@ -651,12 +655,7 @@ class SharingNgContext implements Context { string $sharee, TableNode $table ) { - $permissionID = ""; - if ($shareType === "user") { - $permissionID = "u:" . $this->featureContext->getAttributeOfCreatedUser($sharee, 'id'); - } elseif ($shareType === "group") { - $permissionID = "g:" . $this->featureContext->getAttributeOfCreatedGroup($sharee, 'id'); - } + $permissionID = $this->featureContext->shareNgGetLastCreatedUserGroupShareID(); $this->featureContext->setResponse( $this->updateResourceShare( @@ -1042,8 +1041,8 @@ class SharingNgContext implements Context { $permissionID = match ($shareType) { 'link' => $this->featureContext->shareNgGetLastCreatedLinkShareID(), - 'user' => 'u:' . $this->featureContext->getAttributeOfCreatedUser($recipient, 'id'), - 'group' => 'g:' . $this->featureContext->getAttributeOfCreatedGroup($recipient, 'id'), + 'user' => $this->featureContext->shareNgGetLastCreatedUserGroupShareID(), + 'group' => $this->featureContext->shareNgGetLastCreatedUserGroupShareID(), default => throw new Exception("shareType '$shareType' does not match user|group|link "), }; @@ -1650,11 +1649,7 @@ class SharingNgContext implements Context { TableNode $table ): void { $bodyRows = $table->getRowsHash(); - $permissionID = match ($bodyRows['shareType']) { - 'user' => 'u:' . $this->featureContext->getAttributeOfCreatedUser($bodyRows['sharee'], 'id'), - 'group' => 'g:' . $this->featureContext->getAttributeOfCreatedGroup($bodyRows['sharee'], 'id'), - default => throw new Exception("shareType {$bodyRows['shareType']} does not match user|group "), - }; + $permissionID = $this->featureContext->shareNgGetLastCreatedUserGroupShareID(); $space = $bodyRows['space']; $spaceId = ($this->spacesContext->getSpaceByName($user, $space))["id"]; $body = []; diff --git a/tests/acceptance/features/apiSharingNg1/listPermissions.feature b/tests/acceptance/features/apiSharingNg1/listPermissions.feature index 1e1c62ea7..0c44e084e 100644 --- a/tests/acceptance/features/apiSharingNg1/listPermissions.feature +++ b/tests/acceptance/features/apiSharingNg1/listPermissions.feature @@ -414,7 +414,7 @@ Feature: List a sharing permissions }, "id": { "type": "string", - "pattern": "^u:%user_id_pattern%$" + "pattern": "^%permissions_id_pattern%$" }, "roles": { "type": "array", @@ -456,7 +456,7 @@ Feature: List a sharing permissions }, "id": { "type": "string", - "pattern": "^u:%user_id_pattern%$" + "pattern": "^%permissions_id_pattern%$" }, "roles": { "type": "array", @@ -1428,7 +1428,7 @@ Feature: List a sharing permissions }, "id": { "type": "string", - "pattern": "^u:%user_id_pattern%$" + "pattern": "^%permissions_id_pattern%$" }, "roles": { "type": "array", @@ -1470,7 +1470,7 @@ Feature: List a sharing permissions }, "id": { "type": "string", - "pattern": "^u:%user_id_pattern%$" + "pattern": "^%permissions_id_pattern%$" }, "roles": { "type": "array", @@ -2769,4 +2769,4 @@ Feature: List a sharing permissions } } } - """ \ No newline at end of file + """ diff --git a/tests/acceptance/features/apiSharingNg1/sharedByMe.feature b/tests/acceptance/features/apiSharingNg1/sharedByMe.feature index 2b4d69ae6..1223b03c2 100644 --- a/tests/acceptance/features/apiSharingNg1/sharedByMe.feature +++ b/tests/acceptance/features/apiSharingNg1/sharedByMe.feature @@ -3407,7 +3407,7 @@ Feature: resources shared by user "name", "id", "eTag", - "folder", + "root", "lastModifiedDateTime", "size" ], @@ -3415,7 +3415,7 @@ Feature: resources shared by user "name": { "const": "." }, - "folder": { + "root": { "const": {} }, "id": { diff --git a/tests/acceptance/features/apiSharingNgShareInvitation/shareInvitations.feature b/tests/acceptance/features/apiSharingNgShareInvitation/shareInvitations.feature index 55813fcb6..1e81e376e 100644 --- a/tests/acceptance/features/apiSharingNgShareInvitation/shareInvitations.feature +++ b/tests/acceptance/features/apiSharingNgShareInvitation/shareInvitations.feature @@ -1777,7 +1777,7 @@ Feature: Send a sharing invitations }, "id": { "type": "string", - "pattern": "^g:%group_id_pattern%$" + "pattern": "^%permissions_id_pattern%$" }, "roles": { "type": "array", diff --git a/tests/acceptance/features/apiSharingNgShareInvitation/updateShareInvitations.feature b/tests/acceptance/features/apiSharingNgShareInvitation/updateShareInvitations.feature index e8addc6a8..ad024c006 100644 --- a/tests/acceptance/features/apiSharingNgShareInvitation/updateShareInvitations.feature +++ b/tests/acceptance/features/apiSharingNgShareInvitation/updateShareInvitations.feature @@ -278,7 +278,7 @@ Feature: Update permission of a share }, "id": { "type": "string", - "pattern": "^u:%user_id_pattern%$" + "pattern": "^%permissions_id_pattern%$" }, "roles": { "type": "array", @@ -437,7 +437,7 @@ Feature: Update permission of a share }, "id": { "type": "string", - "pattern": "^g:%group_id_pattern%$" + "pattern": "^%permissions_id_pattern%$" }, "roles": { "type": "array", @@ -517,7 +517,7 @@ Feature: Update permission of a share }, "id": { "type": "string", - "pattern": "^g:%group_id_pattern%$" + "pattern": "^%permissions_id_pattern%$" }, "roles": { "type": "array", @@ -602,7 +602,7 @@ Feature: Update permission of a share }, "id": { "type": "string", - "pattern": "^g:%group_id_pattern%$" + "pattern": "^%permissions_id_pattern%$" }, "roles": { "type": "array", @@ -680,7 +680,7 @@ Feature: Update permission of a share }, "id": { "type": "string", - "pattern": "^g:%group_id_pattern%$" + "pattern": "^%permissions_id_pattern%$" }, "roles": { "type": "array", @@ -766,7 +766,7 @@ Feature: Update permission of a share }, "id": { "type": "string", - "pattern": "^g:%group_id_pattern%$" + "pattern": "^%permissions_id_pattern%$" }, "roles": { "type": "array", @@ -842,7 +842,7 @@ Feature: Update permission of a share }, "id": { "type": "string", - "pattern": "^u:%user_id_pattern%$" + "pattern": "^%permissions_id_pattern%$" }, "roles": { "type": "array", @@ -918,7 +918,7 @@ Feature: Update permission of a share }, "id": { "type": "string", - "pattern": "^u:%user_id_pattern%$" + "pattern": "^%permissions_id_pattern%$" }, "roles": { "type": "array", @@ -1000,7 +1000,7 @@ Feature: Update permission of a share }, "id": { "type": "string", - "pattern": "^u:%user_id_pattern%$" + "pattern": "^%permissions_id_pattern%$" }, "roles": { "type": "array", @@ -1077,7 +1077,7 @@ Feature: Update permission of a share }, "id": { "type": "string", - "pattern": "^u:%user_id_pattern%$" + "pattern": "^%permissions_id_pattern%$" }, "roles": { "type": "array", @@ -1159,7 +1159,7 @@ Feature: Update permission of a share }, "id": { "type": "string", - "pattern": "^u:%user_id_pattern%$" + "pattern": "^%permissions_id_pattern%$" }, "roles": { "type": "array", @@ -1417,7 +1417,7 @@ Feature: Update permission of a share } }, "id": { - "pattern": "^u:%user_id_pattern%$" + "pattern": "^%permissions_id_pattern%$" } } } From 4536fb20ce93443cb2c56130d3399a5f7f0571ab Mon Sep 17 00:00:00 2001 From: "v.scharf" Date: Mon, 13 Apr 2026 13:09:58 +0200 Subject: [PATCH 4/9] adjust tests --- .../acceptance/bootstrap/SharingNgContext.php | 123 +++++++++++++----- .../apiSharingNg1/removeAccessToDrive.feature | 4 +- 2 files changed, 93 insertions(+), 34 deletions(-) diff --git a/tests/acceptance/bootstrap/SharingNgContext.php b/tests/acceptance/bootstrap/SharingNgContext.php index df64e47e9..b1fc165af 100644 --- a/tests/acceptance/bootstrap/SharingNgContext.php +++ b/tests/acceptance/bootstrap/SharingNgContext.php @@ -39,6 +39,34 @@ class SharingNgContext implements Context { private FeatureContext $featureContext; private SpacesContext $spacesContext; + /** + * @var array + */ + private array $permissions = []; + + /** + * @param string $sharee + * @param ResponseInterface $response + * + * @return void + */ + public function setPermission(string $sharee, ResponseInterface $response): void { + $this->permissions[$sharee] = $this->featureContext->getJsonDecodedResponse($response)['value'][0]['id']; + } + + /** + * @param string $sharee + * + * @return string + * @throws Exception + */ + public function getPermission(string $sharee): string { + if (!isset($this->permissions[$sharee])) { + throw new Exception("No permission found for '$sharee'"); + } + return $this->permissions[$sharee]; + } + /** * This will run before EVERY scenario. * It will set the properties for this object. @@ -360,7 +388,7 @@ class SharingNgContext implements Context { $expirationDateTime ); if ($response->getStatusCode() === 200) { - $this->featureContext->shareNgAddToCreatedUserGroupShares($response); + $this->setPermission($sharee, $response); } return $response; } @@ -433,7 +461,7 @@ class SharingNgContext implements Context { $expirationDateTime ); if ($response->getStatusCode() === 200) { - $this->featureContext->shareNgAddToCreatedUserGroupShares($response); + $this->setPermission($sharee, $response); } return $response; } @@ -611,7 +639,7 @@ class SharingNgContext implements Context { * @return void */ public function userHasUpdatedTheLastResourceShareWithTheFollowingProperties(string $user, TableNode $table): void { - $permissionID = $this->featureContext->shareNgGetLastCreatedUserGroupShareID(); + $permissionID = $this->getPermission($table['sharee']); $response = $this->updateResourceShare( $user, $table, @@ -629,7 +657,7 @@ class SharingNgContext implements Context { * @return void */ public function userUpdatesTheLastShareWithFollowingPropertiesUsingGraphApi($user, TableNode $table) { - $permissionID = $this->featureContext->shareNgGetLastCreatedUserGroupShareID(); + $permissionID = $this->getPermission($table['sharee']); $this->featureContext->setResponse( $this->updateResourceShare( $user, @@ -655,7 +683,7 @@ class SharingNgContext implements Context { string $sharee, TableNode $table ) { - $permissionID = $this->featureContext->shareNgGetLastCreatedUserGroupShareID(); + $permissionID = $this->getPermission($table['sharee']); $this->featureContext->setResponse( $this->updateResourceShare( @@ -990,22 +1018,9 @@ class SharingNgContext implements Context { $itemId = (isset($resource)) ? $this->spacesContext->getResourceId($sharer, $space, $resource) : $this->spacesContext->getResourceId($sharer, $space, $space); - $permissionID = ""; - - // if resource is not provided then it indicates a space share - // and the space shares are not stored - // so build the permission-id using the user or group id - if ($resource === null) { - if ($shareType === "user") { - $permissionID = "u:" . $this->featureContext->getAttributeOfCreatedUser($recipient, 'id'); - } elseif ($shareType === "group") { - $permissionID = "g:" . $this->featureContext->getAttributeOfCreatedGroup($recipient, 'id'); - } - } else { - $permissionID = ($shareType === 'link') + $permissionID = ($shareType === 'link') ? $this->featureContext->shareNgGetLastCreatedLinkShareID() - : $this->featureContext->shareNgGetLastCreatedUserGroupShareID(); - } + : $this->getPermission($recipient); return GraphHelper::removeAccessToSpaceItem( @@ -1039,12 +1054,18 @@ class SharingNgContext implements Context { ): ResponseInterface { $spaceId = ($this->spacesContext->getSpaceByName($sharer, $space))["id"]; - $permissionID = match ($shareType) { - 'link' => $this->featureContext->shareNgGetLastCreatedLinkShareID(), - 'user' => $this->featureContext->shareNgGetLastCreatedUserGroupShareID(), - 'group' => $this->featureContext->shareNgGetLastCreatedUserGroupShareID(), - default => throw new Exception("shareType '$shareType' does not match user|group|link "), - }; + // if recipient is not provided, it means user tries to remove own access, then we need to get the user permission id + if (!isset($recipient)) { + $this->setPermission($sharer, $this->getDrivePermissionsList($sharer, $space)); + $permissionID = $this->getPermission($sharer); + } else { + $permissionID = match ($shareType) { + 'link' => $this->featureContext->shareNgGetLastCreatedLinkShareID(), + 'user' => $this->getPermission($recipient), + 'group' => $this->getPermission($recipient), + default => throw new Exception("shareType '$shareType' does not match user|group|link "), + }; + } return GraphHelper::removeAccessToSpace( @@ -1194,6 +1215,44 @@ class SharingNgContext implements Context { ); } + /** + * @When /^user "([^"]*)" removes own access from space "([^"]*)" using root endpoint of the Graph API$/ + * @When /^user "([^"]*)" tries to remove own access from space "([^"]*)" using root endpoint of the Graph API$/ + * + * @param string $user + * @param string $space + * + * @return void + * @throws JsonException + * @throws GuzzleException + */ + public function userRemovesOwnAccessFromSpaceUsingGraphAPI( + string $user, + string $space + ): void { + $this->featureContext->setResponse( + $this->removeAccessToSpace($user, 'user', $space) + ); + } + + /** + * @Given /^user "([^"]*)" has removed own access from space "([^"]*)"$/ + * + * @param string $user + * @param string $space + * + * @return void + * @throws JsonException + * @throws GuzzleException + */ + public function userHasRemovedOwnAccessFromSpace( + string $user, + string $space + ): void { + $response = $this->removeAccessToSpace($user, 'user', $space); + $this->featureContext->theHTTPStatusCodeShouldBe(204, "", $response); + } + /** * @When /^user "([^"]*)" removes the link from space "([^"]*)" using root endpoint of the Graph API$/ * @@ -1268,7 +1327,7 @@ class SharingNgContext implements Context { * @throws Exception|GuzzleException */ public function userHasDisabledSyncOfLastSharedResource(string $user): void { - $shareItemId = $this->featureContext->shareNgGetLastCreatedUserGroupShareID(); + $shareItemId = $this->getPermission($user); $shareSpaceId = GraphHelper::SHARES_SPACE_ID; $itemId = $shareSpaceId . '!' . $shareItemId; $response = GraphHelper::disableShareSync( @@ -1296,7 +1355,7 @@ class SharingNgContext implements Context { * @throws Exception */ public function userDisablesSyncOfShareUsingTheGraphApi(string $user): void { - $shareItemId = $this->featureContext->shareNgGetLastCreatedUserGroupShareID(); + $shareItemId = $this->getPermission($user); $shareSpaceId = GraphHelper::SHARES_SPACE_ID; $itemId = $shareSpaceId . '!' . $shareItemId; $response = GraphHelper::disableShareSync( @@ -1323,7 +1382,7 @@ class SharingNgContext implements Context { * @throws GuzzleException */ public function userHidesTheSharedResourceUsingTheGraphApi(string $user): void { - $shareItemId = $this->featureContext->shareNgGetLastCreatedUserGroupShareID(); + $shareItemId = $this->getPermission($user); $response = $this->hideOrUnhideSharedResource($user, $shareItemId); $this->featureContext->setResponse($response); } @@ -1338,7 +1397,7 @@ class SharingNgContext implements Context { * @throws GuzzleException */ public function userHasHiddenTheShare(string $user): void { - $shareItemId = $this->featureContext->shareNgGetLastCreatedUserGroupShareID(); + $shareItemId = $this->getPermission($user); $response = $this->hideOrUnhideSharedResource($user, $shareItemId); $this->featureContext->theHTTPStatusCodeShouldBe(200, '', $response); } @@ -1353,7 +1412,7 @@ class SharingNgContext implements Context { * @throws GuzzleException */ public function userUnhidesTheSharedResourceUsingTheGraphApi(string $user): void { - $shareItemId = $this->featureContext->shareNgGetLastCreatedUserGroupShareID(); + $shareItemId = $this->getPermission($user); $response = $this->hideOrUnhideSharedResource($user, $shareItemId, false); $this->featureContext->setResponse($response); } @@ -1649,7 +1708,7 @@ class SharingNgContext implements Context { TableNode $table ): void { $bodyRows = $table->getRowsHash(); - $permissionID = $this->featureContext->shareNgGetLastCreatedUserGroupShareID(); + $permissionID = $this->getPermission($bodyRows['sharee']); $space = $bodyRows['space']; $spaceId = ($this->spacesContext->getSpaceByName($user, $space))["id"]; $body = []; diff --git a/tests/acceptance/features/apiSharingNg1/removeAccessToDrive.feature b/tests/acceptance/features/apiSharingNg1/removeAccessToDrive.feature index 267020f6b..fc0ef7563 100644 --- a/tests/acceptance/features/apiSharingNg1/removeAccessToDrive.feature +++ b/tests/acceptance/features/apiSharingNg1/removeAccessToDrive.feature @@ -137,7 +137,7 @@ Feature: Remove access to a drive Scenario: user cannot remove himself from the project space if he is the last manager using root endpoint Given the administrator has assigned the role "Space Admin" to user "Alice" using the Graph API And user "Alice" has created a space "NewSpace" with the default quota using the Graph API - When user "Alice" tries to remove the access of user "Alice" from space "NewSpace" using root endpoint of the Graph API + When user "Alice" tries to remove own access from space "NewSpace" using root endpoint of the Graph API Then the HTTP status code should be "403" And the user "Alice" should have a space called "NewSpace" @@ -152,7 +152,7 @@ Feature: Remove access to a drive | sharee | group1 | | shareType | group | | permissionsRole | Manager | - And user "Alice" has removed the access of user "Alice" from space "NewSpace" + And user "Alice" has removed own access from space "NewSpace" When user "Brian" tries to remove the access of group "group1" from space "NewSpace" using root endpoint of the Graph API Then the HTTP status code should be "403" And the user "Brian" should have a space called "NewSpace" From 3be224127eda4795c1d9d9198fd191a895466621 Mon Sep 17 00:00:00 2001 From: "v.scharf" Date: Mon, 13 Apr 2026 18:39:45 +0200 Subject: [PATCH 5/9] adjust test --- .../acceptance/bootstrap/SharingNgContext.php | 69 +++++-------------- .../expected-failures-posix-storage.md | 4 ++ 2 files changed, 23 insertions(+), 50 deletions(-) diff --git a/tests/acceptance/bootstrap/SharingNgContext.php b/tests/acceptance/bootstrap/SharingNgContext.php index b1fc165af..50c91e001 100644 --- a/tests/acceptance/bootstrap/SharingNgContext.php +++ b/tests/acceptance/bootstrap/SharingNgContext.php @@ -39,34 +39,6 @@ class SharingNgContext implements Context { private FeatureContext $featureContext; private SpacesContext $spacesContext; - /** - * @var array - */ - private array $permissions = []; - - /** - * @param string $sharee - * @param ResponseInterface $response - * - * @return void - */ - public function setPermission(string $sharee, ResponseInterface $response): void { - $this->permissions[$sharee] = $this->featureContext->getJsonDecodedResponse($response)['value'][0]['id']; - } - - /** - * @param string $sharee - * - * @return string - * @throws Exception - */ - public function getPermission(string $sharee): string { - if (!isset($this->permissions[$sharee])) { - throw new Exception("No permission found for '$sharee'"); - } - return $this->permissions[$sharee]; - } - /** * This will run before EVERY scenario. * It will set the properties for this object. @@ -388,7 +360,7 @@ class SharingNgContext implements Context { $expirationDateTime ); if ($response->getStatusCode() === 200) { - $this->setPermission($sharee, $response); + $this->featureContext->shareNgAddToCreatedUserGroupShares($response); } return $response; } @@ -461,7 +433,7 @@ class SharingNgContext implements Context { $expirationDateTime ); if ($response->getStatusCode() === 200) { - $this->setPermission($sharee, $response); + $this->featureContext->shareNgAddToCreatedUserGroupShares($response); } return $response; } @@ -639,7 +611,7 @@ class SharingNgContext implements Context { * @return void */ public function userHasUpdatedTheLastResourceShareWithTheFollowingProperties(string $user, TableNode $table): void { - $permissionID = $this->getPermission($table['sharee']); + $permissionID = $this->featureContext->shareNgGetLastCreatedUserGroupShareID(); $response = $this->updateResourceShare( $user, $table, @@ -657,7 +629,7 @@ class SharingNgContext implements Context { * @return void */ public function userUpdatesTheLastShareWithFollowingPropertiesUsingGraphApi($user, TableNode $table) { - $permissionID = $this->getPermission($table['sharee']); + $permissionID = $this->featureContext->shareNgGetLastCreatedUserGroupShareID(); $this->featureContext->setResponse( $this->updateResourceShare( $user, @@ -683,8 +655,7 @@ class SharingNgContext implements Context { string $sharee, TableNode $table ) { - $permissionID = $this->getPermission($table['sharee']); - + $permissionID = $this->featureContext->shareNgGetLastCreatedUserGroupShareID(); $this->featureContext->setResponse( $this->updateResourceShare( $user, @@ -1001,7 +972,6 @@ class SharingNgContext implements Context { * @param string $shareType (user|group|link) * @param string $space * @param string|null $resource - * @param string|null $recipient * * @return ResponseInterface * @throws GuzzleException @@ -1011,8 +981,7 @@ class SharingNgContext implements Context { string $sharer, string $shareType, string $space, - ?string $resource = null, - ?string $recipient = null + ?string $resource = null ): ResponseInterface { $spaceId = ($this->spacesContext->getSpaceByName($sharer, $space))["id"]; $itemId = (isset($resource)) ? $this->spacesContext->getResourceId($sharer, $space, $resource) @@ -1020,7 +989,7 @@ class SharingNgContext implements Context { $permissionID = ($shareType === 'link') ? $this->featureContext->shareNgGetLastCreatedLinkShareID() - : $this->getPermission($recipient); + : $this->featureContext->shareNgGetLastCreatedUserGroupShareID(); return GraphHelper::removeAccessToSpaceItem( @@ -1055,14 +1024,14 @@ class SharingNgContext implements Context { $spaceId = ($this->spacesContext->getSpaceByName($sharer, $space))["id"]; // if recipient is not provided, it means user tries to remove own access, then we need to get the user permission id - if (!isset($recipient)) { - $this->setPermission($sharer, $this->getDrivePermissionsList($sharer, $space)); - $permissionID = $this->getPermission($sharer); + if ($shareType == 'user' && !isset($recipient)) { + $this->featureContext->shareNgAddToCreatedUserGroupShares($this->getDrivePermissionsList($sharer, $space)); + $permissionID = $this->featureContext->shareNgGetLastCreatedUserGroupShareID(); } else { $permissionID = match ($shareType) { 'link' => $this->featureContext->shareNgGetLastCreatedLinkShareID(), - 'user' => $this->getPermission($recipient), - 'group' => $this->getPermission($recipient), + 'user' => $this->featureContext->shareNgGetLastCreatedUserGroupShareID(), + 'group' => $this->featureContext->shareNgGetLastCreatedUserGroupShareID(), default => throw new Exception("shareType '$shareType' does not match user|group|link "), }; } @@ -1098,7 +1067,7 @@ class SharingNgContext implements Context { string $resource, string $space ): void { - $response = $this->removeAccessToSpaceItem($sharer, $recipientType, $space, $resource); + $response = $this->removeAccessToSpaceItem($sharer, $recipientType, $space, $resource, $recipient); $this->featureContext->theHTTPStatusCodeShouldBe(204, "", $response); } @@ -1327,7 +1296,7 @@ class SharingNgContext implements Context { * @throws Exception|GuzzleException */ public function userHasDisabledSyncOfLastSharedResource(string $user): void { - $shareItemId = $this->getPermission($user); + $shareItemId = $this->featureContext->shareNgGetLastCreatedUserGroupShareID(); $shareSpaceId = GraphHelper::SHARES_SPACE_ID; $itemId = $shareSpaceId . '!' . $shareItemId; $response = GraphHelper::disableShareSync( @@ -1355,7 +1324,7 @@ class SharingNgContext implements Context { * @throws Exception */ public function userDisablesSyncOfShareUsingTheGraphApi(string $user): void { - $shareItemId = $this->getPermission($user); + $shareItemId = $this->featureContext->shareNgGetLastCreatedUserGroupShareID(); $shareSpaceId = GraphHelper::SHARES_SPACE_ID; $itemId = $shareSpaceId . '!' . $shareItemId; $response = GraphHelper::disableShareSync( @@ -1382,7 +1351,7 @@ class SharingNgContext implements Context { * @throws GuzzleException */ public function userHidesTheSharedResourceUsingTheGraphApi(string $user): void { - $shareItemId = $this->getPermission($user); + $shareItemId = $this->featureContext->shareNgGetLastCreatedUserGroupShareID(); $response = $this->hideOrUnhideSharedResource($user, $shareItemId); $this->featureContext->setResponse($response); } @@ -1397,7 +1366,7 @@ class SharingNgContext implements Context { * @throws GuzzleException */ public function userHasHiddenTheShare(string $user): void { - $shareItemId = $this->getPermission($user); + $shareItemId = $this->featureContext->shareNgGetLastCreatedUserGroupShareID(); $response = $this->hideOrUnhideSharedResource($user, $shareItemId); $this->featureContext->theHTTPStatusCodeShouldBe(200, '', $response); } @@ -1412,7 +1381,7 @@ class SharingNgContext implements Context { * @throws GuzzleException */ public function userUnhidesTheSharedResourceUsingTheGraphApi(string $user): void { - $shareItemId = $this->getPermission($user); + $shareItemId = $this->featureContext->shareNgGetLastCreatedUserGroupShareID(); $response = $this->hideOrUnhideSharedResource($user, $shareItemId, false); $this->featureContext->setResponse($response); } @@ -1708,7 +1677,7 @@ class SharingNgContext implements Context { TableNode $table ): void { $bodyRows = $table->getRowsHash(); - $permissionID = $this->getPermission($bodyRows['sharee']); + $permissionID = $this->featureContext->shareNgGetLastCreatedUserGroupShareID(); $space = $bodyRows['space']; $spaceId = ($this->spacesContext->getSpaceByName($user, $space))["id"]; $body = []; diff --git a/tests/acceptance/expected-failures-posix-storage.md b/tests/acceptance/expected-failures-posix-storage.md index a8c71b236..6711e684f 100644 --- a/tests/acceptance/expected-failures-posix-storage.md +++ b/tests/acceptance/expected-failures-posix-storage.md @@ -345,6 +345,10 @@ _ocdav: api compatibility, return correct status code_ - [coreApiWebdavPreviews/previews.feature:264](https://github.com/opencloud-eu/opencloud/blob/main/tests/acceptance/features/coreApiWebdavPreviews/previews.feature#L264) - [coreApiWebdavPreviews/previews.feature:265](https://github.com/opencloud-eu/opencloud/blob/main/tests/acceptance/features/coreApiWebdavPreviews/previews.feature#L265) +### TODO: adjust test + +- [apiSharingNg1/removeAccessToDrive.feature:145](https://github.com/opencloud-eu/opencloud/blob/main/tests/acceptance/features/apiSharingNg1/removeAccessToDrive.feature#L145) + ### Won't fix From 066cef17c4abf62db92ba85723d488d110fa11b5 Mon Sep 17 00:00:00 2001 From: Ralf Haferkamp Date: Wed, 8 Apr 2026 16:40:05 +0200 Subject: [PATCH 6/9] bump reva to feature/guest-links branch --- go.mod | 4 +- go.sum | 8 +- .../app/provider/v1beta1/provider_api.pb.go | 2 +- .../provider/v1beta1/provider_api_grpc.pb.go | 2 +- .../cs3/app/provider/v1beta1/resources.pb.go | 2 +- .../app/registry/v1beta1/registry_api.pb.go | 2 +- .../registry/v1beta1/registry_api_grpc.pb.go | 2 +- .../cs3/app/registry/v1beta1/resources.pb.go | 2 +- .../v1beta1/applications_api.pb.go | 2 +- .../v1beta1/applications_api_grpc.pb.go | 2 +- .../auth/applications/v1beta1/resources.pb.go | 2 +- .../auth/provider/v1beta1/provider_api.pb.go | 2 +- .../provider/v1beta1/provider_api_grpc.pb.go | 2 +- .../cs3/auth/provider/v1beta1/resources.pb.go | 2 +- .../auth/registry/v1beta1/registry_api.pb.go | 2 +- .../registry/v1beta1/registry_api_grpc.pb.go | 2 +- .../cs3/auth/registry/v1beta1/resources.pb.go | 2 +- .../cs3/gateway/v1beta1/gateway_api.pb.go | 2 +- .../gateway/v1beta1/gateway_api_grpc.pb.go | 2 +- .../cs3/gateway/v1beta1/resources.pb.go | 2 +- .../identity/group/v1beta1/group_api.pb.go | 2 +- .../group/v1beta1/group_api_grpc.pb.go | 2 +- .../identity/group/v1beta1/resources.pb.go | 2 +- .../cs3/identity/user/v1beta1/resources.pb.go | 173 ++++++--- .../cs3/identity/user/v1beta1/user_api.pb.go | 2 +- .../identity/user/v1beta1/user_api_grpc.pb.go | 2 +- .../cs3/ocm/core/v1beta1/ocm_core_api.pb.go | 2 +- .../ocm/core/v1beta1/ocm_core_api_grpc.pb.go | 2 +- .../incoming/v1beta1/ocm_incoming_api.pb.go | 2 +- .../v1beta1/ocm_incoming_api_grpc.pb.go | 2 +- .../cs3/ocm/invite/v1beta1/invite_api.pb.go | 2 +- .../ocm/invite/v1beta1/invite_api_grpc.pb.go | 2 +- .../cs3/ocm/invite/v1beta1/resources.pb.go | 2 +- .../ocm/provider/v1beta1/provider_api.pb.go | 2 +- .../provider/v1beta1/provider_api_grpc.pb.go | 2 +- .../cs3/ocm/provider/v1beta1/resources.pb.go | 2 +- .../permissions/v1beta1/permissions_api.pb.go | 2 +- .../v1beta1/permissions_api_grpc.pb.go | 2 +- .../cs3/permissions/v1beta1/resources.pb.go | 2 +- .../preferences/v1beta1/preferences_api.pb.go | 2 +- .../v1beta1/preferences_api_grpc.pb.go | 2 +- .../cs3/preferences/v1beta1/resources.pb.go | 2 +- .../go-cs3apis/cs3/rpc/v1beta1/code.pb.go | 2 +- .../go-cs3apis/cs3/rpc/v1beta1/status.pb.go | 2 +- .../v1beta1/collaboration_api.pb.go | 2 +- .../v1beta1/collaboration_api_grpc.pb.go | 2 +- .../collaboration/v1beta1/resources.pb.go | 131 ++++--- .../cs3/sharing/link/v1beta1/link_api.pb.go | 2 +- .../sharing/link/v1beta1/link_api_grpc.pb.go | 2 +- .../cs3/sharing/link/v1beta1/resources.pb.go | 2 +- .../cs3/sharing/ocm/v1beta1/ocm_api.pb.go | 2 +- .../sharing/ocm/v1beta1/ocm_api_grpc.pb.go | 2 +- .../cs3/sharing/ocm/v1beta1/resources.pb.go | 2 +- .../provider/v1beta1/provider_api.pb.go | 2 +- .../provider/v1beta1/provider_api_grpc.pb.go | 2 +- .../storage/provider/v1beta1/resources.pb.go | 2 +- .../storage/provider/v1beta1/spaces_api.pb.go | 2 +- .../provider/v1beta1/spaces_api_grpc.pb.go | 2 +- .../registry/v1beta1/registry_api.pb.go | 2 +- .../registry/v1beta1/registry_api_grpc.pb.go | 2 +- .../storage/registry/v1beta1/resources.pb.go | 2 +- .../go-cs3apis/cs3/tx/v1beta1/resources.pb.go | 2 +- .../go-cs3apis/cs3/tx/v1beta1/tx_api.pb.go | 2 +- .../cs3/tx/v1beta1/tx_api_grpc.pb.go | 2 +- .../go-cs3apis/cs3/types/v1beta1/types.pb.go | 2 +- .../eventsmiddleware/conversion.go | 35 +- .../interceptors/eventsmiddleware/events.go | 39 +- .../grpc/services/gateway/storageprovider.go | 48 +++ .../services/gateway/usershareprovider.go | 45 ++- .../sharesstorageprovider.go | 17 +- .../usershareprovider/usershareprovider.go | 176 +++++++-- .../handlers/apps/sharing/shares/pending.go | 4 + .../handlers/apps/sharing/shares/shares.go | 9 +- .../handlers/apps/sharing/shares/spaces.go | 213 ++++------- .../ocs/handlers/apps/sharing/shares/user.go | 3 +- .../http/services/owncloud/ocs/ocs.go | 7 + .../v2/pkg/share/manager/jsoncs3/jsoncs3.go | 17 - .../v2/pkg/share/manager/memory/memory.go | 5 - .../opencloud-eu/reva/v2/pkg/share/share.go | 15 + .../reva/v2/pkg/storage/cache/stat.go | 2 +- .../v2/pkg/storage/fs/posix/lookup/lookup.go | 2 +- .../pkg/storage/fs/posix/trashbin/trashbin.go | 2 +- .../{watcher_linux.go => inotifywatcher.go} | 7 +- .../fs/posix/tree/inotifywatcher_default.go | 23 ++ .../reva/v2/pkg/storage/fs/posix/tree/tree.go | 16 +- .../v2/pkg/storage/fs/posix/tree/watch.go | 13 - .../storage/fs/posix/tree/watcher_darwin.go | 226 ----------- .../storage/fs/posix/tree/watcher_others.go | 17 - .../storage/pkg/decomposedfs/decomposedfs.go | 2 +- .../storage/pkg/decomposedfs/lookup/lookup.go | 2 +- .../decomposedfs/metadata/hybrid_backend.go | 41 +- .../pkg/decomposedfs/metadata/metadata.go | 2 +- .../pkg/storage/pkg/decomposedfs/node/node.go | 2 +- .../permissions/spacepermissions.go | 2 +- .../tree/propagator/propagator.go | 2 +- .../pkg/storage/pkg/decomposedfs/tree/tree.go | 2 +- .../storage/pkg/decomposedfs/upload/upload.go | 2 +- .../reva/v2/pkg/storage/utils/metadata/cs3.go | 2 +- .../opencloud-eu/reva/v2/pkg/utils/utils.go | 10 + .../tests/cs3mocks/mocks/SpacesAPIClient.go | 350 ++++++++++++++++++ .../mocks/StorageRegistryAPIClient.go | 277 ++++++++++++++ vendor/modules.txt | 4 +- 102 files changed, 1345 insertions(+), 734 deletions(-) rename vendor/github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/tree/{watcher_linux.go => inotifywatcher.go} (98%) create mode 100644 vendor/github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/tree/inotifywatcher_default.go delete mode 100644 vendor/github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/tree/watch.go delete mode 100644 vendor/github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/tree/watcher_darwin.go delete mode 100644 vendor/github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/tree/watcher_others.go create mode 100644 vendor/github.com/opencloud-eu/reva/v2/tests/cs3mocks/mocks/SpacesAPIClient.go create mode 100644 vendor/github.com/opencloud-eu/reva/v2/tests/cs3mocks/mocks/StorageRegistryAPIClient.go diff --git a/go.mod b/go.mod index 84cee8c36..4e845c1ed 100644 --- a/go.mod +++ b/go.mod @@ -14,7 +14,7 @@ require ( github.com/blevesearch/bleve/v2 v2.5.7 github.com/cenkalti/backoff v2.2.1+incompatible github.com/coreos/go-oidc/v3 v3.18.0 - github.com/cs3org/go-cs3apis v0.0.0-20260407125717-5d69ba49048b + github.com/cs3org/go-cs3apis v0.0.0-20260422093003-c97949ae7a1d github.com/davidbyttow/govips/v2 v2.18.0 github.com/dhowden/tag v0.0.0-20240417053706-3d75831295e8 github.com/dutchcoders/go-clamd v0.0.0-20170520113014-b970184f4d9e @@ -65,7 +65,7 @@ require ( github.com/open-policy-agent/opa v1.15.2 github.com/opencloud-eu/icap-client v0.0.0-20250930132611-28a2afe62d89 github.com/opencloud-eu/libre-graph-api-go v1.0.8-0.20260310090739-853d972b282d - github.com/opencloud-eu/reva/v2 v2.43.0 + github.com/opencloud-eu/reva/v2 v2.42.7-0.20260423074216-11463a55c9a4 github.com/opensearch-project/opensearch-go/v4 v4.6.0 github.com/orcaman/concurrent-map v1.0.0 github.com/pkg/errors v0.9.1 diff --git a/go.sum b/go.sum index 779a29b4e..87aaa0c42 100644 --- a/go.sum +++ b/go.sum @@ -264,8 +264,8 @@ github.com/crewjam/httperr v0.2.0 h1:b2BfXR8U3AlIHwNeFFvZ+BV1LFvKLlzMjzaTnZMybNo github.com/crewjam/httperr v0.2.0/go.mod h1:Jlz+Sg/XqBQhyMjdDiC+GNNRzZTD7x39Gu3pglZ5oH4= github.com/crewjam/saml v0.4.14 h1:g9FBNx62osKusnFzs3QTN5L9CVA/Egfgm+stJShzw/c= github.com/crewjam/saml v0.4.14/go.mod h1:UVSZCf18jJkk6GpWNVqcyQJMD5HsRugBPf4I1nl2mME= -github.com/cs3org/go-cs3apis v0.0.0-20260407125717-5d69ba49048b h1:WNwuveokaUXIAGrwVLWqJSk0BdJv8k+9RXipBItGuyY= -github.com/cs3org/go-cs3apis v0.0.0-20260407125717-5d69ba49048b/go.mod h1:DedpcqXl193qF/08Y04IO0PpxyyMu8+GrkD6kWK2MEQ= +github.com/cs3org/go-cs3apis v0.0.0-20260422093003-c97949ae7a1d h1:OskzS3/kqXRpp9B+svjTRCnqBvojfMJuOy6QSCCf9+s= +github.com/cs3org/go-cs3apis v0.0.0-20260422093003-c97949ae7a1d/go.mod h1:DedpcqXl193qF/08Y04IO0PpxyyMu8+GrkD6kWK2MEQ= github.com/cyberdelia/templates v0.0.0-20141128023046-ca7fffd4298c/go.mod h1:GyV+0YP4qX0UQ7r2MoYZ+AvYDp12OF5yg4q8rGnyNh4= github.com/cyphar/filepath-securejoin v0.5.1 h1:eYgfMq5yryL4fbWfkLpFFy2ukSELzaJOTaUTuh+oF48= github.com/cyphar/filepath-securejoin v0.5.1/go.mod h1:Sdj7gXlvMcPZsbhwhQ33GguGLDGQL7h7bg04C/+u9jI= @@ -952,8 +952,8 @@ github.com/opencloud-eu/inotifywaitgo v0.0.0-20251111171128-a390bae3c5e9 h1:dIft github.com/opencloud-eu/inotifywaitgo v0.0.0-20251111171128-a390bae3c5e9/go.mod h1:JWyDC6H+5oZRdUJUgKuaye+8Ph5hEs6HVzVoPKzWSGI= github.com/opencloud-eu/libre-graph-api-go v1.0.8-0.20260310090739-853d972b282d h1:JcqGDiyrcaQwVyV861TUyQgO7uEmsjkhfm7aQd84dOw= github.com/opencloud-eu/libre-graph-api-go v1.0.8-0.20260310090739-853d972b282d/go.mod h1:pzatilMEHZFT3qV7C/X3MqOa3NlRQuYhlRhZTL+hN6Q= -github.com/opencloud-eu/reva/v2 v2.43.0 h1:b7YazijK2K3O6MM7wsUxE2UmlRkrE8h3NUxIl5nxQmo= -github.com/opencloud-eu/reva/v2 v2.43.0/go.mod h1:iXbAo4xX1PFucJjFxMsFk7DlhnfAskAt5zV2eYUVJYE= +github.com/opencloud-eu/reva/v2 v2.42.7-0.20260423074216-11463a55c9a4 h1:Ka8HHFl+vLJ4Y5ZWoL9Gw9mkHE5eKKXi2o1XFbLyhcE= +github.com/opencloud-eu/reva/v2 v2.42.7-0.20260423074216-11463a55c9a4/go.mod h1:vCgkkDyeXaAZ409xMB2FeYNCQaxEHgbV9dfP0xP92Bo= github.com/opencloud-eu/secure v0.0.0-20260312082735-b6f5cb2244e4 h1:l2oB/RctH+t8r7QBj5p8thfEHCM/jF35aAY3WQ3hADI= github.com/opencloud-eu/secure v0.0.0-20260312082735-b6f5cb2244e4/go.mod h1:BmF5hyM6tXczk3MpQkFf1hpKSRqCyhqcbiQtiAF7+40= github.com/opencontainers/go-digest v1.0.0 h1:apOUWs51W5PlhuyGyz9FCeeBIOUDA/6nW8Oi/yOhh5U= diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/app/provider/v1beta1/provider_api.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/app/provider/v1beta1/provider_api.pb.go index 43522bd46..cc9dd1d62 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/app/provider/v1beta1/provider_api.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/app/provider/v1beta1/provider_api.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/app/provider/v1beta1/provider_api_grpc.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/app/provider/v1beta1/provider_api_grpc.pb.go index 405ccbcbc..68e88e029 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/app/provider/v1beta1/provider_api_grpc.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/app/provider/v1beta1/provider_api_grpc.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/app/provider/v1beta1/resources.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/app/provider/v1beta1/resources.pb.go index a48504a7e..d2a72d986 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/app/provider/v1beta1/resources.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/app/provider/v1beta1/resources.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/app/registry/v1beta1/registry_api.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/app/registry/v1beta1/registry_api.pb.go index 4bf479e5d..7ba94536c 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/app/registry/v1beta1/registry_api.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/app/registry/v1beta1/registry_api.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/app/registry/v1beta1/registry_api_grpc.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/app/registry/v1beta1/registry_api_grpc.pb.go index 8bbf1d894..54d846fb4 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/app/registry/v1beta1/registry_api_grpc.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/app/registry/v1beta1/registry_api_grpc.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/app/registry/v1beta1/resources.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/app/registry/v1beta1/resources.pb.go index 887733687..ac6fb5249 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/app/registry/v1beta1/resources.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/app/registry/v1beta1/resources.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/auth/applications/v1beta1/applications_api.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/auth/applications/v1beta1/applications_api.pb.go index bd8b29a48..99dcecd06 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/auth/applications/v1beta1/applications_api.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/auth/applications/v1beta1/applications_api.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/auth/applications/v1beta1/applications_api_grpc.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/auth/applications/v1beta1/applications_api_grpc.pb.go index 010216c59..9240e0fb5 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/auth/applications/v1beta1/applications_api_grpc.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/auth/applications/v1beta1/applications_api_grpc.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/auth/applications/v1beta1/resources.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/auth/applications/v1beta1/resources.pb.go index 56f537983..4928d5d7c 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/auth/applications/v1beta1/resources.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/auth/applications/v1beta1/resources.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/auth/provider/v1beta1/provider_api.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/auth/provider/v1beta1/provider_api.pb.go index 3e0844111..830be7347 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/auth/provider/v1beta1/provider_api.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/auth/provider/v1beta1/provider_api.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/auth/provider/v1beta1/provider_api_grpc.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/auth/provider/v1beta1/provider_api_grpc.pb.go index 16c3ac057..8571f26c1 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/auth/provider/v1beta1/provider_api_grpc.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/auth/provider/v1beta1/provider_api_grpc.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/auth/provider/v1beta1/resources.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/auth/provider/v1beta1/resources.pb.go index 82931eb54..d9c2c4461 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/auth/provider/v1beta1/resources.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/auth/provider/v1beta1/resources.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/auth/registry/v1beta1/registry_api.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/auth/registry/v1beta1/registry_api.pb.go index a0604df86..d1f7fb3d8 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/auth/registry/v1beta1/registry_api.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/auth/registry/v1beta1/registry_api.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/auth/registry/v1beta1/registry_api_grpc.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/auth/registry/v1beta1/registry_api_grpc.pb.go index 9d96c7d1d..6d5cc4ea2 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/auth/registry/v1beta1/registry_api_grpc.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/auth/registry/v1beta1/registry_api_grpc.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/auth/registry/v1beta1/resources.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/auth/registry/v1beta1/resources.pb.go index 76a536864..486b81c07 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/auth/registry/v1beta1/resources.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/auth/registry/v1beta1/resources.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/gateway/v1beta1/gateway_api.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/gateway/v1beta1/gateway_api.pb.go index 709154cf3..ac499a4f4 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/gateway/v1beta1/gateway_api.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/gateway/v1beta1/gateway_api.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/gateway/v1beta1/gateway_api_grpc.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/gateway/v1beta1/gateway_api_grpc.pb.go index 5480483d2..d766c1516 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/gateway/v1beta1/gateway_api_grpc.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/gateway/v1beta1/gateway_api_grpc.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/gateway/v1beta1/resources.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/gateway/v1beta1/resources.pb.go index ad4a21185..0f4d3ea83 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/gateway/v1beta1/resources.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/gateway/v1beta1/resources.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/identity/group/v1beta1/group_api.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/identity/group/v1beta1/group_api.pb.go index 06c139245..f9bf4d327 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/identity/group/v1beta1/group_api.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/identity/group/v1beta1/group_api.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/identity/group/v1beta1/group_api_grpc.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/identity/group/v1beta1/group_api_grpc.pb.go index ec60660dd..e9fbd4302 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/identity/group/v1beta1/group_api_grpc.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/identity/group/v1beta1/group_api_grpc.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/identity/group/v1beta1/resources.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/identity/group/v1beta1/resources.pb.go index ea742685d..f30d2fa4b 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/identity/group/v1beta1/resources.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/identity/group/v1beta1/resources.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/identity/user/v1beta1/resources.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/identity/user/v1beta1/resources.pb.go index b28770518..7da931a4e 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/identity/user/v1beta1/resources.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/identity/user/v1beta1/resources.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. @@ -116,6 +116,60 @@ func (UserType) EnumDescriptor() ([]byte, []int) { return file_cs3_identity_user_v1beta1_resources_proto_rawDescGZIP(), []int{0} } +// The status of a user. +type UserStatus int32 + +const ( + // The user is active and allowed to log in. + UserStatus_USER_STATUS_ACTIVE UserStatus = 0 + // The user can log in but its validity is about to expire. + // The actual grace period the user is granted depends on its tenant's policy. + UserStatus_USER_STATUS_EXPIRING UserStatus = 1 + // The user is valid but it has been blocked from login in its tenant. + UserStatus_USER_STATUS_BLOCKED UserStatus = 2 +) + +// Enum value maps for UserStatus. +var ( + UserStatus_name = map[int32]string{ + 0: "USER_STATUS_ACTIVE", + 1: "USER_STATUS_EXPIRING", + 2: "USER_STATUS_BLOCKED", + } + UserStatus_value = map[string]int32{ + "USER_STATUS_ACTIVE": 0, + "USER_STATUS_EXPIRING": 1, + "USER_STATUS_BLOCKED": 2, + } +) + +func (x UserStatus) Enum() *UserStatus { + p := new(UserStatus) + *p = x + return p +} + +func (x UserStatus) String() string { + return protoimpl.X.EnumStringOf(x.Descriptor(), protoreflect.EnumNumber(x)) +} + +func (UserStatus) Descriptor() protoreflect.EnumDescriptor { + return file_cs3_identity_user_v1beta1_resources_proto_enumTypes[1].Descriptor() +} + +func (UserStatus) Type() protoreflect.EnumType { + return &file_cs3_identity_user_v1beta1_resources_proto_enumTypes[1] +} + +func (x UserStatus) Number() protoreflect.EnumNumber { + return protoreflect.EnumNumber(x) +} + +// Deprecated: Use UserStatus.Descriptor instead. +func (UserStatus) EnumDescriptor() ([]byte, []int) { + return file_cs3_identity_user_v1beta1_resources_proto_rawDescGZIP(), []int{1} +} + // ExternalIdentity represents an external identifier of a user. // This can be populated when multiple identities collapse onto // the same user, for example when signing in with e-mail or with @@ -306,6 +360,11 @@ type User struct { // OPTIONAL. // The group id of this user in the Unix world. GidNumber int64 `protobuf:"varint,9,opt,name=gid_number,json=gidNumber,proto3" json:"gid_number,omitempty"` + // OPTIONAL. + // The status of this user in the tenant it belongs to. + // Useful for tenants implementing a users lifecycle, + // otherwise it defaults to ACTIVE. + Status UserStatus `protobuf:"varint,10,opt,name=status,proto3,enum=cs3.identity.user.v1beta1.UserStatus" json:"status,omitempty"` } func (x *User) Reset() { @@ -403,6 +462,13 @@ func (x *User) GetGidNumber() int64 { return 0 } +func (x *User) GetStatus() UserStatus { + if x != nil { + return x.Status + } + return UserStatus_USER_STATUS_ACTIVE +} + var File_cs3_identity_user_v1beta1_resources_proto protoreflect.FileDescriptor var file_cs3_identity_user_v1beta1_resources_proto_rawDesc = []byte{ @@ -431,7 +497,7 @@ var file_cs3_identity_user_v1beta1_resources_proto_rawDesc = []byte{ 0x74, 0x69, 0x74, 0x79, 0x2e, 0x75, 0x73, 0x65, 0x72, 0x2e, 0x76, 0x31, 0x62, 0x65, 0x74, 0x61, 0x31, 0x2e, 0x45, 0x78, 0x74, 0x65, 0x72, 0x6e, 0x61, 0x6c, 0x49, 0x64, 0x65, 0x6e, 0x74, 0x69, 0x74, 0x79, 0x52, 0x12, 0x65, 0x78, 0x74, 0x65, 0x72, 0x6e, 0x61, 0x6c, 0x49, 0x64, 0x65, 0x6e, - 0x74, 0x69, 0x74, 0x69, 0x65, 0x73, 0x22, 0xba, 0x02, 0x0a, 0x04, 0x55, 0x73, 0x65, 0x72, 0x12, + 0x74, 0x69, 0x74, 0x69, 0x65, 0x73, 0x22, 0xf9, 0x02, 0x0a, 0x04, 0x55, 0x73, 0x65, 0x72, 0x12, 0x31, 0x0a, 0x02, 0x69, 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x21, 0x2e, 0x63, 0x73, 0x33, 0x2e, 0x69, 0x64, 0x65, 0x6e, 0x74, 0x69, 0x74, 0x79, 0x2e, 0x75, 0x73, 0x65, 0x72, 0x2e, 0x76, 0x31, 0x62, 0x65, 0x74, 0x61, 0x31, 0x2e, 0x55, 0x73, 0x65, 0x72, 0x49, 0x64, 0x52, 0x02, @@ -451,38 +517,47 @@ var file_cs3_identity_user_v1beta1_resources_proto_rawDesc = []byte{ 0x62, 0x65, 0x72, 0x18, 0x08, 0x20, 0x01, 0x28, 0x03, 0x52, 0x09, 0x75, 0x69, 0x64, 0x4e, 0x75, 0x6d, 0x62, 0x65, 0x72, 0x12, 0x1d, 0x0a, 0x0a, 0x67, 0x69, 0x64, 0x5f, 0x6e, 0x75, 0x6d, 0x62, 0x65, 0x72, 0x18, 0x09, 0x20, 0x01, 0x28, 0x03, 0x52, 0x09, 0x67, 0x69, 0x64, 0x4e, 0x75, 0x6d, - 0x62, 0x65, 0x72, 0x2a, 0xe7, 0x01, 0x0a, 0x08, 0x55, 0x73, 0x65, 0x72, 0x54, 0x79, 0x70, 0x65, - 0x12, 0x15, 0x0a, 0x11, 0x55, 0x53, 0x45, 0x52, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x49, 0x4e, - 0x56, 0x41, 0x4c, 0x49, 0x44, 0x10, 0x00, 0x12, 0x15, 0x0a, 0x11, 0x55, 0x53, 0x45, 0x52, 0x5f, - 0x54, 0x59, 0x50, 0x45, 0x5f, 0x50, 0x52, 0x49, 0x4d, 0x41, 0x52, 0x59, 0x10, 0x01, 0x12, 0x17, - 0x0a, 0x13, 0x55, 0x53, 0x45, 0x52, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x53, 0x45, 0x43, 0x4f, - 0x4e, 0x44, 0x41, 0x52, 0x59, 0x10, 0x02, 0x12, 0x15, 0x0a, 0x11, 0x55, 0x53, 0x45, 0x52, 0x5f, - 0x54, 0x59, 0x50, 0x45, 0x5f, 0x53, 0x45, 0x52, 0x56, 0x49, 0x43, 0x45, 0x10, 0x03, 0x12, 0x19, - 0x0a, 0x15, 0x55, 0x53, 0x45, 0x52, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x41, 0x50, 0x50, 0x4c, - 0x49, 0x43, 0x41, 0x54, 0x49, 0x4f, 0x4e, 0x10, 0x04, 0x12, 0x13, 0x0a, 0x0f, 0x55, 0x53, 0x45, - 0x52, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x47, 0x55, 0x45, 0x53, 0x54, 0x10, 0x05, 0x12, 0x17, - 0x0a, 0x13, 0x55, 0x53, 0x45, 0x52, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x46, 0x45, 0x44, 0x45, - 0x52, 0x41, 0x54, 0x45, 0x44, 0x10, 0x06, 0x12, 0x19, 0x0a, 0x15, 0x55, 0x53, 0x45, 0x52, 0x5f, - 0x54, 0x59, 0x50, 0x45, 0x5f, 0x4c, 0x49, 0x47, 0x48, 0x54, 0x57, 0x45, 0x49, 0x47, 0x48, 0x54, - 0x10, 0x07, 0x12, 0x19, 0x0a, 0x15, 0x55, 0x53, 0x45, 0x52, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, - 0x53, 0x50, 0x41, 0x43, 0x45, 0x5f, 0x4f, 0x57, 0x4e, 0x45, 0x52, 0x10, 0x08, 0x42, 0xfa, 0x01, - 0x0a, 0x1d, 0x63, 0x6f, 0x6d, 0x2e, 0x63, 0x73, 0x33, 0x2e, 0x69, 0x64, 0x65, 0x6e, 0x74, 0x69, - 0x74, 0x79, 0x2e, 0x75, 0x73, 0x65, 0x72, 0x2e, 0x76, 0x31, 0x62, 0x65, 0x74, 0x61, 0x31, 0x42, - 0x0e, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x73, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, - 0x01, 0x5a, 0x42, 0x67, 0x69, 0x74, 0x68, 0x75, 0x62, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x63, 0x73, - 0x33, 0x6f, 0x72, 0x67, 0x2f, 0x67, 0x6f, 0x2d, 0x63, 0x73, 0x33, 0x61, 0x70, 0x69, 0x73, 0x2f, - 0x63, 0x73, 0x33, 0x2f, 0x69, 0x64, 0x65, 0x6e, 0x74, 0x69, 0x74, 0x79, 0x2f, 0x75, 0x73, 0x65, - 0x72, 0x2f, 0x76, 0x31, 0x62, 0x65, 0x74, 0x61, 0x31, 0x3b, 0x75, 0x73, 0x65, 0x72, 0x76, 0x31, - 0x62, 0x65, 0x74, 0x61, 0x31, 0xa2, 0x02, 0x03, 0x43, 0x49, 0x55, 0xaa, 0x02, 0x19, 0x43, 0x73, - 0x33, 0x2e, 0x49, 0x64, 0x65, 0x6e, 0x74, 0x69, 0x74, 0x79, 0x2e, 0x55, 0x73, 0x65, 0x72, 0x2e, - 0x56, 0x31, 0x62, 0x65, 0x74, 0x61, 0x31, 0xca, 0x02, 0x19, 0x43, 0x73, 0x33, 0x5c, 0x49, 0x64, - 0x65, 0x6e, 0x74, 0x69, 0x74, 0x79, 0x5c, 0x55, 0x73, 0x65, 0x72, 0x5c, 0x56, 0x31, 0x62, 0x65, - 0x74, 0x61, 0x31, 0xe2, 0x02, 0x25, 0x43, 0x73, 0x33, 0x5c, 0x49, 0x64, 0x65, 0x6e, 0x74, 0x69, - 0x74, 0x79, 0x5c, 0x55, 0x73, 0x65, 0x72, 0x5c, 0x56, 0x31, 0x62, 0x65, 0x74, 0x61, 0x31, 0x5c, - 0x47, 0x50, 0x42, 0x4d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0xea, 0x02, 0x1c, 0x43, 0x73, - 0x33, 0x3a, 0x3a, 0x49, 0x64, 0x65, 0x6e, 0x74, 0x69, 0x74, 0x79, 0x3a, 0x3a, 0x55, 0x73, 0x65, - 0x72, 0x3a, 0x3a, 0x56, 0x31, 0x62, 0x65, 0x74, 0x61, 0x31, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, - 0x6f, 0x33, + 0x62, 0x65, 0x72, 0x12, 0x3d, 0x0a, 0x06, 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x18, 0x0a, 0x20, + 0x01, 0x28, 0x0e, 0x32, 0x25, 0x2e, 0x63, 0x73, 0x33, 0x2e, 0x69, 0x64, 0x65, 0x6e, 0x74, 0x69, + 0x74, 0x79, 0x2e, 0x75, 0x73, 0x65, 0x72, 0x2e, 0x76, 0x31, 0x62, 0x65, 0x74, 0x61, 0x31, 0x2e, + 0x55, 0x73, 0x65, 0x72, 0x53, 0x74, 0x61, 0x74, 0x75, 0x73, 0x52, 0x06, 0x73, 0x74, 0x61, 0x74, + 0x75, 0x73, 0x2a, 0xe7, 0x01, 0x0a, 0x08, 0x55, 0x73, 0x65, 0x72, 0x54, 0x79, 0x70, 0x65, 0x12, + 0x15, 0x0a, 0x11, 0x55, 0x53, 0x45, 0x52, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x49, 0x4e, 0x56, + 0x41, 0x4c, 0x49, 0x44, 0x10, 0x00, 0x12, 0x15, 0x0a, 0x11, 0x55, 0x53, 0x45, 0x52, 0x5f, 0x54, + 0x59, 0x50, 0x45, 0x5f, 0x50, 0x52, 0x49, 0x4d, 0x41, 0x52, 0x59, 0x10, 0x01, 0x12, 0x17, 0x0a, + 0x13, 0x55, 0x53, 0x45, 0x52, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x53, 0x45, 0x43, 0x4f, 0x4e, + 0x44, 0x41, 0x52, 0x59, 0x10, 0x02, 0x12, 0x15, 0x0a, 0x11, 0x55, 0x53, 0x45, 0x52, 0x5f, 0x54, + 0x59, 0x50, 0x45, 0x5f, 0x53, 0x45, 0x52, 0x56, 0x49, 0x43, 0x45, 0x10, 0x03, 0x12, 0x19, 0x0a, + 0x15, 0x55, 0x53, 0x45, 0x52, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x41, 0x50, 0x50, 0x4c, 0x49, + 0x43, 0x41, 0x54, 0x49, 0x4f, 0x4e, 0x10, 0x04, 0x12, 0x13, 0x0a, 0x0f, 0x55, 0x53, 0x45, 0x52, + 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x47, 0x55, 0x45, 0x53, 0x54, 0x10, 0x05, 0x12, 0x17, 0x0a, + 0x13, 0x55, 0x53, 0x45, 0x52, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x46, 0x45, 0x44, 0x45, 0x52, + 0x41, 0x54, 0x45, 0x44, 0x10, 0x06, 0x12, 0x19, 0x0a, 0x15, 0x55, 0x53, 0x45, 0x52, 0x5f, 0x54, + 0x59, 0x50, 0x45, 0x5f, 0x4c, 0x49, 0x47, 0x48, 0x54, 0x57, 0x45, 0x49, 0x47, 0x48, 0x54, 0x10, + 0x07, 0x12, 0x19, 0x0a, 0x15, 0x55, 0x53, 0x45, 0x52, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x53, + 0x50, 0x41, 0x43, 0x45, 0x5f, 0x4f, 0x57, 0x4e, 0x45, 0x52, 0x10, 0x08, 0x2a, 0x57, 0x0a, 0x0a, + 0x55, 0x73, 0x65, 0x72, 0x53, 0x74, 0x61, 0x74, 0x75, 0x73, 0x12, 0x16, 0x0a, 0x12, 0x55, 0x53, + 0x45, 0x52, 0x5f, 0x53, 0x54, 0x41, 0x54, 0x55, 0x53, 0x5f, 0x41, 0x43, 0x54, 0x49, 0x56, 0x45, + 0x10, 0x00, 0x12, 0x18, 0x0a, 0x14, 0x55, 0x53, 0x45, 0x52, 0x5f, 0x53, 0x54, 0x41, 0x54, 0x55, + 0x53, 0x5f, 0x45, 0x58, 0x50, 0x49, 0x52, 0x49, 0x4e, 0x47, 0x10, 0x01, 0x12, 0x17, 0x0a, 0x13, + 0x55, 0x53, 0x45, 0x52, 0x5f, 0x53, 0x54, 0x41, 0x54, 0x55, 0x53, 0x5f, 0x42, 0x4c, 0x4f, 0x43, + 0x4b, 0x45, 0x44, 0x10, 0x02, 0x42, 0xfa, 0x01, 0x0a, 0x1d, 0x63, 0x6f, 0x6d, 0x2e, 0x63, 0x73, + 0x33, 0x2e, 0x69, 0x64, 0x65, 0x6e, 0x74, 0x69, 0x74, 0x79, 0x2e, 0x75, 0x73, 0x65, 0x72, 0x2e, + 0x76, 0x31, 0x62, 0x65, 0x74, 0x61, 0x31, 0x42, 0x0e, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, + 0x65, 0x73, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x42, 0x67, 0x69, 0x74, 0x68, 0x75, + 0x62, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x63, 0x73, 0x33, 0x6f, 0x72, 0x67, 0x2f, 0x67, 0x6f, 0x2d, + 0x63, 0x73, 0x33, 0x61, 0x70, 0x69, 0x73, 0x2f, 0x63, 0x73, 0x33, 0x2f, 0x69, 0x64, 0x65, 0x6e, + 0x74, 0x69, 0x74, 0x79, 0x2f, 0x75, 0x73, 0x65, 0x72, 0x2f, 0x76, 0x31, 0x62, 0x65, 0x74, 0x61, + 0x31, 0x3b, 0x75, 0x73, 0x65, 0x72, 0x76, 0x31, 0x62, 0x65, 0x74, 0x61, 0x31, 0xa2, 0x02, 0x03, + 0x43, 0x49, 0x55, 0xaa, 0x02, 0x19, 0x43, 0x73, 0x33, 0x2e, 0x49, 0x64, 0x65, 0x6e, 0x74, 0x69, + 0x74, 0x79, 0x2e, 0x55, 0x73, 0x65, 0x72, 0x2e, 0x56, 0x31, 0x62, 0x65, 0x74, 0x61, 0x31, 0xca, + 0x02, 0x19, 0x43, 0x73, 0x33, 0x5c, 0x49, 0x64, 0x65, 0x6e, 0x74, 0x69, 0x74, 0x79, 0x5c, 0x55, + 0x73, 0x65, 0x72, 0x5c, 0x56, 0x31, 0x62, 0x65, 0x74, 0x61, 0x31, 0xe2, 0x02, 0x25, 0x43, 0x73, + 0x33, 0x5c, 0x49, 0x64, 0x65, 0x6e, 0x74, 0x69, 0x74, 0x79, 0x5c, 0x55, 0x73, 0x65, 0x72, 0x5c, + 0x56, 0x31, 0x62, 0x65, 0x74, 0x61, 0x31, 0x5c, 0x47, 0x50, 0x42, 0x4d, 0x65, 0x74, 0x61, 0x64, + 0x61, 0x74, 0x61, 0xea, 0x02, 0x1c, 0x43, 0x73, 0x33, 0x3a, 0x3a, 0x49, 0x64, 0x65, 0x6e, 0x74, + 0x69, 0x74, 0x79, 0x3a, 0x3a, 0x55, 0x73, 0x65, 0x72, 0x3a, 0x3a, 0x56, 0x31, 0x62, 0x65, 0x74, + 0x61, 0x31, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, } var ( @@ -497,25 +572,27 @@ func file_cs3_identity_user_v1beta1_resources_proto_rawDescGZIP() []byte { return file_cs3_identity_user_v1beta1_resources_proto_rawDescData } -var file_cs3_identity_user_v1beta1_resources_proto_enumTypes = make([]protoimpl.EnumInfo, 1) +var file_cs3_identity_user_v1beta1_resources_proto_enumTypes = make([]protoimpl.EnumInfo, 2) var file_cs3_identity_user_v1beta1_resources_proto_msgTypes = make([]protoimpl.MessageInfo, 3) var file_cs3_identity_user_v1beta1_resources_proto_goTypes = []interface{}{ (UserType)(0), // 0: cs3.identity.user.v1beta1.UserType - (*ExternalIdentity)(nil), // 1: cs3.identity.user.v1beta1.ExternalIdentity - (*UserId)(nil), // 2: cs3.identity.user.v1beta1.UserId - (*User)(nil), // 3: cs3.identity.user.v1beta1.User - (*v1beta1.Opaque)(nil), // 4: cs3.types.v1beta1.Opaque + (UserStatus)(0), // 1: cs3.identity.user.v1beta1.UserStatus + (*ExternalIdentity)(nil), // 2: cs3.identity.user.v1beta1.ExternalIdentity + (*UserId)(nil), // 3: cs3.identity.user.v1beta1.UserId + (*User)(nil), // 4: cs3.identity.user.v1beta1.User + (*v1beta1.Opaque)(nil), // 5: cs3.types.v1beta1.Opaque } var file_cs3_identity_user_v1beta1_resources_proto_depIdxs = []int32{ 0, // 0: cs3.identity.user.v1beta1.UserId.type:type_name -> cs3.identity.user.v1beta1.UserType - 1, // 1: cs3.identity.user.v1beta1.UserId.external_identities:type_name -> cs3.identity.user.v1beta1.ExternalIdentity - 2, // 2: cs3.identity.user.v1beta1.User.id:type_name -> cs3.identity.user.v1beta1.UserId - 4, // 3: cs3.identity.user.v1beta1.User.opaque:type_name -> cs3.types.v1beta1.Opaque - 4, // [4:4] is the sub-list for method output_type - 4, // [4:4] is the sub-list for method input_type - 4, // [4:4] is the sub-list for extension type_name - 4, // [4:4] is the sub-list for extension extendee - 0, // [0:4] is the sub-list for field type_name + 2, // 1: cs3.identity.user.v1beta1.UserId.external_identities:type_name -> cs3.identity.user.v1beta1.ExternalIdentity + 3, // 2: cs3.identity.user.v1beta1.User.id:type_name -> cs3.identity.user.v1beta1.UserId + 5, // 3: cs3.identity.user.v1beta1.User.opaque:type_name -> cs3.types.v1beta1.Opaque + 1, // 4: cs3.identity.user.v1beta1.User.status:type_name -> cs3.identity.user.v1beta1.UserStatus + 5, // [5:5] is the sub-list for method output_type + 5, // [5:5] is the sub-list for method input_type + 5, // [5:5] is the sub-list for extension type_name + 5, // [5:5] is the sub-list for extension extendee + 0, // [0:5] is the sub-list for field type_name } func init() { file_cs3_identity_user_v1beta1_resources_proto_init() } @@ -566,7 +643,7 @@ func file_cs3_identity_user_v1beta1_resources_proto_init() { File: protoimpl.DescBuilder{ GoPackagePath: reflect.TypeOf(x{}).PkgPath(), RawDescriptor: file_cs3_identity_user_v1beta1_resources_proto_rawDesc, - NumEnums: 1, + NumEnums: 2, NumMessages: 3, NumExtensions: 0, NumServices: 0, diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/identity/user/v1beta1/user_api.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/identity/user/v1beta1/user_api.pb.go index 12cec1a84..da7a2ab53 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/identity/user/v1beta1/user_api.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/identity/user/v1beta1/user_api.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/identity/user/v1beta1/user_api_grpc.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/identity/user/v1beta1/user_api_grpc.pb.go index 904366eca..5e4083808 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/identity/user/v1beta1/user_api_grpc.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/identity/user/v1beta1/user_api_grpc.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/ocm/core/v1beta1/ocm_core_api.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/ocm/core/v1beta1/ocm_core_api.pb.go index 18258e14a..d531871f5 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/ocm/core/v1beta1/ocm_core_api.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/ocm/core/v1beta1/ocm_core_api.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/ocm/core/v1beta1/ocm_core_api_grpc.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/ocm/core/v1beta1/ocm_core_api_grpc.pb.go index b4c1319c3..df7acebfc 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/ocm/core/v1beta1/ocm_core_api_grpc.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/ocm/core/v1beta1/ocm_core_api_grpc.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/ocm/incoming/v1beta1/ocm_incoming_api.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/ocm/incoming/v1beta1/ocm_incoming_api.pb.go index 861d4c44c..bd5a807cd 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/ocm/incoming/v1beta1/ocm_incoming_api.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/ocm/incoming/v1beta1/ocm_incoming_api.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/ocm/incoming/v1beta1/ocm_incoming_api_grpc.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/ocm/incoming/v1beta1/ocm_incoming_api_grpc.pb.go index 1597d43cb..bd2f76ac1 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/ocm/incoming/v1beta1/ocm_incoming_api_grpc.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/ocm/incoming/v1beta1/ocm_incoming_api_grpc.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/ocm/invite/v1beta1/invite_api.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/ocm/invite/v1beta1/invite_api.pb.go index a25503012..0213496b4 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/ocm/invite/v1beta1/invite_api.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/ocm/invite/v1beta1/invite_api.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/ocm/invite/v1beta1/invite_api_grpc.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/ocm/invite/v1beta1/invite_api_grpc.pb.go index fd2133184..05753d3cc 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/ocm/invite/v1beta1/invite_api_grpc.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/ocm/invite/v1beta1/invite_api_grpc.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/ocm/invite/v1beta1/resources.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/ocm/invite/v1beta1/resources.pb.go index c34e40bb5..e46012f86 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/ocm/invite/v1beta1/resources.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/ocm/invite/v1beta1/resources.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/ocm/provider/v1beta1/provider_api.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/ocm/provider/v1beta1/provider_api.pb.go index 65f6ba3d5..50817cffa 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/ocm/provider/v1beta1/provider_api.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/ocm/provider/v1beta1/provider_api.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/ocm/provider/v1beta1/provider_api_grpc.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/ocm/provider/v1beta1/provider_api_grpc.pb.go index 7e272c77a..ee1a9cd57 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/ocm/provider/v1beta1/provider_api_grpc.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/ocm/provider/v1beta1/provider_api_grpc.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/ocm/provider/v1beta1/resources.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/ocm/provider/v1beta1/resources.pb.go index 9d9ea25b2..265f64ab2 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/ocm/provider/v1beta1/resources.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/ocm/provider/v1beta1/resources.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/permissions/v1beta1/permissions_api.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/permissions/v1beta1/permissions_api.pb.go index 5200029f6..b963ceb13 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/permissions/v1beta1/permissions_api.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/permissions/v1beta1/permissions_api.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/permissions/v1beta1/permissions_api_grpc.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/permissions/v1beta1/permissions_api_grpc.pb.go index c871cd185..a89f5c993 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/permissions/v1beta1/permissions_api_grpc.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/permissions/v1beta1/permissions_api_grpc.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/permissions/v1beta1/resources.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/permissions/v1beta1/resources.pb.go index 81e05be1e..3246eb4b2 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/permissions/v1beta1/resources.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/permissions/v1beta1/resources.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/preferences/v1beta1/preferences_api.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/preferences/v1beta1/preferences_api.pb.go index 8a5c85460..3079ab476 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/preferences/v1beta1/preferences_api.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/preferences/v1beta1/preferences_api.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/preferences/v1beta1/preferences_api_grpc.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/preferences/v1beta1/preferences_api_grpc.pb.go index 9037547f2..a832bb1a7 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/preferences/v1beta1/preferences_api_grpc.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/preferences/v1beta1/preferences_api_grpc.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/preferences/v1beta1/resources.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/preferences/v1beta1/resources.pb.go index 35f9df7d9..484eae763 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/preferences/v1beta1/resources.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/preferences/v1beta1/resources.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/rpc/v1beta1/code.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/rpc/v1beta1/code.pb.go index 7cbd5c728..f6daf8d32 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/rpc/v1beta1/code.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/rpc/v1beta1/code.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/rpc/v1beta1/status.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/rpc/v1beta1/status.pb.go index 717be17b9..32b191551 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/rpc/v1beta1/status.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/rpc/v1beta1/status.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/sharing/collaboration/v1beta1/collaboration_api.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/sharing/collaboration/v1beta1/collaboration_api.pb.go index 61eb23ae1..af54f1b04 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/sharing/collaboration/v1beta1/collaboration_api.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/sharing/collaboration/v1beta1/collaboration_api.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/sharing/collaboration/v1beta1/collaboration_api_grpc.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/sharing/collaboration/v1beta1/collaboration_api_grpc.pb.go index f081c3aab..d49e5d462 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/sharing/collaboration/v1beta1/collaboration_api_grpc.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/sharing/collaboration/v1beta1/collaboration_api_grpc.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/sharing/collaboration/v1beta1/resources.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/sharing/collaboration/v1beta1/resources.pb.go index a9aadfa71..778c4613d 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/sharing/collaboration/v1beta1/resources.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/sharing/collaboration/v1beta1/resources.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. @@ -116,21 +116,26 @@ const ( Filter_TYPE_SPACE_ID Filter_Type = 7 Filter_TYPE_STATE Filter_Type = 8 Filter_TYPE_GRANTEE Filter_Type = 9 + // Filter shares by whether the shared resource is a space root. + // When the term `space_root` is true, only shares on space roots are returned. + // When false, shares on space roots are excluded. + Filter_TYPE_SPACE_ROOT Filter_Type = 10 ) // Enum value maps for Filter_Type. var ( Filter_Type_name = map[int32]string{ - 0: "TYPE_INVALID", - 1: "TYPE_NO", - 2: "TYPE_RESOURCE_ID", - 3: "TYPE_OWNER", - 4: "TYPE_CREATOR", - 5: "TYPE_GRANTEE_TYPE", - 6: "TYPE_EXCLUDE_DENIALS", - 7: "TYPE_SPACE_ID", - 8: "TYPE_STATE", - 9: "TYPE_GRANTEE", + 0: "TYPE_INVALID", + 1: "TYPE_NO", + 2: "TYPE_RESOURCE_ID", + 3: "TYPE_OWNER", + 4: "TYPE_CREATOR", + 5: "TYPE_GRANTEE_TYPE", + 6: "TYPE_EXCLUDE_DENIALS", + 7: "TYPE_SPACE_ID", + 8: "TYPE_STATE", + 9: "TYPE_GRANTEE", + 10: "TYPE_SPACE_ROOT", } Filter_Type_value = map[string]int32{ "TYPE_INVALID": 0, @@ -143,6 +148,7 @@ var ( "TYPE_SPACE_ID": 7, "TYPE_STATE": 8, "TYPE_GRANTEE": 9, + "TYPE_SPACE_ROOT": 10, } ) @@ -773,6 +779,7 @@ type Filter struct { // *Filter_SpaceId // *Filter_State // *Filter_Grantee + // *Filter_SpaceRoot Term isFilter_Term `protobuf_oneof:"term"` } @@ -871,6 +878,13 @@ func (x *Filter) GetGrantee() *v1beta1.Grantee { return nil } +func (x *Filter) GetSpaceRoot() bool { + if x, ok := x.GetTerm().(*Filter_SpaceRoot); ok { + return x.SpaceRoot + } + return false +} + type isFilter_Term interface { isFilter_Term() } @@ -903,6 +917,11 @@ type Filter_Grantee struct { Grantee *v1beta1.Grantee `protobuf:"bytes,9,opt,name=grantee,proto3,oneof"` } +type Filter_SpaceRoot struct { + // Used with TYPE_SPACE_ROOT. + SpaceRoot bool `protobuf:"varint,10,opt,name=space_root,json=spaceRoot,proto3,oneof"` +} + func (*Filter_ResourceId) isFilter_Term() {} func (*Filter_Owner) isFilter_Term() {} @@ -917,6 +936,8 @@ func (*Filter_State) isFilter_Term() {} func (*Filter_Grantee) isFilter_Term() {} +func (*Filter_SpaceRoot) isFilter_Term() {} + var File_cs3_sharing_collaboration_v1beta1_resources_proto protoreflect.FileDescriptor var file_cs3_sharing_collaboration_v1beta1_resources_proto_rawDesc = []byte{ @@ -1034,7 +1055,7 @@ var file_cs3_sharing_collaboration_v1beta1_resources_proto_rawDesc = []byte{ 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x63, 0x73, 0x33, 0x2e, 0x74, 0x79, 0x70, 0x65, 0x73, 0x2e, 0x76, 0x31, 0x62, 0x65, 0x74, 0x61, 0x31, 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x73, 0x74, 0x61, 0x6d, 0x70, 0x52, 0x0a, 0x65, 0x78, 0x70, 0x69, - 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x22, 0xd8, 0x05, 0x0a, 0x06, 0x46, 0x69, 0x6c, 0x74, 0x65, + 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x22, 0x8e, 0x06, 0x0a, 0x06, 0x46, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x12, 0x42, 0x0a, 0x04, 0x74, 0x79, 0x70, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x2e, 0x2e, 0x63, 0x73, 0x33, 0x2e, 0x73, 0x68, 0x61, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x63, 0x6f, 0x6c, 0x6c, 0x61, 0x62, 0x6f, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x76, 0x31, 0x62, 0x65, @@ -1067,47 +1088,50 @@ var file_cs3_sharing_collaboration_v1beta1_resources_proto_rawDesc = []byte{ 0x0b, 0x32, 0x25, 0x2e, 0x63, 0x73, 0x33, 0x2e, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x76, 0x69, 0x64, 0x65, 0x72, 0x2e, 0x76, 0x31, 0x62, 0x65, 0x74, 0x61, 0x31, 0x2e, 0x47, 0x72, 0x61, 0x6e, 0x74, 0x65, 0x65, 0x48, 0x00, 0x52, 0x07, 0x67, 0x72, 0x61, 0x6e, - 0x74, 0x65, 0x65, 0x22, 0xc3, 0x01, 0x0a, 0x04, 0x54, 0x79, 0x70, 0x65, 0x12, 0x10, 0x0a, 0x0c, - 0x54, 0x59, 0x50, 0x45, 0x5f, 0x49, 0x4e, 0x56, 0x41, 0x4c, 0x49, 0x44, 0x10, 0x00, 0x12, 0x0b, - 0x0a, 0x07, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x4e, 0x4f, 0x10, 0x01, 0x12, 0x14, 0x0a, 0x10, 0x54, - 0x59, 0x50, 0x45, 0x5f, 0x52, 0x45, 0x53, 0x4f, 0x55, 0x52, 0x43, 0x45, 0x5f, 0x49, 0x44, 0x10, - 0x02, 0x12, 0x0e, 0x0a, 0x0a, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x4f, 0x57, 0x4e, 0x45, 0x52, 0x10, - 0x03, 0x12, 0x10, 0x0a, 0x0c, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x43, 0x52, 0x45, 0x41, 0x54, 0x4f, - 0x52, 0x10, 0x04, 0x12, 0x15, 0x0a, 0x11, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x47, 0x52, 0x41, 0x4e, - 0x54, 0x45, 0x45, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x10, 0x05, 0x12, 0x18, 0x0a, 0x14, 0x54, 0x59, - 0x50, 0x45, 0x5f, 0x45, 0x58, 0x43, 0x4c, 0x55, 0x44, 0x45, 0x5f, 0x44, 0x45, 0x4e, 0x49, 0x41, - 0x4c, 0x53, 0x10, 0x06, 0x12, 0x11, 0x0a, 0x0d, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x53, 0x50, 0x41, - 0x43, 0x45, 0x5f, 0x49, 0x44, 0x10, 0x07, 0x12, 0x0e, 0x0a, 0x0a, 0x54, 0x59, 0x50, 0x45, 0x5f, - 0x53, 0x54, 0x41, 0x54, 0x45, 0x10, 0x08, 0x12, 0x10, 0x0a, 0x0c, 0x54, 0x59, 0x50, 0x45, 0x5f, - 0x47, 0x52, 0x41, 0x4e, 0x54, 0x45, 0x45, 0x10, 0x09, 0x42, 0x06, 0x0a, 0x04, 0x74, 0x65, 0x72, - 0x6d, 0x2a, 0x72, 0x0a, 0x0a, 0x53, 0x68, 0x61, 0x72, 0x65, 0x53, 0x74, 0x61, 0x74, 0x65, 0x12, - 0x17, 0x0a, 0x13, 0x53, 0x48, 0x41, 0x52, 0x45, 0x5f, 0x53, 0x54, 0x41, 0x54, 0x45, 0x5f, 0x49, - 0x4e, 0x56, 0x41, 0x4c, 0x49, 0x44, 0x10, 0x00, 0x12, 0x17, 0x0a, 0x13, 0x53, 0x48, 0x41, 0x52, - 0x45, 0x5f, 0x53, 0x54, 0x41, 0x54, 0x45, 0x5f, 0x50, 0x45, 0x4e, 0x44, 0x49, 0x4e, 0x47, 0x10, - 0x01, 0x12, 0x18, 0x0a, 0x14, 0x53, 0x48, 0x41, 0x52, 0x45, 0x5f, 0x53, 0x54, 0x41, 0x54, 0x45, - 0x5f, 0x41, 0x43, 0x43, 0x45, 0x50, 0x54, 0x45, 0x44, 0x10, 0x02, 0x12, 0x18, 0x0a, 0x14, 0x53, - 0x48, 0x41, 0x52, 0x45, 0x5f, 0x53, 0x54, 0x41, 0x54, 0x45, 0x5f, 0x52, 0x45, 0x4a, 0x45, 0x43, - 0x54, 0x45, 0x44, 0x10, 0x03, 0x42, 0xb3, 0x02, 0x0a, 0x25, 0x63, 0x6f, 0x6d, 0x2e, 0x63, 0x73, - 0x33, 0x2e, 0x73, 0x68, 0x61, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x63, 0x6f, 0x6c, 0x6c, 0x61, 0x62, - 0x6f, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x76, 0x31, 0x62, 0x65, 0x74, 0x61, 0x31, 0x42, - 0x0e, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x73, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, - 0x01, 0x5a, 0x53, 0x67, 0x69, 0x74, 0x68, 0x75, 0x62, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x63, 0x73, - 0x33, 0x6f, 0x72, 0x67, 0x2f, 0x67, 0x6f, 0x2d, 0x63, 0x73, 0x33, 0x61, 0x70, 0x69, 0x73, 0x2f, - 0x63, 0x73, 0x33, 0x2f, 0x73, 0x68, 0x61, 0x72, 0x69, 0x6e, 0x67, 0x2f, 0x63, 0x6f, 0x6c, 0x6c, - 0x61, 0x62, 0x6f, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x2f, 0x76, 0x31, 0x62, 0x65, 0x74, 0x61, - 0x31, 0x3b, 0x63, 0x6f, 0x6c, 0x6c, 0x61, 0x62, 0x6f, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x76, - 0x31, 0x62, 0x65, 0x74, 0x61, 0x31, 0xa2, 0x02, 0x03, 0x43, 0x53, 0x43, 0xaa, 0x02, 0x21, 0x43, - 0x73, 0x33, 0x2e, 0x53, 0x68, 0x61, 0x72, 0x69, 0x6e, 0x67, 0x2e, 0x43, 0x6f, 0x6c, 0x6c, 0x61, - 0x62, 0x6f, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x56, 0x31, 0x62, 0x65, 0x74, 0x61, 0x31, - 0xca, 0x02, 0x21, 0x43, 0x73, 0x33, 0x5c, 0x53, 0x68, 0x61, 0x72, 0x69, 0x6e, 0x67, 0x5c, 0x43, - 0x6f, 0x6c, 0x6c, 0x61, 0x62, 0x6f, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5c, 0x56, 0x31, 0x62, - 0x65, 0x74, 0x61, 0x31, 0xe2, 0x02, 0x2d, 0x43, 0x73, 0x33, 0x5c, 0x53, 0x68, 0x61, 0x72, 0x69, - 0x6e, 0x67, 0x5c, 0x43, 0x6f, 0x6c, 0x6c, 0x61, 0x62, 0x6f, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, - 0x5c, 0x56, 0x31, 0x62, 0x65, 0x74, 0x61, 0x31, 0x5c, 0x47, 0x50, 0x42, 0x4d, 0x65, 0x74, 0x61, - 0x64, 0x61, 0x74, 0x61, 0xea, 0x02, 0x24, 0x43, 0x73, 0x33, 0x3a, 0x3a, 0x53, 0x68, 0x61, 0x72, - 0x69, 0x6e, 0x67, 0x3a, 0x3a, 0x43, 0x6f, 0x6c, 0x6c, 0x61, 0x62, 0x6f, 0x72, 0x61, 0x74, 0x69, - 0x6f, 0x6e, 0x3a, 0x3a, 0x56, 0x31, 0x62, 0x65, 0x74, 0x61, 0x31, 0x62, 0x06, 0x70, 0x72, 0x6f, - 0x74, 0x6f, 0x33, + 0x74, 0x65, 0x65, 0x12, 0x1f, 0x0a, 0x0a, 0x73, 0x70, 0x61, 0x63, 0x65, 0x5f, 0x72, 0x6f, 0x6f, + 0x74, 0x18, 0x0a, 0x20, 0x01, 0x28, 0x08, 0x48, 0x00, 0x52, 0x09, 0x73, 0x70, 0x61, 0x63, 0x65, + 0x52, 0x6f, 0x6f, 0x74, 0x22, 0xd8, 0x01, 0x0a, 0x04, 0x54, 0x79, 0x70, 0x65, 0x12, 0x10, 0x0a, + 0x0c, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x49, 0x4e, 0x56, 0x41, 0x4c, 0x49, 0x44, 0x10, 0x00, 0x12, + 0x0b, 0x0a, 0x07, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x4e, 0x4f, 0x10, 0x01, 0x12, 0x14, 0x0a, 0x10, + 0x54, 0x59, 0x50, 0x45, 0x5f, 0x52, 0x45, 0x53, 0x4f, 0x55, 0x52, 0x43, 0x45, 0x5f, 0x49, 0x44, + 0x10, 0x02, 0x12, 0x0e, 0x0a, 0x0a, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x4f, 0x57, 0x4e, 0x45, 0x52, + 0x10, 0x03, 0x12, 0x10, 0x0a, 0x0c, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x43, 0x52, 0x45, 0x41, 0x54, + 0x4f, 0x52, 0x10, 0x04, 0x12, 0x15, 0x0a, 0x11, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x47, 0x52, 0x41, + 0x4e, 0x54, 0x45, 0x45, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x10, 0x05, 0x12, 0x18, 0x0a, 0x14, 0x54, + 0x59, 0x50, 0x45, 0x5f, 0x45, 0x58, 0x43, 0x4c, 0x55, 0x44, 0x45, 0x5f, 0x44, 0x45, 0x4e, 0x49, + 0x41, 0x4c, 0x53, 0x10, 0x06, 0x12, 0x11, 0x0a, 0x0d, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x53, 0x50, + 0x41, 0x43, 0x45, 0x5f, 0x49, 0x44, 0x10, 0x07, 0x12, 0x0e, 0x0a, 0x0a, 0x54, 0x59, 0x50, 0x45, + 0x5f, 0x53, 0x54, 0x41, 0x54, 0x45, 0x10, 0x08, 0x12, 0x10, 0x0a, 0x0c, 0x54, 0x59, 0x50, 0x45, + 0x5f, 0x47, 0x52, 0x41, 0x4e, 0x54, 0x45, 0x45, 0x10, 0x09, 0x12, 0x13, 0x0a, 0x0f, 0x54, 0x59, + 0x50, 0x45, 0x5f, 0x53, 0x50, 0x41, 0x43, 0x45, 0x5f, 0x52, 0x4f, 0x4f, 0x54, 0x10, 0x0a, 0x42, + 0x06, 0x0a, 0x04, 0x74, 0x65, 0x72, 0x6d, 0x2a, 0x72, 0x0a, 0x0a, 0x53, 0x68, 0x61, 0x72, 0x65, + 0x53, 0x74, 0x61, 0x74, 0x65, 0x12, 0x17, 0x0a, 0x13, 0x53, 0x48, 0x41, 0x52, 0x45, 0x5f, 0x53, + 0x54, 0x41, 0x54, 0x45, 0x5f, 0x49, 0x4e, 0x56, 0x41, 0x4c, 0x49, 0x44, 0x10, 0x00, 0x12, 0x17, + 0x0a, 0x13, 0x53, 0x48, 0x41, 0x52, 0x45, 0x5f, 0x53, 0x54, 0x41, 0x54, 0x45, 0x5f, 0x50, 0x45, + 0x4e, 0x44, 0x49, 0x4e, 0x47, 0x10, 0x01, 0x12, 0x18, 0x0a, 0x14, 0x53, 0x48, 0x41, 0x52, 0x45, + 0x5f, 0x53, 0x54, 0x41, 0x54, 0x45, 0x5f, 0x41, 0x43, 0x43, 0x45, 0x50, 0x54, 0x45, 0x44, 0x10, + 0x02, 0x12, 0x18, 0x0a, 0x14, 0x53, 0x48, 0x41, 0x52, 0x45, 0x5f, 0x53, 0x54, 0x41, 0x54, 0x45, + 0x5f, 0x52, 0x45, 0x4a, 0x45, 0x43, 0x54, 0x45, 0x44, 0x10, 0x03, 0x42, 0xb3, 0x02, 0x0a, 0x25, + 0x63, 0x6f, 0x6d, 0x2e, 0x63, 0x73, 0x33, 0x2e, 0x73, 0x68, 0x61, 0x72, 0x69, 0x6e, 0x67, 0x2e, + 0x63, 0x6f, 0x6c, 0x6c, 0x61, 0x62, 0x6f, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x76, 0x31, + 0x62, 0x65, 0x74, 0x61, 0x31, 0x42, 0x0e, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x73, + 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x53, 0x67, 0x69, 0x74, 0x68, 0x75, 0x62, 0x2e, + 0x63, 0x6f, 0x6d, 0x2f, 0x63, 0x73, 0x33, 0x6f, 0x72, 0x67, 0x2f, 0x67, 0x6f, 0x2d, 0x63, 0x73, + 0x33, 0x61, 0x70, 0x69, 0x73, 0x2f, 0x63, 0x73, 0x33, 0x2f, 0x73, 0x68, 0x61, 0x72, 0x69, 0x6e, + 0x67, 0x2f, 0x63, 0x6f, 0x6c, 0x6c, 0x61, 0x62, 0x6f, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x2f, + 0x76, 0x31, 0x62, 0x65, 0x74, 0x61, 0x31, 0x3b, 0x63, 0x6f, 0x6c, 0x6c, 0x61, 0x62, 0x6f, 0x72, + 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x76, 0x31, 0x62, 0x65, 0x74, 0x61, 0x31, 0xa2, 0x02, 0x03, 0x43, + 0x53, 0x43, 0xaa, 0x02, 0x21, 0x43, 0x73, 0x33, 0x2e, 0x53, 0x68, 0x61, 0x72, 0x69, 0x6e, 0x67, + 0x2e, 0x43, 0x6f, 0x6c, 0x6c, 0x61, 0x62, 0x6f, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x56, + 0x31, 0x62, 0x65, 0x74, 0x61, 0x31, 0xca, 0x02, 0x21, 0x43, 0x73, 0x33, 0x5c, 0x53, 0x68, 0x61, + 0x72, 0x69, 0x6e, 0x67, 0x5c, 0x43, 0x6f, 0x6c, 0x6c, 0x61, 0x62, 0x6f, 0x72, 0x61, 0x74, 0x69, + 0x6f, 0x6e, 0x5c, 0x56, 0x31, 0x62, 0x65, 0x74, 0x61, 0x31, 0xe2, 0x02, 0x2d, 0x43, 0x73, 0x33, + 0x5c, 0x53, 0x68, 0x61, 0x72, 0x69, 0x6e, 0x67, 0x5c, 0x43, 0x6f, 0x6c, 0x6c, 0x61, 0x62, 0x6f, + 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5c, 0x56, 0x31, 0x62, 0x65, 0x74, 0x61, 0x31, 0x5c, 0x47, + 0x50, 0x42, 0x4d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0xea, 0x02, 0x24, 0x43, 0x73, 0x33, + 0x3a, 0x3a, 0x53, 0x68, 0x61, 0x72, 0x69, 0x6e, 0x67, 0x3a, 0x3a, 0x43, 0x6f, 0x6c, 0x6c, 0x61, + 0x62, 0x6f, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x3a, 0x3a, 0x56, 0x31, 0x62, 0x65, 0x74, 0x61, + 0x31, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, } var ( @@ -1294,6 +1318,7 @@ func file_cs3_sharing_collaboration_v1beta1_resources_proto_init() { (*Filter_SpaceId)(nil), (*Filter_State)(nil), (*Filter_Grantee)(nil), + (*Filter_SpaceRoot)(nil), } type x struct{} out := protoimpl.TypeBuilder{ diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/sharing/link/v1beta1/link_api.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/sharing/link/v1beta1/link_api.pb.go index b4ec9fc3e..a8441b31d 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/sharing/link/v1beta1/link_api.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/sharing/link/v1beta1/link_api.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/sharing/link/v1beta1/link_api_grpc.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/sharing/link/v1beta1/link_api_grpc.pb.go index 3d136ea18..2c1a470ae 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/sharing/link/v1beta1/link_api_grpc.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/sharing/link/v1beta1/link_api_grpc.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/sharing/link/v1beta1/resources.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/sharing/link/v1beta1/resources.pb.go index fe7079d1e..0d6141df2 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/sharing/link/v1beta1/resources.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/sharing/link/v1beta1/resources.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/sharing/ocm/v1beta1/ocm_api.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/sharing/ocm/v1beta1/ocm_api.pb.go index c19d9721c..dc0d969b3 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/sharing/ocm/v1beta1/ocm_api.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/sharing/ocm/v1beta1/ocm_api.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/sharing/ocm/v1beta1/ocm_api_grpc.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/sharing/ocm/v1beta1/ocm_api_grpc.pb.go index 7ea27d200..9fd85f384 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/sharing/ocm/v1beta1/ocm_api_grpc.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/sharing/ocm/v1beta1/ocm_api_grpc.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/sharing/ocm/v1beta1/resources.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/sharing/ocm/v1beta1/resources.pb.go index 58353fa12..78f9b71ca 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/sharing/ocm/v1beta1/resources.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/sharing/ocm/v1beta1/resources.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/storage/provider/v1beta1/provider_api.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/storage/provider/v1beta1/provider_api.pb.go index b25fb74ed..8e5dab76f 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/storage/provider/v1beta1/provider_api.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/storage/provider/v1beta1/provider_api.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/storage/provider/v1beta1/provider_api_grpc.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/storage/provider/v1beta1/provider_api_grpc.pb.go index 1df73c58d..ee4573872 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/storage/provider/v1beta1/provider_api_grpc.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/storage/provider/v1beta1/provider_api_grpc.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/storage/provider/v1beta1/resources.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/storage/provider/v1beta1/resources.pb.go index ce4130428..b6c2c0290 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/storage/provider/v1beta1/resources.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/storage/provider/v1beta1/resources.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/storage/provider/v1beta1/spaces_api.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/storage/provider/v1beta1/spaces_api.pb.go index 7693f8d15..9de72ff36 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/storage/provider/v1beta1/spaces_api.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/storage/provider/v1beta1/spaces_api.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/storage/provider/v1beta1/spaces_api_grpc.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/storage/provider/v1beta1/spaces_api_grpc.pb.go index 2c7fda31c..9e7a131bc 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/storage/provider/v1beta1/spaces_api_grpc.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/storage/provider/v1beta1/spaces_api_grpc.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/storage/registry/v1beta1/registry_api.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/storage/registry/v1beta1/registry_api.pb.go index b955c5061..f37be5f6d 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/storage/registry/v1beta1/registry_api.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/storage/registry/v1beta1/registry_api.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/storage/registry/v1beta1/registry_api_grpc.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/storage/registry/v1beta1/registry_api_grpc.pb.go index b279d2609..b6f4303a9 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/storage/registry/v1beta1/registry_api_grpc.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/storage/registry/v1beta1/registry_api_grpc.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/storage/registry/v1beta1/resources.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/storage/registry/v1beta1/resources.pb.go index 9051ee305..b46672b4c 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/storage/registry/v1beta1/resources.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/storage/registry/v1beta1/resources.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/tx/v1beta1/resources.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/tx/v1beta1/resources.pb.go index 50606a55c..7bf93a81d 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/tx/v1beta1/resources.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/tx/v1beta1/resources.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/tx/v1beta1/tx_api.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/tx/v1beta1/tx_api.pb.go index 1843928cd..caec4f4f4 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/tx/v1beta1/tx_api.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/tx/v1beta1/tx_api.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/tx/v1beta1/tx_api_grpc.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/tx/v1beta1/tx_api_grpc.pb.go index 65297763b..4963f5c6d 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/tx/v1beta1/tx_api_grpc.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/tx/v1beta1/tx_api_grpc.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/cs3org/go-cs3apis/cs3/types/v1beta1/types.pb.go b/vendor/github.com/cs3org/go-cs3apis/cs3/types/v1beta1/types.pb.go index 931798e06..a46174eac 100644 --- a/vendor/github.com/cs3org/go-cs3apis/cs3/types/v1beta1/types.pb.go +++ b/vendor/github.com/cs3org/go-cs3apis/cs3/types/v1beta1/types.pb.go @@ -1,4 +1,4 @@ -// Copyright 2018-2025 CERN +// Copyright 2018-2026 CERN // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/interceptors/eventsmiddleware/conversion.go b/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/interceptors/eventsmiddleware/conversion.go index 6f7df8ca2..d0fd30d92 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/interceptors/eventsmiddleware/conversion.go +++ b/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/interceptors/eventsmiddleware/conversion.go @@ -414,38 +414,45 @@ func SpaceEnabled(r *provider.UpdateStorageSpaceResponse, req *provider.UpdateSt } // SpaceShared converts the response to an event -// func SpaceShared(req *provider.AddGrantRequest, executant, sharer *user.UserId, grantee *provider.Grantee) events.SpaceShared { -func SpaceShared(r *provider.AddGrantResponse, req *provider.AddGrantRequest, executant *user.User) events.SpaceShared { - id := storagespace.FormatStorageID(req.Ref.ResourceId.StorageId, req.Ref.ResourceId.SpaceId) +func SpaceShared(r *collaboration.CreateShareResponse, executant *user.User) events.SpaceShared { + id := storagespace.FormatStorageID(r.GetShare().GetResourceId().GetStorageId(), r.GetShare().GetResourceId().GetSpaceId()) return events.SpaceShared{ Executant: executant.GetId(), - Creator: req.Grant.Creator, - GranteeUserID: req.Grant.GetGrantee().GetUserId(), - GranteeGroupID: req.Grant.GetGrantee().GetGroupId(), + Creator: r.Share.GetCreator(), + GranteeUserID: r.Share.GetGrantee().GetUserId(), + GranteeGroupID: r.Share.GetGrantee().GetGroupId(), ID: &provider.StorageSpaceId{OpaqueId: id}, Timestamp: time.Now(), } } // SpaceShareUpdated converts the response to an events -func SpaceShareUpdated(r *provider.UpdateGrantResponse, req *provider.UpdateGrantRequest, executant *user.User) events.SpaceShareUpdated { - id := storagespace.FormatStorageID(req.Ref.ResourceId.StorageId, req.Ref.ResourceId.SpaceId) +func SpaceShareUpdated(r *collaboration.UpdateShareResponse, executant *user.User) events.SpaceShareUpdated { + id := storagespace.FormatStorageID(r.GetShare().GetResourceId().GetStorageId(), r.GetShare().GetResourceId().GetSpaceId()) return events.SpaceShareUpdated{ Executant: executant.GetId(), - GranteeUserID: req.Grant.GetGrantee().GetUserId(), - GranteeGroupID: req.Grant.GetGrantee().GetGroupId(), + GranteeUserID: r.GetShare().GetGrantee().GetUserId(), + GranteeGroupID: r.GetShare().GetGrantee().GetGroupId(), ID: &provider.StorageSpaceId{OpaqueId: id}, Timestamp: time.Now(), } } // SpaceUnshared converts the response to an event -func SpaceUnshared(r *provider.RemoveGrantResponse, req *provider.RemoveGrantRequest, executant *user.User) events.SpaceUnshared { - id := storagespace.FormatStorageID(req.Ref.ResourceId.StorageId, req.Ref.ResourceId.SpaceId) +func SpaceUnshared(r *collaboration.RemoveShareResponse, req *collaboration.RemoveShareRequest, executant *user.User) events.SpaceUnshared { + var ( + userid *user.UserId + groupid *group.GroupId + rid *provider.ResourceId + ) + _ = utils.ReadJSONFromOpaque(r.Opaque, "granteeuserid", &userid) + _ = utils.ReadJSONFromOpaque(r.Opaque, "granteegroupid", &groupid) + _ = utils.ReadJSONFromOpaque(r.Opaque, "resourceid", &rid) + id := storagespace.FormatStorageID(rid.StorageId, rid.SpaceId) return events.SpaceUnshared{ Executant: executant.GetId(), - GranteeUserID: req.Grant.GetGrantee().GetUserId(), - GranteeGroupID: req.Grant.GetGrantee().GetGroupId(), + GranteeUserID: userid, + GranteeGroupID: groupid, ID: &provider.StorageSpaceId{OpaqueId: id}, Timestamp: time.Now(), } diff --git a/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/interceptors/eventsmiddleware/events.go b/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/interceptors/eventsmiddleware/events.go index 7cd409d34..4b376c2d5 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/interceptors/eventsmiddleware/events.go +++ b/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/interceptors/eventsmiddleware/events.go @@ -81,15 +81,30 @@ func NewUnary(m map[string]interface{}) (grpc.UnaryServerInterceptor, int, error switch v := res.(type) { case *collaboration.CreateShareResponse: if isSuccess(v) { - ev = ShareCreated(v, executant) + if utils.ExistsInOpaque(v.Opaque, "noevent") { + break + } + if utils.ExistsInOpaque(v.Opaque, "spacegrant") { + ev = SpaceShared(v, executant) + } else { + ev = ShareCreated(v, executant) + } } case *collaboration.RemoveShareResponse: if isSuccess(v) { - ev = ShareRemoved(v, req.(*collaboration.RemoveShareRequest), executant) + if utils.ExistsInOpaque(v.Opaque, "spacegrant") { + ev = SpaceUnshared(v, req.(*collaboration.RemoveShareRequest), executant) + } else { + ev = ShareRemoved(v, req.(*collaboration.RemoveShareRequest), executant) + } } case *collaboration.UpdateShareResponse: if isSuccess(v) { - ev = ShareUpdated(v, req.(*collaboration.UpdateShareRequest), executant) + if utils.ExistsInOpaque(v.Opaque, "spacegrant") { + ev = SpaceShareUpdated(v, executant) + } else { + ev = ShareUpdated(v, req.(*collaboration.UpdateShareRequest), executant) + } } case *collaboration.UpdateReceivedShareResponse: if isSuccess(v) { @@ -117,24 +132,6 @@ func NewUnary(m map[string]interface{}) (grpc.UnaryServerInterceptor, int, error if isSuccess(v) { ev = OCMCoreShareCreated(v, req.(*ocmcore.CreateOCMCoreShareRequest), executant) } - case *provider.AddGrantResponse: - // TODO: update CS3 APIs - // FIXME these should be part of the RemoveGrantRequest object - // https://github.com/owncloud/ocis/issues/4312 - r := req.(*provider.AddGrantRequest) - if isSuccess(v) && utils.ExistsInOpaque(r.Opaque, "spacegrant") { - ev = SpaceShared(v, r, executant) - } - case *provider.UpdateGrantResponse: - r := req.(*provider.UpdateGrantRequest) - if isSuccess(v) && utils.ExistsInOpaque(r.Opaque, "spacegrant") { - ev = SpaceShareUpdated(v, r, executant) - } - case *provider.RemoveGrantResponse: - r := req.(*provider.RemoveGrantRequest) - if isSuccess(v) && utils.ExistsInOpaque(r.Opaque, "spacegrant") { - ev = SpaceUnshared(v, req.(*provider.RemoveGrantRequest), executant) - } case *provider.CreateContainerResponse: if isSuccess(v) { ev = ContainerCreated(v, req.(*provider.CreateContainerRequest), ownerID, executant) diff --git a/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/services/gateway/storageprovider.go b/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/services/gateway/storageprovider.go index 539f13dad..bdeb10bdb 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/services/gateway/storageprovider.go +++ b/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/services/gateway/storageprovider.go @@ -36,6 +36,8 @@ import ( provider "github.com/cs3org/go-cs3apis/cs3/storage/provider/v1beta1" registry "github.com/cs3org/go-cs3apis/cs3/storage/registry/v1beta1" typesv1beta1 "github.com/cs3org/go-cs3apis/cs3/types/v1beta1" + "github.com/opencloud-eu/reva/v2/pkg/conversions" + "github.com/rs/zerolog/log" "google.golang.org/grpc/codes" "github.com/golang-jwt/jwt/v5" @@ -226,6 +228,52 @@ func (s *svc) CreateStorageSpace(ctx context.Context, req *provider.CreateStorag }, nil } + // If the create space is not a "personal" space, we add a Share to the ShareProvider to give the creator + // of the space "manager" access to it. + // Note: the DecomposedFS storagadriver already adds a grant to the space root giving that access, the "CreateShare" + // here is happeing so that that grant is also visible when listing permission (shares) on the spaceroot. + if req.GetType() != "personal" && createRes.GetStatus().GetCode() == rpc.Code_CODE_OK { + rollbackFn := func() { + dsRes, dsErr := s.DeleteStorageSpace(ctx, &provider.DeleteStorageSpaceRequest{ + Id: createRes.GetStorageSpace().GetId(), + }) + if dsErr != nil || dsRes.GetStatus().GetCode() != rpc.Code_CODE_OK { + log.Error().Err(dsErr).Interface("status", dsRes.GetStatus()).Interface("space_id", createRes.GetStorageSpace().GetId()).Msg("failed to delete space during rollback") + } + } + + u := ctxpkg.ContextMustGetUser(ctx) + shareReq := &collaborationv1beta1.CreateShareRequest{ + ResourceInfo: &provider.ResourceInfo{ + Id: createRes.GetStorageSpace().GetRoot(), + }, + Grant: &collaborationv1beta1.ShareGrant{ + Grantee: &provider.Grantee{ + Type: provider.GranteeType_GRANTEE_TYPE_USER, + Id: &provider.Grantee_UserId{ + UserId: u.GetId(), + }, + }, + Permissions: &collaborationv1beta1.SharePermissions{ + Permissions: conversions.NewManagerRole().CS3ResourcePermissions(), + }, + }, + } + csResp, err := s.CreateShare(ctx, shareReq) + if err != nil || csResp.GetStatus().GetCode() != rpc.Code_CODE_OK { + log.Error().Err(err).Interface("status", csResp.GetStatus()).Interface("space_id", createRes.GetStorageSpace().GetId()).Msg("failed to create initial share for space creator, rolling back space creation") + rollbackFn() + + shareErrMsg := "failed to create initial share for space creator" + if err == nil { + shareErrMsg = csResp.GetStatus().GetMessage() + } + return &provider.CreateStorageSpaceResponse{ + Status: status.NewInternal(ctx, shareErrMsg), + }, nil + } + } + return createRes, nil } diff --git a/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/services/gateway/usershareprovider.go b/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/services/gateway/usershareprovider.go index 738faa826..388b6f04e 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/services/gateway/usershareprovider.go +++ b/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/services/gateway/usershareprovider.go @@ -150,7 +150,12 @@ func (s *svc) updateShare(ctx context.Context, req *collaboration.UpdateShareReq Expiration: res.GetShare().GetExpiration(), Creator: creator.GetId(), } - updateGrantStatus, err := s.updateGrant(ctx, res.GetShare().GetResourceId(), grant, nil) + var opaque *typesv1beta1.Opaque + if refIsSpaceRoot(res.GetShare().GetResourceId()) { + opaque = utils.SpaceGrantOpaque() + utils.AppendPlainToOpaque(opaque, "spacetype", utils.ReadPlainFromOpaque(req.GetOpaque(), "spacetype")) + } + updateGrantStatus, err := s.updateGrant(ctx, res.GetShare().GetResourceId(), grant, opaque) if err != nil { return nil, errors.Wrap(err, "gateway: error calling updateGrant") @@ -175,11 +180,7 @@ func (s *svc) updateSpaceShare(ctx context.Context, req *collaboration.UpdateSha var st *rpc.Status var err error // TODO: change CS3 APIs - opaque := &typesv1beta1.Opaque{ - Map: map[string]*typesv1beta1.OpaqueEntry{ - "spacegrant": {}, - }, - } + opaque := utils.SpaceGrantOpaque() utils.AppendPlainToOpaque(opaque, "spacetype", utils.ReadPlainFromOpaque(req.Opaque, "spacetype")) if grants.PermissionsEqual(req.Share.GetPermissions().GetPermissions(), &provider.ResourcePermissions{}) { @@ -613,13 +614,18 @@ func (s *svc) addShare(ctx context.Context, req *collaboration.CreateShareReques if s.c.CommitShareToStorageGrant { // If the share is a denial we call denyGrant instead. var status *rpc.Status + var opaque *typesv1beta1.Opaque + if refIsSpaceRoot(req.ResourceInfo.Id) { + opaque = utils.SpaceGrantOpaque() + utils.AppendPlainToOpaque(opaque, "spacetype", req.ResourceInfo.GetSpace().GetSpaceType()) + } if grants.PermissionsEqual(req.Grant.Permissions.Permissions, &provider.ResourcePermissions{}) { - status, err = s.denyGrant(ctx, req.ResourceInfo.Id, req.Grant.Grantee, nil) + status, err = s.denyGrant(ctx, req.ResourceInfo.Id, req.Grant.Grantee, opaque) if err != nil { return nil, errors.Wrap(err, "gateway: error denying grant in storage") } } else { - status, err = s.addGrant(ctx, req.ResourceInfo.Id, req.Grant.Grantee, req.Grant.Permissions.Permissions, req.Grant.Expiration, nil) + status, err = s.addGrant(ctx, req.ResourceInfo.Id, req.Grant.Grantee, req.Grant.Permissions.Permissions, req.Grant.Expiration, opaque) if err != nil { appctx.GetLogger(ctx).Debug().Interface("status", status).Interface("req", req).Msg(err.Error()) rollBackFn(status) @@ -628,7 +634,7 @@ func (s *svc) addShare(ctx context.Context, req *collaboration.CreateShareReques } switch status.Code { - case rpc.Code_CODE_OK: + case rpc.Code_CODE_OK, rpc.Code_CODE_ALREADY_EXISTS: // ok case rpc.Code_CODE_UNIMPLEMENTED: appctx.GetLogger(ctx).Debug().Interface("status", status).Interface("req", req).Msg("storing grants not supported, ignoring") @@ -653,11 +659,7 @@ func (s *svc) addSpaceShare(ctx context.Context, req *collaboration.CreateShareR var st *rpc.Status var err error // TODO: change CS3 APIs - opaque := &typesv1beta1.Opaque{ - Map: map[string]*typesv1beta1.OpaqueEntry{ - "spacegrant": {}, - }, - } + opaque := utils.SpaceGrantOpaque() utils.AppendPlainToOpaque( opaque, "spacetype", @@ -742,9 +744,16 @@ func (s *svc) removeShare(ctx context.Context, req *collaboration.RemoveShareReq if err != nil { return nil, errors.Wrap(err, "gateway: error calling RemoveShare") } + if res.Status.Code != rpc.Code_CODE_OK { + return res, nil + } if s.c.CommitShareToStorageGrant { - removeGrantStatus, err := s.removeGrant(ctx, share.ResourceId, share.Grantee, share.Permissions.Permissions, nil) + var opaque *typesv1beta1.Opaque + if refIsSpaceRoot(share.ResourceId) { + opaque = utils.SpaceGrantOpaque() + } + removeGrantStatus, err := s.removeGrant(ctx, share.ResourceId, share.Grantee, share.Permissions.Permissions, opaque) if err != nil { return nil, errors.Wrap(err, "gateway: error removing grant from storage") } @@ -780,11 +789,7 @@ func (s *svc) removeSpaceShare(ctx context.Context, ref *provider.ResourceId, gr } // TODO: change CS3 APIs - opaque := &typesv1beta1.Opaque{ - Map: map[string]*typesv1beta1.OpaqueEntry{ - "spacegrant": {}, - }, - } + opaque := utils.SpaceGrantOpaque() removeGrantStatus, err := s.removeGrant(ctx, ref, grantee, permissions, opaque) if err != nil { return nil, errors.Wrap(err, "gateway: error removing grant from storage") diff --git a/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/services/sharesstorageprovider/sharesstorageprovider.go b/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/services/sharesstorageprovider/sharesstorageprovider.go index 04c253e82..b36df8bda 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/services/sharesstorageprovider/sharesstorageprovider.go +++ b/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/services/sharesstorageprovider/sharesstorageprovider.go @@ -46,6 +46,7 @@ import ( "github.com/opencloud-eu/reva/v2/pkg/rgrpc" "github.com/opencloud-eu/reva/v2/pkg/rgrpc/status" "github.com/opencloud-eu/reva/v2/pkg/rgrpc/todo/pool" + "github.com/opencloud-eu/reva/v2/pkg/share" "github.com/opencloud-eu/reva/v2/pkg/sharedconf" "github.com/opencloud-eu/reva/v2/pkg/utils" "github.com/pkg/errors" @@ -1093,12 +1094,8 @@ func (s *service) resolveAcceptedShare(ctx context.Context, ref *provider.Refere if ref.ResourceId.OpaqueId == utils.ShareStorageProviderID && ref.Path != "." { lsRes, err := sharingCollaborationClient.ListReceivedShares(ctx, &collaboration.ListReceivedSharesRequest{ Filters: []*collaboration.Filter{ - { - Type: collaboration.Filter_TYPE_STATE, - Term: &collaboration.Filter_State{ - State: collaboration.ShareState_SHARE_STATE_ACCEPTED, - }, - }, + share.StateFilter(collaboration.ShareState_SHARE_STATE_ACCEPTED), + share.SpaceRootFilter(false), // TODO filter by mountpoint? }, }) @@ -1179,12 +1176,8 @@ func (s *service) fetchAcceptedShares(ctx context.Context, opaque *typesv1beta1. lsRes, err := sharingCollaborationClient.ListReceivedShares(ctx, &collaboration.ListReceivedSharesRequest{ Filters: []*collaboration.Filter{ - { - Type: collaboration.Filter_TYPE_STATE, - Term: &collaboration.Filter_State{ - State: collaboration.ShareState_SHARE_STATE_ACCEPTED, - }, - }, + share.StateFilter(collaboration.ShareState_SHARE_STATE_ACCEPTED), + share.SpaceRootFilter(false), }, }) if err != nil { diff --git a/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/services/usershareprovider/usershareprovider.go b/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/services/usershareprovider/usershareprovider.go index ac3629334..eaab35976 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/services/usershareprovider/usershareprovider.go +++ b/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/services/usershareprovider/usershareprovider.go @@ -27,10 +27,12 @@ import ( "strings" gateway "github.com/cs3org/go-cs3apis/cs3/gateway/v1beta1" + grouppb "github.com/cs3org/go-cs3apis/cs3/identity/group/v1beta1" userpb "github.com/cs3org/go-cs3apis/cs3/identity/user/v1beta1" rpc "github.com/cs3org/go-cs3apis/cs3/rpc/v1beta1" collaboration "github.com/cs3org/go-cs3apis/cs3/sharing/collaboration/v1beta1" provider "github.com/cs3org/go-cs3apis/cs3/storage/provider/v1beta1" + typesv1beta1 "github.com/cs3org/go-cs3apis/cs3/types/v1beta1" "github.com/mitchellh/mapstructure" "github.com/pkg/errors" "github.com/rs/zerolog" @@ -54,6 +56,9 @@ const ( _fieldMaskPathMountPoint = "mount_point" _fieldMaskPathPermissions = "permissions" _fieldMaskPathState = "state" + _spaceTypePersonal = "personal" + _spaceTypeProject = "project" + _spaceTypeVirtual = "virtual" ) func init() { @@ -166,13 +171,6 @@ func (s *service) isPathAllowed(path string) bool { func (s *service) CreateShare(ctx context.Context, req *collaboration.CreateShareRequest) (*collaboration.CreateShareResponse, error) { log := appctx.GetLogger(ctx) user := ctxpkg.ContextMustGetUser(ctx) - // Grants must not allow grant permissions - if HasGrantPermissions(req.GetGrant().GetPermissions().GetPermissions()) { - return &collaboration.CreateShareResponse{ - Status: status.NewInvalidArg(ctx, "resharing not supported"), - }, nil - } - // check if the grantee is a user or group if req.GetGrant().GetGrantee().GetType() == provider.GranteeType_GRANTEE_TYPE_USER { // check if the tenantId of the user matches the tenantId of the target user @@ -202,8 +200,8 @@ func (s *service) CreateShare(ctx context.Context, req *collaboration.CreateShar }, nil } + // use logged in user Idp as default, if the Grantee does not have an IDP set. if req.GetGrant().GetGrantee().GetType() == provider.GranteeType_GRANTEE_TYPE_USER && req.GetGrant().GetGrantee().GetUserId().GetIdp() == "" { - // use logged in user Idp as default. req.GetGrant().GetGrantee().Id = &provider.Grantee_UserId{ UserId: &userpb.UserId{ OpaqueId: req.GetGrant().GetGrantee().GetUserId().GetOpaqueId(), @@ -211,6 +209,16 @@ func (s *service) CreateShare(ctx context.Context, req *collaboration.CreateShar Type: userpb.UserType_USER_TYPE_PRIMARY}, } } + // some for group grantees + if req.GetGrant().GetGrantee().GetType() == provider.GranteeType_GRANTEE_TYPE_GROUP && req.GetGrant().GetGrantee().GetGroupId().GetIdp() == "" { + // use logged in user Idp as default. + req.GetGrant().GetGrantee().Id = &provider.Grantee_GroupId{ + GroupId: &grouppb.GroupId{ + OpaqueId: req.GetGrant().GetGrantee().GetGroupId().GetOpaqueId(), + Idp: user.GetId().GetIdp(), + Type: grouppb.GroupType_GROUP_TYPE_REGULAR}, + } + } sRes, err := gatewayClient.Stat(ctx, &provider.StatRequest{Ref: &provider.Reference{ResourceId: req.GetResourceInfo().GetId()}}) if err != nil { @@ -225,6 +233,55 @@ func (s *service) CreateShare(ctx context.Context, req *collaboration.CreateShar Status: status.NewPermissionDenied(ctx, nil, "no permission to add grants on shared resource"), }, err } + + isSpaceRoot := utils.IsSpaceRoot(sRes.GetInfo()) + var noEvent bool + + if isSpaceRoot { + if sRes.GetInfo().GetSpace().GetSpaceType() == _spaceTypePersonal || sRes.GetInfo().GetSpace().GetSpaceType() == _spaceTypeVirtual { + return &collaboration.CreateShareResponse{Status: status.NewInvalid(ctx, "space type is not eligible for sharing")}, nil + } + } + + // do not allow share to myself or the owner if share is for a user + if req.GetGrant().GetGrantee().GetType() == provider.GranteeType_GRANTEE_TYPE_USER && + (utils.UserEqual(req.GetGrant().GetGrantee().GetUserId(), user.Id) || utils.UserEqual(req.GetGrant().GetGrantee().GetUserId(), sRes.GetInfo().GetOwner())) { + + denySelfShare := true + // To allow adding the initial "mananger" share for the creator of a space when need to make an exception here + // if the shared resource is a space root, that does not have any Share existin yet. Note, that we have already + // verified that the user adding the share does really have "AddGrant" permissions on the affected resource, so + // this "hack" should be ok. + if isSpaceRoot { + shares, err := s.sm.ListShares( + ctx, + []*collaboration.Filter{share.ResourceIDFilter(req.GetResourceInfo().GetId())}, + ) + if err != nil { + return &collaboration.CreateShareResponse{ + Status: status.NewInternal(ctx, "failed to list existing shares"), + }, nil + } + if len(shares) == 0 { + denySelfShare = false + noEvent = true + } + } + if denySelfShare { + err := errtypes.BadRequest("jsoncs3: owner/creator and grantee are the same") + return nil, err + } + } + + // resharing is forbidden for not space roots + if !isSpaceRoot { + // Resharing of Files/Directories is forbidden. So the grants must not allow the "grant" permissions + if HasGrantPermissions(req.GetGrant().GetPermissions().GetPermissions()) { + return &collaboration.CreateShareResponse{ + Status: status.NewInvalidArg(ctx, "resharing not supported"), + }, nil + } + } // check if the share creator has sufficient permissions to do so. if shareCreationAllowed := conversions.SufficientCS3Permissions( sRes.GetInfo().GetPermissionSet(), @@ -256,10 +313,22 @@ func (s *service) CreateShare(ctx context.Context, req *collaboration.CreateShar }, nil } + var opaque *typesv1beta1.Opaque + if isSpaceRoot { + opaque = utils.SpaceGrantOpaque() + } + + if noEvent { + opaque = &typesv1beta1.Opaque{ + Map: map[string]*typesv1beta1.OpaqueEntry{ + "noevent": {}, + }, + } + } return &collaboration.CreateShareResponse{ Status: status.NewOK(ctx), Share: createdShare, - Opaque: utils.AppendPlainToOpaque(nil, "resourcename", sRes.GetInfo().GetName()), + Opaque: utils.AppendPlainToOpaque(opaque, "resourcename", sRes.GetInfo().GetName()), }, nil } @@ -267,6 +336,30 @@ func HasGrantPermissions(p *provider.ResourcePermissions) bool { return p.GetAddGrant() || p.GetUpdateGrant() || p.GetRemoveGrant() || p.GetDenyGrant() } +// spaceRootHasRemainingManager returns true if the given resource has at least one share +// (excluding the share with excludeShareOpaqueID) that grants both AddGrant and RemoveGrant. +func (s *service) spaceRootHasRemainingManager(ctx context.Context, resourceID *provider.ResourceId, excludeShareOpaqueID string) (bool, error) { + shares, err := s.sm.ListShares(ctx, []*collaboration.Filter{ + { + Type: collaboration.Filter_TYPE_RESOURCE_ID, + Term: &collaboration.Filter_ResourceId{ResourceId: resourceID}, + }, + }) + if err != nil { + return false, err + } + for _, s := range shares { + if s.GetId().GetOpaqueId() == excludeShareOpaqueID { + continue + } + perms := s.GetPermissions().GetPermissions() + if perms.GetAddGrant() && perms.GetRemoveGrant() { + return true, nil + } + } + return false, nil +} + func (s *service) RemoveShare(ctx context.Context, req *collaboration.RemoveShareRequest) (*collaboration.RemoveShareResponse, error) { log := appctx.GetLogger(ctx) user := ctxpkg.ContextMustGetUser(ctx) @@ -300,6 +393,20 @@ func (s *service) RemoveShare(ctx context.Context, req *collaboration.RemoveShar }, err } + // For space root shares, ensure at least one share with both AddGrant and RemoveGrant will remain + // so the space always has a manager who can administer grants. + if utils.IsSpaceRoot(sRes.GetInfo()) { + if ok, err := s.spaceRootHasRemainingManager(ctx, share.GetResourceId(), share.GetId().GetOpaqueId()); err != nil { + return &collaboration.RemoveShareResponse{ + Status: status.NewInternal(ctx, "failed to list shares for space root"), + }, nil + } else if !ok { + return &collaboration.RemoveShareResponse{ + Status: status.NewPermissionDenied(ctx, nil, "cannot remove the last share with manager permissions on a space root"), + }, nil + } + } + err = s.sm.Unshare(ctx, req.Ref) if err != nil { return &collaboration.RemoveShareResponse{ @@ -307,16 +414,20 @@ func (s *service) RemoveShare(ctx context.Context, req *collaboration.RemoveShar }, nil } - o := utils.AppendJSONToOpaque(nil, "resourceid", share.GetResourceId()) - o = utils.AppendPlainToOpaque(o, "resourcename", sRes.GetInfo().GetName()) + var opaque *typesv1beta1.Opaque + if utils.IsSpaceRoot(sRes.GetInfo()) { + opaque = utils.SpaceGrantOpaque() + } + opaque = utils.AppendJSONToOpaque(opaque, "resourceid", share.GetResourceId()) + opaque = utils.AppendPlainToOpaque(opaque, "resourcename", sRes.GetInfo().GetName()) if user := share.GetGrantee().GetUserId(); user != nil { - o = utils.AppendJSONToOpaque(o, "granteeuserid", user) + opaque = utils.AppendJSONToOpaque(opaque, "granteeuserid", user) } else { - o = utils.AppendJSONToOpaque(o, "granteegroupid", share.GetGrantee().GetGroupId()) + opaque = utils.AppendJSONToOpaque(opaque, "granteegroupid", share.GetGrantee().GetGroupId()) } return &collaboration.RemoveShareResponse{ - Opaque: o, + Opaque: opaque, Status: status.NewOK(ctx), }, nil } @@ -361,13 +472,6 @@ func (s *service) UpdateShare(ctx context.Context, req *collaboration.UpdateShar log := appctx.GetLogger(ctx) user := ctxpkg.ContextMustGetUser(ctx) - // Grants must not allow grant permissions - if HasGrantPermissions(req.GetShare().GetPermissions().GetPermissions()) { - return &collaboration.UpdateShareResponse{ - Status: status.NewInvalidArg(ctx, "resharing not supported"), - }, nil - } - gatewayClient, err := s.gatewaySelector.Next() if err != nil { return nil, err @@ -427,6 +531,15 @@ func (s *service) UpdateShare(ctx context.Context, req *collaboration.UpdateShar }, err } + // resharing is forbidden for not space roots + if !utils.IsSpaceRoot(sRes.GetInfo()) { + // Resharing of Files/Directories is forbidden. So the grants must not allow the "grant" permissions + if HasGrantPermissions(req.GetShare().GetPermissions().GetPermissions()) { + return &collaboration.UpdateShareResponse{ + Status: status.NewInvalidArg(ctx, "resharing not supported"), + }, nil + } + } // If this is a permissions update, check if user's permissions on the resource are sufficient to set the desired permissions var newPermissions *provider.ResourcePermissions if slices.Contains(req.GetUpdateMask().GetPaths(), _fieldMaskPathPermissions) { @@ -440,6 +553,20 @@ func (s *service) UpdateShare(ctx context.Context, req *collaboration.UpdateShar }, nil } + // For space root shares, if the new permissions would strip AddGrant or RemoveGrant from this share, + // ensure at least one other share still has both so the space retains a manager. + if utils.IsSpaceRoot(sRes.GetInfo()) && newPermissions != nil && (!newPermissions.GetAddGrant() || !newPermissions.GetRemoveGrant()) { + if ok, err := s.spaceRootHasRemainingManager(ctx, currentShare.GetResourceId(), currentShare.GetId().GetOpaqueId()); err != nil { + return &collaboration.UpdateShareResponse{ + Status: status.NewInternal(ctx, "failed to list shares for space root"), + }, nil + } else if !ok { + return &collaboration.UpdateShareResponse{ + Status: status.NewPermissionDenied(ctx, nil, "cannot remove the last share with manager permissions on a space root"), + }, nil + } + } + // check if the requested permission are plausible for the Resource // do we need more here? if sRes.GetInfo().GetType() == provider.ResourceType_RESOURCE_TYPE_FILE { @@ -457,10 +584,15 @@ func (s *service) UpdateShare(ctx context.Context, req *collaboration.UpdateShar }, nil } + var opaque *typesv1beta1.Opaque + if utils.IsSpaceRoot(sRes.GetInfo()) { + opaque = utils.SpaceGrantOpaque() + } + res := &collaboration.UpdateShareResponse{ Status: status.NewOK(ctx), Share: share, - Opaque: utils.AppendPlainToOpaque(nil, "resourcename", sRes.GetInfo().GetName()), + Opaque: utils.AppendPlainToOpaque(opaque, "resourcename", sRes.GetInfo().GetName()), } return res, nil } diff --git a/vendor/github.com/opencloud-eu/reva/v2/internal/http/services/owncloud/ocs/handlers/apps/sharing/shares/pending.go b/vendor/github.com/opencloud-eu/reva/v2/internal/http/services/owncloud/ocs/handlers/apps/sharing/shares/pending.go index 7e6ac28d3..8b263d10c 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/internal/http/services/owncloud/ocs/handlers/apps/sharing/shares/pending.go +++ b/vendor/github.com/opencloud-eu/reva/v2/internal/http/services/owncloud/ocs/handlers/apps/sharing/shares/pending.go @@ -179,6 +179,10 @@ func (h *Handler) UpdateReceivedShare(w http.ResponseWriter, r *http.Request) { response.WriteOCSSuccess(w, r, []*conversions.ShareData{data}) } +func (h *Handler) ReceivedShareNotFound(w http.ResponseWriter, r *http.Request) { + response.WriteOCSError(w, r, response.MetaNotFound.StatusCode, "cannot find share", nil) +} + func (h *Handler) updateReceivedShare(ctx context.Context, receivedShare *collaboration.ReceivedShare, fieldMask *fieldmaskpb.FieldMask) (*conversions.ShareData, response.Meta, error) { logger := appctx.GetLogger(ctx) diff --git a/vendor/github.com/opencloud-eu/reva/v2/internal/http/services/owncloud/ocs/handlers/apps/sharing/shares/shares.go b/vendor/github.com/opencloud-eu/reva/v2/internal/http/services/owncloud/ocs/handlers/apps/sharing/shares/shares.go index d44c3316c..753e1c862 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/internal/http/services/owncloud/ocs/handlers/apps/sharing/shares/shares.go +++ b/vendor/github.com/opencloud-eu/reva/v2/internal/http/services/owncloud/ocs/handlers/apps/sharing/shares/shares.go @@ -78,7 +78,6 @@ var ( type Handler struct { gatewayAddr string machineAuthAPIKey string - storageRegistryAddr string publicURL string sharePrefix string homeNamespace string @@ -129,7 +128,6 @@ type GatewayClientGetter func() (gateway.GatewayAPIClient, error) func (h *Handler) Init(c *config.Config) error { h.gatewayAddr = c.GatewaySvc h.machineAuthAPIKey = c.MachineAuthAPIKey - h.storageRegistryAddr = c.StorageregistrySvc h.publicURL = c.Config.Host h.sharePrefix = c.SharePrefix h.homeNamespace = c.HomeNamespace @@ -941,12 +939,11 @@ func (h *Handler) RemoveShare(w http.ResponseWriter, r *http.Request) { h.removeFederatedShare(w, r, shareID) return } - - if prov, ok := h.isSpaceShare(r, shareID); ok { - // The request is a remove space member request. - h.removeSpaceMember(w, r, shareID, prov) + if h.isSpaceShare(r, shareID) { + h.removeSpaceMember(w, r, shareID) return } + response.WriteOCSError(w, r, response.MetaNotFound.StatusCode, "cannot find share", nil) } diff --git a/vendor/github.com/opencloud-eu/reva/v2/internal/http/services/owncloud/ocs/handlers/apps/sharing/shares/spaces.go b/vendor/github.com/opencloud-eu/reva/v2/internal/http/services/owncloud/ocs/handlers/apps/sharing/shares/spaces.go index 3a1a2f595..94d0a0501 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/internal/http/services/owncloud/ocs/handlers/apps/sharing/shares/spaces.go +++ b/vendor/github.com/opencloud-eu/reva/v2/internal/http/services/owncloud/ocs/handlers/apps/sharing/shares/spaces.go @@ -29,18 +29,12 @@ import ( rpc "github.com/cs3org/go-cs3apis/cs3/rpc/v1beta1" collaborationv1beta1 "github.com/cs3org/go-cs3apis/cs3/sharing/collaboration/v1beta1" provider "github.com/cs3org/go-cs3apis/cs3/storage/provider/v1beta1" - registry "github.com/cs3org/go-cs3apis/cs3/storage/registry/v1beta1" types "github.com/cs3org/go-cs3apis/cs3/types/v1beta1" "github.com/opencloud-eu/reva/v2/internal/http/services/owncloud/ocs/response" "github.com/opencloud-eu/reva/v2/pkg/appctx" "github.com/opencloud-eu/reva/v2/pkg/conversions" - "github.com/opencloud-eu/reva/v2/pkg/errtypes" - "github.com/opencloud-eu/reva/v2/pkg/rgrpc/status" - "github.com/opencloud-eu/reva/v2/pkg/rgrpc/todo/pool" - sdk "github.com/opencloud-eu/reva/v2/pkg/sdk/common" "github.com/opencloud-eu/reva/v2/pkg/storagespace" "github.com/opencloud-eu/reva/v2/pkg/utils" - "github.com/pkg/errors" "google.golang.org/protobuf/types/known/fieldmaskpb" ) @@ -131,45 +125,34 @@ func (h *Handler) addSpaceMember(w http.ResponseWriter, r *http.Request, info *p fieldmask = append(fieldmask, "expiration") } - ref := provider.Reference{ResourceId: info.GetId()} - p, err := h.findProvider(ctx, &ref) - if err != nil { - response.WriteOCSError(w, r, response.MetaNotFound.StatusCode, "error getting storage provider", err) + lsRes, err := client.ListShares(ctx, &collaborationv1beta1.ListSharesRequest{ + Filters: []*collaborationv1beta1.Filter{ + { + Type: collaborationv1beta1.Filter_TYPE_RESOURCE_ID, + Term: &collaborationv1beta1.Filter_ResourceId{ + ResourceId: info.GetId(), + }, + }, + }, + }) + if err != nil || lsRes.Status.Code != rpc.Code_CODE_OK { + response.WriteOCSError(w, r, response.MetaServerError.StatusCode, "error listing space members", err) return } - providerClient, err := h.getStorageProviderClient(p) - if err != nil { - response.WriteOCSError(w, r, response.MetaNotFound.StatusCode, "error getting storage provider client", err) - return - } - - lgRes, err := providerClient.ListGrants(ctx, &provider.ListGrantsRequest{Ref: &ref}) - if err != nil || lgRes.Status.Code != rpc.Code_CODE_OK { - response.WriteOCSError(w, r, response.MetaServerError.StatusCode, "error listing space grants", err) - return - } - - if !isSpaceManagerRemaining(lgRes.Grants, &grantee) { + if !isSpaceManagerRemainingInShares(lsRes.Shares, &grantee) { response.WriteOCSError(w, r, http.StatusForbidden, "the space must have at least one manager", nil) return } - // we have to send the update request to the gateway to give it a chance to invalidate its cache - // TODO the gateway no longer should cache stuff because invalidation is to expensive. The decomposedfs already has a better cache. - if granteeExists(lgRes.Grants, &grantee) { + if existingShare := findShareByGrantee(lsRes.Shares, &grantee); existingShare != nil { if permissions != nil { fieldmask = append(fieldmask, "permissions") } updateShareReq := &collaborationv1beta1.UpdateShareRequest{ - // TODO: change CS3 APIs - Opaque: &types.Opaque{ - Map: map[string]*types.OpaqueEntry{ - "spacegrant": {}, - }, - }, + Opaque: utils.AppendPlainToOpaque(nil, "spacetype", info.GetSpace().GetSpaceType()), Share: &collaborationv1beta1.Share{ - ResourceId: ref.GetResourceId(), + Id: existingShare.Id, Permissions: &collaborationv1beta1.SharePermissions{ Permissions: permissions, }, @@ -180,10 +163,9 @@ func (h *Handler) addSpaceMember(w http.ResponseWriter, r *http.Request, info *p Paths: fieldmask, }, } - updateShareReq.Opaque = utils.AppendPlainToOpaque(updateShareReq.Opaque, "spacetype", info.GetSpace().GetSpaceType()) updateShareRes, err := client.UpdateShare(ctx, updateShareReq) if err != nil || updateShareRes.Status.Code != rpc.Code_CODE_OK { - response.WriteOCSError(w, r, response.MetaServerError.StatusCode, "could not update space member grant", err) + response.WriteOCSError(w, r, response.MetaServerError.StatusCode, "could not update space member", err) return } } else { @@ -198,7 +180,7 @@ func (h *Handler) addSpaceMember(w http.ResponseWriter, r *http.Request, info *p }, }) if err != nil || createShareRes.Status.Code != rpc.Code_CODE_OK { - response.WriteOCSError(w, r, response.MetaServerError.StatusCode, "could not add space member grant", err) + response.WriteOCSError(w, r, response.MetaServerError.StatusCode, "could not add space member", err) return } } @@ -206,21 +188,22 @@ func (h *Handler) addSpaceMember(w http.ResponseWriter, r *http.Request, info *p response.WriteOCSSuccess(w, r, nil) } -func (h *Handler) isSpaceShare(r *http.Request, spaceID string) (*registry.ProviderInfo, bool) { - ref, err := storagespace.ParseReference(spaceID) - if err != nil { - return nil, false +func (h *Handler) isSpaceShare(r *http.Request, shareID string) bool { + ref, err := storagespace.ParseReference(shareID) + // NOTE: we ignore the 'Path' part of the reference here as we're just interested in the space root + switch { + case err != nil: + return false + case ref.GetResourceId().GetSpaceId() == "": + return false + case ref.GetResourceId().GetOpaqueId() == "" || ref.GetResourceId().GetSpaceId() == ref.GetResourceId().GetOpaqueId(): + return true + default: + return false } - - if ref.ResourceId.OpaqueId == "" { - ref.ResourceId.OpaqueId = ref.ResourceId.SpaceId - } - - p, err := h.findProvider(r.Context(), &ref) - return p, err == nil } -func (h *Handler) removeSpaceMember(w http.ResponseWriter, r *http.Request, spaceID string, prov *registry.ProviderInfo) { +func (h *Handler) removeSpaceMember(w http.ResponseWriter, r *http.Request, spaceID string) { ctx := r.Context() shareWith := r.URL.Query().Get("shareWith") @@ -245,129 +228,73 @@ func (h *Handler) removeSpaceMember(w http.ResponseWriter, r *http.Request, spac ref.ResourceId.OpaqueId = ref.ResourceId.SpaceId } - providerClient, err := h.getStorageProviderClient(prov) - if err != nil { - response.WriteOCSError(w, r, response.MetaNotFound.StatusCode, "error getting storage provider client", err) - return - } - - lgRes, err := providerClient.ListGrants(ctx, &provider.ListGrantsRequest{Ref: &ref}) - if err != nil || lgRes.Status.Code != rpc.Code_CODE_OK { - response.WriteOCSError(w, r, response.MetaServerError.StatusCode, "error listing space grants", err) - return - } - - if len(lgRes.Grants) == 1 || !isSpaceManagerRemaining(lgRes.Grants, &grantee) { - response.WriteOCSError(w, r, http.StatusForbidden, "can't remove the last manager", nil) - return - } - - gatewayClient, err := h.getClient() + client, err := h.getClient() if err != nil { response.WriteOCSError(w, r, response.MetaNotFound.StatusCode, "error getting gateway client", err) return } - removeShareRes, err := gatewayClient.RemoveShare(ctx, &collaborationv1beta1.RemoveShareRequest{ - Ref: &collaborationv1beta1.ShareReference{ - Spec: &collaborationv1beta1.ShareReference_Key{ - Key: &collaborationv1beta1.ShareKey{ + lsRes, err := client.ListShares(ctx, &collaborationv1beta1.ListSharesRequest{ + Filters: []*collaborationv1beta1.Filter{ + { + Type: collaborationv1beta1.Filter_TYPE_RESOURCE_ID, + Term: &collaborationv1beta1.Filter_ResourceId{ ResourceId: ref.ResourceId, - Grantee: &grantee, }, }, }, }) + if err != nil || lsRes.Status.Code != rpc.Code_CODE_OK { + response.WriteOCSError(w, r, response.MetaServerError.StatusCode, "error listing space members", err) + return + } + + if len(lsRes.Shares) == 1 || !isSpaceManagerRemainingInShares(lsRes.Shares, &grantee) { + response.WriteOCSError(w, r, http.StatusForbidden, "can't remove the last manager", nil) + return + } + + s := findShareByGrantee(lsRes.Shares, &grantee) + if s == nil { + response.WriteOCSError(w, r, response.MetaNotFound.StatusCode, "cannot find share", nil) + return + } + + removeShareRes, err := client.RemoveShare(ctx, &collaborationv1beta1.RemoveShareRequest{ + Ref: &collaborationv1beta1.ShareReference{ + Spec: &collaborationv1beta1.ShareReference_Id{ + Id: s.Id, + }, + }, + }) if err != nil { - response.WriteOCSError(w, r, response.MetaServerError.StatusCode, "error removing grant", err) + response.WriteOCSError(w, r, response.MetaServerError.StatusCode, "error removing space member", err) return } if removeShareRes.Status.Code != rpc.Code_CODE_OK { - response.WriteOCSError(w, r, response.MetaServerError.StatusCode, "error removing grant", err) + response.WriteOCSError(w, r, response.MetaServerError.StatusCode, "error removing space member", nil) return } response.WriteOCSSuccess(w, r, nil) } -func (h *Handler) getStorageProviderClient(p *registry.ProviderInfo) (provider.ProviderAPIClient, error) { - c, err := pool.GetStorageProviderServiceClient(p.Address) - if err != nil { - err = errors.Wrap(err, "shares spaces: error getting a storage provider client") - return nil, err - } - - return c, nil -} - -func (h *Handler) findProvider(ctx context.Context, ref *provider.Reference) (*registry.ProviderInfo, error) { - c, err := pool.GetStorageRegistryClient(h.storageRegistryAddr) - if err != nil { - return nil, errors.Wrap(err, "shares spaces: error getting storage registry client") - } - - filters := map[string]string{} - if ref.Path != "" { - filters["path"] = ref.Path - } - if ref.ResourceId != nil { - filters["storage_id"] = ref.ResourceId.StorageId - filters["space_id"] = ref.ResourceId.SpaceId - filters["opaque_id"] = ref.ResourceId.OpaqueId - } - - listReq := ®istry.ListStorageProvidersRequest{ - Opaque: &types.Opaque{}, - } - sdk.EncodeOpaqueMap(listReq.Opaque, filters) - - res, err := c.ListStorageProviders(ctx, listReq) - - if err != nil { - return nil, errors.Wrap(err, "shares spaces: error calling ListStorageProviders") - } - - if res.Status.Code != rpc.Code_CODE_OK { - switch res.Status.Code { - case rpc.Code_CODE_NOT_FOUND: - return nil, errtypes.NotFound("shares spaces: storage provider not found for reference:" + ref.String()) - case rpc.Code_CODE_PERMISSION_DENIED: - return nil, errtypes.PermissionDenied("shares spaces: " + res.Status.Message + " for " + ref.String() + " with code " + res.Status.Code.String()) - case rpc.Code_CODE_INVALID_ARGUMENT, rpc.Code_CODE_FAILED_PRECONDITION, rpc.Code_CODE_OUT_OF_RANGE: - return nil, errtypes.BadRequest("shares spaces: " + res.Status.Message + " for " + ref.String() + " with code " + res.Status.Code.String()) - case rpc.Code_CODE_UNIMPLEMENTED: - return nil, errtypes.NotSupported("shares spaces: " + res.Status.Message + " for " + ref.String() + " with code " + res.Status.Code.String()) - default: - return nil, status.NewErrorFromCode(res.Status.Code, "shares spaces") - } - } - - if len(res.Providers) < 1 { - return nil, errtypes.NotFound("shares spaces: no provider found") - } - - return res.Providers[0], nil -} - -func isSpaceManagerRemaining(grants []*provider.Grant, grantee *provider.Grantee) bool { - for _, g := range grants { - // RemoveGrant is currently the way to check for the manager role - // If it is not set than the current grant is not for a manager and - // we can just continue with the next one. - if g.Permissions.RemoveGrant && !isEqualGrantee(g.Grantee, grantee) { +func isSpaceManagerRemainingInShares(shares []*collaborationv1beta1.Share, grantee *provider.Grantee) bool { + for _, s := range shares { + if s.GetPermissions().GetPermissions().GetRemoveGrant() && !isEqualGrantee(s.Grantee, grantee) { return true } } return false } -func granteeExists(grants []*provider.Grant, grantee *provider.Grantee) bool { - for _, g := range grants { - if isEqualGrantee(g.Grantee, grantee) { - return true +func findShareByGrantee(shares []*collaborationv1beta1.Share, grantee *provider.Grantee) *collaborationv1beta1.Share { + for _, s := range shares { + if isEqualGrantee(s.Grantee, grantee) { + return s } } - return false + return nil } func isEqualGrantee(a, b *provider.Grantee) bool { diff --git a/vendor/github.com/opencloud-eu/reva/v2/internal/http/services/owncloud/ocs/handlers/apps/sharing/shares/user.go b/vendor/github.com/opencloud-eu/reva/v2/internal/http/services/owncloud/ocs/handlers/apps/sharing/shares/user.go index fbea09a26..ce45c6002 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/internal/http/services/owncloud/ocs/handlers/apps/sharing/shares/user.go +++ b/vendor/github.com/opencloud-eu/reva/v2/internal/http/services/owncloud/ocs/handlers/apps/sharing/shares/user.go @@ -34,6 +34,7 @@ import ( ctxpkg "github.com/opencloud-eu/reva/v2/pkg/ctx" "github.com/opencloud-eu/reva/v2/pkg/permission" "github.com/opencloud-eu/reva/v2/pkg/rgrpc/todo/pool" + "github.com/opencloud-eu/reva/v2/pkg/share" "github.com/opencloud-eu/reva/v2/pkg/utils" ) @@ -330,7 +331,7 @@ func (h *Handler) listUserShares(r *http.Request, filters []*collaboration.Filte log := appctx.GetLogger(ctx) lsUserSharesRequest := collaboration.ListSharesRequest{ - Filters: filters, + Filters: append(filters, share.SpaceRootFilter(false)), } ocsDataPayload := make([]*conversions.ShareData, 0) diff --git a/vendor/github.com/opencloud-eu/reva/v2/internal/http/services/owncloud/ocs/ocs.go b/vendor/github.com/opencloud-eu/reva/v2/internal/http/services/owncloud/ocs/ocs.go index 40113a73f..795827b30 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/internal/http/services/owncloud/ocs/ocs.go +++ b/vendor/github.com/opencloud-eu/reva/v2/internal/http/services/owncloud/ocs/ocs.go @@ -123,6 +123,13 @@ func (s *svc) routerInit(log *zerolog.Logger) error { r.Delete("/", sharesHandler.RejectReceivedShare) r.Put("/", sharesHandler.UpdateReceivedShare) }) + r.Route("/pending", func(r chi.Router) { + r.Post("/", func(w http.ResponseWriter, r *http.Request) { + w.WriteHeader(http.StatusMethodNotAllowed) + }) + r.Delete("/", sharesHandler.ReceivedShareNotFound) + r.Put("/", sharesHandler.ReceivedShareNotFound) + }) r.Route("/remote_shares", func(r chi.Router) { r.Get("/", sharesHandler.ListFederatedShares) r.Get("/{shareid}", sharesHandler.GetFederatedShare) diff --git a/vendor/github.com/opencloud-eu/reva/v2/pkg/share/manager/jsoncs3/jsoncs3.go b/vendor/github.com/opencloud-eu/reva/v2/pkg/share/manager/jsoncs3/jsoncs3.go index eac37873f..ba995639b 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/pkg/share/manager/jsoncs3/jsoncs3.go +++ b/vendor/github.com/opencloud-eu/reva/v2/pkg/share/manager/jsoncs3/jsoncs3.go @@ -296,16 +296,6 @@ func (m *Manager) Share(ctx context.Context, md *provider.ResourceInfo, g *colla user := ctxpkg.ContextMustGetUser(ctx) ts := utils.TSNow() - // do not allow share to myself or the owner if share is for a user - // TODO: should this not already be caught at the gw level? - if g.Grantee.Type == provider.GranteeType_GRANTEE_TYPE_USER && - (utils.UserEqual(g.Grantee.GetUserId(), user.Id) || utils.UserEqual(g.Grantee.GetUserId(), md.Owner)) { - err := errtypes.BadRequest("jsoncs3: owner/creator and grantee are the same") - span.RecordError(err) - span.SetStatus(codes.Error, err.Error()) - return nil, err - } - // check if share already exists. key := &collaboration.ShareKey{ // Owner: md.Owner, owner no longer matters as it belongs to the space @@ -508,17 +498,10 @@ func (m *Manager) Unshare(ctx context.Context, ref *collaboration.ShareReference return err } - user := ctxpkg.ContextMustGetUser(ctx) - s, err := m.get(ctx, ref) if err != nil { return err } - // TODO allow manager to unshare shares in a space created by other users - if !share.IsCreatedByUser(s, user) { - // TODO why not permission denied? - return errtypes.NotFound(ref.String()) - } return m.removeShare(ctx, s, false) } diff --git a/vendor/github.com/opencloud-eu/reva/v2/pkg/share/manager/memory/memory.go b/vendor/github.com/opencloud-eu/reva/v2/pkg/share/manager/memory/memory.go index 1e7dc7ef2..8ade5926f 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/pkg/share/manager/memory/memory.go +++ b/vendor/github.com/opencloud-eu/reva/v2/pkg/share/manager/memory/memory.go @@ -82,11 +82,6 @@ func (m *manager) Share(ctx context.Context, md *provider.ResourceInfo, g *colla Nanos: uint32(now % 1000000000), } - if g.Grantee.Type == provider.GranteeType_GRANTEE_TYPE_USER && - (utils.UserEqual(g.Grantee.GetUserId(), user.Id) || utils.UserEqual(g.Grantee.GetUserId(), md.Owner)) { - return nil, errtypes.BadRequest("memory: owner/creator and grantee are the same") - } - // check if share already exists. key := &collaboration.ShareKey{ Owner: md.Owner, diff --git a/vendor/github.com/opencloud-eu/reva/v2/pkg/share/share.go b/vendor/github.com/opencloud-eu/reva/v2/pkg/share/share.go index 57e5c8226..904cd4171 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/pkg/share/share.go +++ b/vendor/github.com/opencloud-eu/reva/v2/pkg/share/share.go @@ -136,6 +136,18 @@ func StateFilter(state collaboration.ShareState) *collaboration.Filter { } } +// SpaceRootFilter is an abstraction for filtering shares by whether the shared +// resource is a space root. Pass true to include only space-root shares (space +// membership), false to exclude them (file/folder shares only). +func SpaceRootFilter(spaceRoot bool) *collaboration.Filter { + return &collaboration.Filter{ + Type: collaboration.Filter_TYPE_SPACE_ROOT, + Term: &collaboration.Filter_SpaceRoot{ + SpaceRoot: spaceRoot, + }, + } +} + // IsCreatedByUser checks if the user is the owner or creator of the share. func IsCreatedByUser(share *collaboration.Share, user *userv1beta1.User) bool { return utils.UserEqual(user.Id, share.Owner) || utils.UserEqual(user.Id, share.Creator) @@ -172,6 +184,9 @@ func MatchesFilter(share *collaboration.Share, state collaboration.ShareState, f return share.ResourceId.SpaceId == filter.GetSpaceId() case collaboration.Filter_TYPE_STATE: return state == filter.GetState() + case collaboration.Filter_TYPE_SPACE_ROOT: + isSpaceRoot := share.ResourceId.SpaceId == share.ResourceId.OpaqueId + return isSpaceRoot == filter.GetSpaceRoot() default: return false } diff --git a/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/cache/stat.go b/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/cache/stat.go index 7f56a72ed..af23b3c13 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/cache/stat.go +++ b/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/cache/stat.go @@ -35,7 +35,7 @@ import ( var tracer trace.Tracer func init() { - tracer = otel.Tracer("github.com/opencloud-eu/reva/v2/pkg/storage/cache") + tracer = otel.Tracer("github.com/cs3org/reva/pkg/storage/cache") } // NewStatCache creates a new StatCache diff --git a/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/lookup/lookup.go b/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/lookup/lookup.go index acb7d3d28..d691cdc40 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/lookup/lookup.go +++ b/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/lookup/lookup.go @@ -53,7 +53,7 @@ var _spaceTypePersonal = "personal" var _spaceTypeProject = "project" func init() { - tracer = otel.Tracer("github.com/opencloud-eu/reva/v2/pkg/storage/pkg/decomposedfs/lookup") + tracer = otel.Tracer("github.com/cs3org/reva/pkg/storage/pkg/decomposedfs/lookup") } // IDCache is a cache for node ids diff --git a/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/trashbin/trashbin.go b/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/trashbin/trashbin.go index a4b78d702..e9dd13626 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/trashbin/trashbin.go +++ b/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/trashbin/trashbin.go @@ -50,7 +50,7 @@ var ( ) func init() { - tracer = otel.Tracer("github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/trashbin") + tracer = otel.Tracer("github.com/cs3org/reva/pkg/storage/fs/posix/trashbin") } type Trashbin struct { diff --git a/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/tree/watcher_linux.go b/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/tree/inotifywatcher.go similarity index 98% rename from vendor/github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/tree/watcher_linux.go rename to vendor/github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/tree/inotifywatcher.go index 6ba622712..d5a1b475a 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/tree/watcher_linux.go +++ b/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/tree/inotifywatcher.go @@ -29,12 +29,11 @@ import ( "strings" "time" + "github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/options" + "github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/watcher" "github.com/pablodz/inotifywaitgo/inotifywaitgo" "github.com/rs/zerolog" slogzerolog "github.com/samber/slog-zerolog/v2" - - "github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/options" - "github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/watcher" ) type InotifyWatcher struct { @@ -43,7 +42,7 @@ type InotifyWatcher struct { log *zerolog.Logger } -func NewWatcher(tree *Tree, o *options.Options, log *zerolog.Logger) (*InotifyWatcher, error) { +func NewInotifyWatcher(tree *Tree, o *options.Options, log *zerolog.Logger) (*InotifyWatcher, error) { return &InotifyWatcher{ tree: tree, options: o, diff --git a/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/tree/inotifywatcher_default.go b/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/tree/inotifywatcher_default.go new file mode 100644 index 000000000..ebe5019a2 --- /dev/null +++ b/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/tree/inotifywatcher_default.go @@ -0,0 +1,23 @@ +//go:build !linux + +// Copyright 2025 OpenCloud GmbH +// SPDX-License-Identifier: Apache-2.0 + +package tree + +import ( + "github.com/opencloud-eu/reva/v2/pkg/errtypes" + "github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/options" + "github.com/rs/zerolog" +) + +// NullWatcher is a dummy watcher that does nothing +type NullWatcher struct{} + +// Watch does nothing +func (*NullWatcher) Watch(path string) {} + +// NewInotifyWatcher returns a new inotify watcher +func NewInotifyWatcher(_ *Tree, _ *options.Options, _ *zerolog.Logger) (*NullWatcher, error) { + return nil, errtypes.NotSupported("inotify watcher is not supported on this platform") +} diff --git a/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/tree/tree.go b/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/tree/tree.go index 84b8b84e6..7a36f95e6 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/tree/tree.go +++ b/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/tree/tree.go @@ -68,7 +68,7 @@ var ( ) func init() { - tracer = otel.Tracer("github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/tree") + tracer = otel.Tracer("github.com/cs3org/reva/pkg/storage/pkg/decomposedfs/tree") } type Watcher interface { @@ -160,7 +160,7 @@ func New(lu node.PathLookup, bs node.Blobstore, um usermapper.Mapper, trashbin * return nil, err } default: - t.watcher, err = NewWatcher(t, o, log) + t.watcher, err = NewInotifyWatcher(t, o, log) if err != nil { return nil, err } @@ -360,9 +360,6 @@ func (t *Tree) CreateDir(ctx context.Context, n *node.Node) (err error) { // Move replaces the target with the source func (t *Tree) Move(ctx context.Context, oldNode *node.Node, newNode *node.Node) (err error) { - ctx, span := tracer.Start(ctx, "Move") - defer span.End() - if oldNode.SpaceID != newNode.SpaceID { // WebDAV RFC https://www.rfc-editor.org/rfc/rfc4918#section-9.9.4 says to use // > 502 (Bad Gateway) - This may occur when the destination is on another @@ -385,7 +382,6 @@ func (t *Tree) Move(ctx context.Context, oldNode *node.Node, newNode *node.Node) newNode.ID = oldNode.ID } - _, subspan := tracer.Start(ctx, "os.Rename") // rename node err = os.Rename( filepath.Join(oldParent, oldNode.Name), @@ -394,9 +390,7 @@ func (t *Tree) Move(ctx context.Context, oldNode *node.Node, newNode *node.Node) if err != nil { return errors.Wrap(err, "posixfs: could not move child") } - subspan.End() - _, subspan = tracer.Start(ctx, "update id cache and attributes") // update the id cache // invalidate old tree err = t.lookup.IDCache.DeleteByPath(ctx, filepath.Join(oldNode.ParentPath(), oldNode.Name)) @@ -415,9 +409,6 @@ func (t *Tree) Move(ctx context.Context, oldNode *node.Node, newNode *node.Node) return errors.Wrap(err, "posixfs: could not update node attributes") } - subspan.End() - - _, subspan = tracer.Start(ctx, "warmup id cache for moved subtree") // update id cache for the moved subtree. if oldNode.IsDir(ctx) { err = t.WarmupIDCache(filepath.Join(newNode.ParentPath(), newNode.Name), false, false) @@ -425,7 +416,6 @@ func (t *Tree) Move(ctx context.Context, oldNode *node.Node, newNode *node.Node) return err } } - subspan.End() // the size diff is the current treesize or blobsize of the old/source node var sizeDiff int64 @@ -439,7 +429,6 @@ func (t *Tree) Move(ctx context.Context, oldNode *node.Node, newNode *node.Node) sizeDiff = oldNode.Blobsize } - _, subspan = tracer.Start(ctx, "propagate size changes") err = t.Propagate(ctx, oldNode, -sizeDiff) if err != nil { return errors.Wrap(err, "posixfs: Move: could not propagate old node") @@ -448,7 +437,6 @@ func (t *Tree) Move(ctx context.Context, oldNode *node.Node, newNode *node.Node) if err != nil { return errors.Wrap(err, "posixfs: Move: could not propagate new node") } - subspan.End() return nil } diff --git a/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/tree/watch.go b/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/tree/watch.go deleted file mode 100644 index a609f08f2..000000000 --- a/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/tree/watch.go +++ /dev/null @@ -1,13 +0,0 @@ -package tree - -import ( - "github.com/opencloud-eu/reva/v2/pkg/errtypes" -) - -var ErrUnsupportedWatcher = errtypes.NotSupported("watching the filesystem is not supported on this platform") - -// NoopWatcher is a watcher that does nothing -type NoopWatcher struct{} - -// Watch does nothing -func (*NoopWatcher) Watch(_ string) {} diff --git a/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/tree/watcher_darwin.go b/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/tree/watcher_darwin.go deleted file mode 100644 index ec16106e1..000000000 --- a/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/tree/watcher_darwin.go +++ /dev/null @@ -1,226 +0,0 @@ -//go:build darwin && experimental_watchfs_darwin - -package tree - -import ( - "io/fs" - "os" - "path/filepath" - "strings" - "sync" - - "github.com/fsnotify/fsnotify" - "github.com/rs/zerolog" - - "github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/options" - "github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/watcher" -) - -// FSnotifyWatcher fills the gap with fsnotify on Darwin, be careful with its limitations. -// The main reason for its existence is to provide a working watcher on Darwin for development and testing purposes. -type FSnotifyWatcher struct { - tree *Tree - options *options.Options - log *zerolog.Logger - - mu sync.Mutex - watched map[string]struct{} -} - -// NewWatcher creates a new FSnotifyWatcher which implements the Watcher interface for Darwin using fsnotify. -func NewWatcher(tree *Tree, o *options.Options, log *zerolog.Logger) (*FSnotifyWatcher, error) { - log.Warn().Msg("fsnotify watcher on darwin has limitations and may not work as expected in all scenarios, not recommended for production use") - - return &FSnotifyWatcher{ - tree: tree, - options: o, - log: log, - watched: make(map[string]struct{}), - }, nil -} - -// add takes care of adding watches for root and its subpaths. -func (w *FSnotifyWatcher) add(fsWatcher *fsnotify.Watcher, root string) error { - // Check if the root is ignored before walking the tree - if isPathIgnored(w.tree, root) { - return nil - } - - return filepath.WalkDir(root, func(p string, d fs.DirEntry, err error) error { - if err != nil { - return err - } - - // skip ignored paths or files - if isPathIgnored(w.tree, p) || !d.IsDir() { - return nil - } - - w.mu.Lock() - defer w.mu.Unlock() - - // path is known, skip - if _, ok := w.watched[p]; ok { - return nil - } - - if err := fsWatcher.Add(p); err != nil { - return err - } - - w.watched[p] = struct{}{} - - return nil - }) -} - -// remove takes care of removing watches for root and its subpaths. -func (w *FSnotifyWatcher) remove(fsWatcher *fsnotify.Watcher, root string) { - w.mu.Lock() - defer w.mu.Unlock() - - for p := range w.watched { - if p == root || isSubpath(root, p) { - if err := fsWatcher.Remove(p); err != nil { - w.log.Debug().Err(err).Str("path", p).Msg("failed to remove watch") - } - - delete(w.watched, p) - } - } -} - -// handleEvent supervises the handling of fsnotify events. -func (w *FSnotifyWatcher) handleEvent(fsWatcher *fsnotify.Watcher, event fsnotify.Event) error { - isCreate := event.Op&fsnotify.Create != 0 - isRemove := event.Op&fsnotify.Remove != 0 - isRename := event.Op&fsnotify.Rename != 0 - isWrite := event.Op&fsnotify.Write != 0 - - isKnownEvent := isCreate || isRemove || isRename || isWrite - isIgnored := isPathIgnored(w.tree, event.Name) - - // filter out unwanted events - if isIgnored || !isKnownEvent { - return nil - } - - st, statErr := os.Stat(event.Name) - exists := statErr == nil - isDir := exists && st.IsDir() - - switch { - case isRename: - if exists { - if isDir { - _ = w.add(fsWatcher, event.Name) - } - - return w.tree.Scan(event.Name, watcher.ActionMove, isDir) - } - - w.remove(fsWatcher, event.Name) - return w.tree.Scan(event.Name, watcher.ActionMoveFrom, false) - case isRemove: - w.remove(fsWatcher, event.Name) - return w.tree.Scan(event.Name, watcher.ActionDelete, false) - - case isCreate: - if exists { - if isDir { - _ = w.add(fsWatcher, event.Name) - } - - return w.tree.Scan(event.Name, watcher.ActionCreate, isDir) - } - - w.remove(fsWatcher, event.Name) - return w.tree.Scan(event.Name, watcher.ActionMoveFrom, false) - case isWrite: - if exists { - return w.tree.Scan(event.Name, watcher.ActionUpdate, isDir) - } - default: - w.log.Warn().Interface("event", event).Msg("unhandled event") - } - - return nil -} - -// Watch starts watching the given path for changes. -func (w *FSnotifyWatcher) Watch(path string) { - fsWatcher, err := fsnotify.NewWatcher() - if err != nil { - w.log.Error().Err(err).Msg("failed to create watcher") - return - } - defer func() { _ = fsWatcher.Close() }() - - if w.options.InotifyStatsFrequency > 0 { - w.log.Debug().Str("watcher", "not implemented on darwin").Msg("fsnotify stats") - } - - go func() { - for { - select { - case event, ok := <-fsWatcher.Events: - if !ok { - return - } - - if err := w.handleEvent(fsWatcher, event); err != nil { - w.log.Error().Err(err).Str("path", event.Name).Msg("error scanning file") - } - case err, ok := <-fsWatcher.Errors: - if !ok { - return - } - - w.log.Error().Err(err).Msg("fsnotify error") - } - } - }() - - base := filepath.Join(path, "users") - if err := w.add(fsWatcher, base); err != nil { - w.log.Error().Err(err).Str("path", base).Msg("failed to add initial watches") - } - - <-make(chan struct{}) -} - -// isSubpath checks if p is a subpath of root -func isSubpath(root, p string) bool { - r, err := filepath.Abs(root) - if err != nil { - r = filepath.Clean(root) - } - - pp, err := filepath.Abs(p) - if err != nil { - pp = filepath.Clean(p) - } - - rel, err := filepath.Rel(r, pp) - if err != nil { - return false - } - - return rel != "." && !strings.HasPrefix(rel, "..") -} - -// isIgnored checks if the path is ignored by its tree. -func isPathIgnored(tree *Tree, path string) bool { - - isLockFile := isLockFile(path) - isTrash := isTrash(path) - isUpload := tree.isUpload(path) - isInternal := tree.isInternal(path) - - // ask the tree if the path is internal or ignored - return path == "" || - isLockFile || - isTrash || - isUpload || - isInternal -} diff --git a/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/tree/watcher_others.go b/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/tree/watcher_others.go deleted file mode 100644 index 028d71fae..000000000 --- a/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/tree/watcher_others.go +++ /dev/null @@ -1,17 +0,0 @@ -//go:build !linux && (!darwin || !experimental_watchfs_darwin) - -// Copyright 2025 OpenCloud GmbH -// SPDX-License-Identifier: Apache-2.0 - -package tree - -import ( - "github.com/rs/zerolog" - - "github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/options" -) - -// NewWatcher returns a NoopWatcher on unsupported platforms -func NewWatcher(_ *Tree, _ *options.Options, _ *zerolog.Logger) (*NoopWatcher, error) { - return nil, ErrUnsupportedWatcher -} diff --git a/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/pkg/decomposedfs/decomposedfs.go b/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/pkg/decomposedfs/decomposedfs.go index f2fb19cbb..a828d4524 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/pkg/decomposedfs/decomposedfs.go +++ b/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/pkg/decomposedfs/decomposedfs.go @@ -86,7 +86,7 @@ var ( ) func init() { - tracer = otel.Tracer("github.com/opencloud-eu/reva/v2/pkg/storage/pkg/decomposedfs") + tracer = otel.Tracer("github.com/cs3org/reva/pkg/storage/pkg/decomposedfs") } // Session is the interface that DecomposedfsSession implements. By combining tus.Upload, diff --git a/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/pkg/decomposedfs/lookup/lookup.go b/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/pkg/decomposedfs/lookup/lookup.go index 80a364f73..3ecf9df72 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/pkg/decomposedfs/lookup/lookup.go +++ b/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/pkg/decomposedfs/lookup/lookup.go @@ -48,7 +48,7 @@ const ( ) func init() { - tracer = otel.Tracer("github.com/opencloud-eu/reva/v2/pkg/storage/utils/decomposedfs/lookup") + tracer = otel.Tracer("github.com/cs3org/reva/pkg/storage/utils/decomposedfs/lookup") } // Lookup implements transformations from filepath to node and back diff --git a/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/pkg/decomposedfs/metadata/hybrid_backend.go b/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/pkg/decomposedfs/metadata/hybrid_backend.go index c4bfe064f..d84851c11 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/pkg/decomposedfs/metadata/hybrid_backend.go +++ b/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/pkg/decomposedfs/metadata/hybrid_backend.go @@ -153,10 +153,6 @@ func (b HybridBackend) getAll(ctx context.Context, n MetadataNode, skipCache, sk } if len(attrNames) == 0 { - err = b.metaCache.PushToCache(b.cacheKey(n), attribs) - if err != nil { - return nil, err - } return attribs, nil } @@ -183,9 +179,6 @@ func (b HybridBackend) getAll(ctx context.Context, n MetadataNode, skipCache, sk // merge the attributes from the offload file offloaded, err := xattr.Get(path, _metadataOffloadedAttr) - if err != nil && !IsAttrUnset(err) { - return nil, err - } if !skipOffloaded && err == nil && string(offloaded) == "1" { msgpackAttribs := map[string][]byte{} msgBytes, err := os.ReadFile(b.MetadataPath(n)) @@ -315,9 +308,16 @@ func (b HybridBackend) SetMultiple(ctx context.Context, n MetadataNode, attribs return fmt.Errorf("failed to set %d/%d xattrs: %w", xerrs, total, xerr) } - // Update the cache with the new values - _, err = b.getAll(ctx, n, true, false, false) - return err + attribs, err = b.getAll(ctx, n, true, false, false) + if err != nil { + return err + } + err = b.metaCache.PushToCache(b.cacheKey(n), attribs) + if err != nil { + return err + } + + return nil } func (b HybridBackend) offloadMetadata(ctx context.Context, n MetadataNode) error { @@ -439,9 +439,11 @@ func (b HybridBackend) Remove(ctx context.Context, n MetadataNode, key string, a } } - // Update the cache with the new values - _, err := b.getAll(ctx, n, true, false, false) - return err + attribs, err := b.getAll(ctx, n, true, false, false) + if err != nil { + return err + } + return b.metaCache.PushToCache(b.cacheKey(n), attribs) } // IsMetaFile returns whether the given path represents a meta file @@ -453,10 +455,15 @@ func (b HybridBackend) Purge(ctx context.Context, n MetadataNode) error { _, err := os.Stat(path) if err == nil { attribs, err := b.getAll(ctx, n, true, false, true) - if err == nil { - for attr := range attribs { - if strings.HasPrefix(attr, prefixes.OcPrefix) { - _ = xattr.Remove(path, attr) + if err != nil { + return err + } + + for attr := range attribs { + if strings.HasPrefix(attr, prefixes.OcPrefix) { + err := xattr.Remove(path, attr) + if err != nil { + return err } } } diff --git a/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/pkg/decomposedfs/metadata/metadata.go b/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/pkg/decomposedfs/metadata/metadata.go index b60b19df4..1350b6b5a 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/pkg/decomposedfs/metadata/metadata.go +++ b/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/pkg/decomposedfs/metadata/metadata.go @@ -31,7 +31,7 @@ import ( var tracer trace.Tracer func init() { - tracer = otel.Tracer("github.com/opencloud-eu/reva/v2/pkg/storage/utils/decomposedfs/metadata") + tracer = otel.Tracer("github.com/cs3org/reva/pkg/storage/utils/decomposedfs/metadata") } var errUnconfiguredError = errors.New("no metadata backend configured. Bailing out") diff --git a/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/pkg/decomposedfs/node/node.go b/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/pkg/decomposedfs/node/node.go index 810cc2362..1b05a0205 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/pkg/decomposedfs/node/node.go +++ b/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/pkg/decomposedfs/node/node.go @@ -58,7 +58,7 @@ import ( var tracer trace.Tracer func init() { - tracer = otel.Tracer("github.com/opencloud-eu/reva/v2/pkg/storage/utils/decomposedfs/node") + tracer = otel.Tracer("github.com/cs3org/reva/pkg/storage/utils/decomposedfs/node") } // Define keys and values used in the node metadata diff --git a/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/pkg/decomposedfs/permissions/spacepermissions.go b/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/pkg/decomposedfs/permissions/spacepermissions.go index 82a093710..88c52f123 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/pkg/decomposedfs/permissions/spacepermissions.go +++ b/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/pkg/decomposedfs/permissions/spacepermissions.go @@ -21,7 +21,7 @@ var ( ) func init() { - tracer = otel.Tracer("github.com/opencloud-eu/reva/v2/pkg/storage/utils/decomposedfs/permissions") + tracer = otel.Tracer("github.com/cs3org/reva/pkg/storage/utils/decomposedfs/permissions") } const ( diff --git a/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/pkg/decomposedfs/tree/propagator/propagator.go b/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/pkg/decomposedfs/tree/propagator/propagator.go index 9509357f0..dd2e9c24c 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/pkg/decomposedfs/tree/propagator/propagator.go +++ b/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/pkg/decomposedfs/tree/propagator/propagator.go @@ -38,7 +38,7 @@ import ( var tracer trace.Tracer func init() { - tracer = otel.Tracer("github.com/opencloud-eu/reva/v2/pkg/storage/utils/decomposedfs/tree/propagator") + tracer = otel.Tracer("github.com/cs3org/reva/pkg/storage/utils/decomposedfs/tree/propagator") } type Propagator interface { diff --git a/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/pkg/decomposedfs/tree/tree.go b/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/pkg/decomposedfs/tree/tree.go index 47d6ab058..d4787aa5e 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/pkg/decomposedfs/tree/tree.go +++ b/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/pkg/decomposedfs/tree/tree.go @@ -53,7 +53,7 @@ import ( var tracer trace.Tracer func init() { - tracer = otel.Tracer("github.com/opencloud-eu/reva/v2/pkg/storage/utils/decomposedfs/tree") + tracer = otel.Tracer("github.com/cs3org/reva/pkg/storage/utils/decomposedfs/tree") } // Tree manages a hierarchical tree diff --git a/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/pkg/decomposedfs/upload/upload.go b/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/pkg/decomposedfs/upload/upload.go index 3a276c767..db5065b77 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/pkg/decomposedfs/upload/upload.go +++ b/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/pkg/decomposedfs/upload/upload.go @@ -57,7 +57,7 @@ var ( ) func init() { - tracer = otel.Tracer("github.com/opencloud-eu/reva/v2/pkg/storage/utils/decomposedfs/upload") + tracer = otel.Tracer("github.com/cs3org/reva/pkg/storage/utils/decomposedfs/upload") } // WriteChunk writes the stream from the reader to the given offset of the upload diff --git a/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/utils/metadata/cs3.go b/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/utils/metadata/cs3.go index b9616148f..20d678a4b 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/utils/metadata/cs3.go +++ b/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/utils/metadata/cs3.go @@ -49,7 +49,7 @@ import ( var tracer trace.Tracer func init() { - tracer = otel.Tracer("github.com/opencloud-eu/reva/v2/pkg/storage/utils/metadata") + tracer = otel.Tracer("github.com/cs3org/reva/pkg/storage/utils/metadata") } // CS3 represents a metadata storage with a cs3 storage backend diff --git a/vendor/github.com/opencloud-eu/reva/v2/pkg/utils/utils.go b/vendor/github.com/opencloud-eu/reva/v2/pkg/utils/utils.go index c10313687..d2f3e4cd1 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/pkg/utils/utils.go +++ b/vendor/github.com/opencloud-eu/reva/v2/pkg/utils/utils.go @@ -470,6 +470,16 @@ func ExistsInOpaque(o *types.Opaque, key string) bool { return ok } +// SpaceGrantOpaque returns an Opaque with the "spacegrant" key set, which +// signals to storage and event middleware that a grant targets a space root. +func SpaceGrantOpaque() *types.Opaque { + return &types.Opaque{ + Map: map[string]*types.OpaqueEntry{ + "spacegrant": {}, + }, + } +} + // MergeOpaques will merge the opaques. If a key exists in both opaques // the values from the first opaque will be taken func MergeOpaques(o *types.Opaque, p *types.Opaque) *types.Opaque { diff --git a/vendor/github.com/opencloud-eu/reva/v2/tests/cs3mocks/mocks/SpacesAPIClient.go b/vendor/github.com/opencloud-eu/reva/v2/tests/cs3mocks/mocks/SpacesAPIClient.go new file mode 100644 index 000000000..250a04d5e --- /dev/null +++ b/vendor/github.com/opencloud-eu/reva/v2/tests/cs3mocks/mocks/SpacesAPIClient.go @@ -0,0 +1,350 @@ +// Copyright 2018-2022 CERN +// +// Licensed under the Apache License, Version 2.0 (the "License"); +// you may not use this file except in compliance with the License. +// You may obtain a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, +// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +// See the License for the specific language governing permissions and +// limitations under the License. +// +// In applying this license, CERN does not waive the privileges and immunities +// granted to it by virtue of its status as an Intergovernmental Organization +// or submit itself to any jurisdiction. + +// Code generated by mockery v2.53.2. DO NOT EDIT. + +package mocks + +import ( + context "context" + + grpc "google.golang.org/grpc" + + mock "github.com/stretchr/testify/mock" + + providerv1beta1 "github.com/cs3org/go-cs3apis/cs3/storage/provider/v1beta1" +) + +// SpacesAPIClient is an autogenerated mock type for the SpacesAPIClient type +type SpacesAPIClient struct { + mock.Mock +} + +type SpacesAPIClient_Expecter struct { + mock *mock.Mock +} + +func (_m *SpacesAPIClient) EXPECT() *SpacesAPIClient_Expecter { + return &SpacesAPIClient_Expecter{mock: &_m.Mock} +} + +// CreateStorageSpace provides a mock function with given fields: ctx, in, opts +func (_m *SpacesAPIClient) CreateStorageSpace(ctx context.Context, in *providerv1beta1.CreateStorageSpaceRequest, opts ...grpc.CallOption) (*providerv1beta1.CreateStorageSpaceResponse, error) { + var tmpRet mock.Arguments + if len(opts) > 0 { + tmpRet = _m.Called(ctx, in, opts) + } else { + tmpRet = _m.Called(ctx, in) + } + ret := tmpRet + + if len(ret) == 0 { + panic("no return value specified for CreateStorageSpace") + } + + var r0 *providerv1beta1.CreateStorageSpaceResponse + var r1 error + if rf, ok := ret.Get(0).(func(context.Context, *providerv1beta1.CreateStorageSpaceRequest, ...grpc.CallOption) (*providerv1beta1.CreateStorageSpaceResponse, error)); ok { + return rf(ctx, in, opts...) + } + if rf, ok := ret.Get(0).(func(context.Context, *providerv1beta1.CreateStorageSpaceRequest, ...grpc.CallOption) *providerv1beta1.CreateStorageSpaceResponse); ok { + r0 = rf(ctx, in, opts...) + } else { + if ret.Get(0) != nil { + r0 = ret.Get(0).(*providerv1beta1.CreateStorageSpaceResponse) + } + } + + if rf, ok := ret.Get(1).(func(context.Context, *providerv1beta1.CreateStorageSpaceRequest, ...grpc.CallOption) error); ok { + r1 = rf(ctx, in, opts...) + } else { + r1 = ret.Error(1) + } + + return r0, r1 +} + +// SpacesAPIClient_CreateStorageSpace_Call is a *mock.Call that shadows Run/Return methods with type explicit version for method 'CreateStorageSpace' +type SpacesAPIClient_CreateStorageSpace_Call struct { + *mock.Call +} + +// CreateStorageSpace is a helper method to define mock.On call +// - ctx context.Context +// - in *providerv1beta1.CreateStorageSpaceRequest +// - opts ...grpc.CallOption +func (_e *SpacesAPIClient_Expecter) CreateStorageSpace(ctx interface{}, in interface{}, opts ...interface{}) *SpacesAPIClient_CreateStorageSpace_Call { + return &SpacesAPIClient_CreateStorageSpace_Call{Call: _e.mock.On("CreateStorageSpace", + append([]interface{}{ctx, in}, opts...)...)} +} + +func (_c *SpacesAPIClient_CreateStorageSpace_Call) Run(run func(ctx context.Context, in *providerv1beta1.CreateStorageSpaceRequest, opts ...grpc.CallOption)) *SpacesAPIClient_CreateStorageSpace_Call { + _c.Call.Run(func(args mock.Arguments) { + variadicArgs := make([]grpc.CallOption, len(args)-2) + for i, a := range args[2:] { + if a != nil { + variadicArgs[i] = a.(grpc.CallOption) + } + } + run(args[0].(context.Context), args[1].(*providerv1beta1.CreateStorageSpaceRequest), variadicArgs...) + }) + return _c +} + +func (_c *SpacesAPIClient_CreateStorageSpace_Call) Return(_a0 *providerv1beta1.CreateStorageSpaceResponse, _a1 error) *SpacesAPIClient_CreateStorageSpace_Call { + _c.Call.Return(_a0, _a1) + return _c +} + +func (_c *SpacesAPIClient_CreateStorageSpace_Call) RunAndReturn(run func(context.Context, *providerv1beta1.CreateStorageSpaceRequest, ...grpc.CallOption) (*providerv1beta1.CreateStorageSpaceResponse, error)) *SpacesAPIClient_CreateStorageSpace_Call { + _c.Call.Return(run) + return _c +} + +// DeleteStorageSpace provides a mock function with given fields: ctx, in, opts +func (_m *SpacesAPIClient) DeleteStorageSpace(ctx context.Context, in *providerv1beta1.DeleteStorageSpaceRequest, opts ...grpc.CallOption) (*providerv1beta1.DeleteStorageSpaceResponse, error) { + var tmpRet mock.Arguments + if len(opts) > 0 { + tmpRet = _m.Called(ctx, in, opts) + } else { + tmpRet = _m.Called(ctx, in) + } + ret := tmpRet + + if len(ret) == 0 { + panic("no return value specified for DeleteStorageSpace") + } + + var r0 *providerv1beta1.DeleteStorageSpaceResponse + var r1 error + if rf, ok := ret.Get(0).(func(context.Context, *providerv1beta1.DeleteStorageSpaceRequest, ...grpc.CallOption) (*providerv1beta1.DeleteStorageSpaceResponse, error)); ok { + return rf(ctx, in, opts...) + } + if rf, ok := ret.Get(0).(func(context.Context, *providerv1beta1.DeleteStorageSpaceRequest, ...grpc.CallOption) *providerv1beta1.DeleteStorageSpaceResponse); ok { + r0 = rf(ctx, in, opts...) + } else { + if ret.Get(0) != nil { + r0 = ret.Get(0).(*providerv1beta1.DeleteStorageSpaceResponse) + } + } + + if rf, ok := ret.Get(1).(func(context.Context, *providerv1beta1.DeleteStorageSpaceRequest, ...grpc.CallOption) error); ok { + r1 = rf(ctx, in, opts...) + } else { + r1 = ret.Error(1) + } + + return r0, r1 +} + +// SpacesAPIClient_DeleteStorageSpace_Call is a *mock.Call that shadows Run/Return methods with type explicit version for method 'DeleteStorageSpace' +type SpacesAPIClient_DeleteStorageSpace_Call struct { + *mock.Call +} + +// DeleteStorageSpace is a helper method to define mock.On call +// - ctx context.Context +// - in *providerv1beta1.DeleteStorageSpaceRequest +// - opts ...grpc.CallOption +func (_e *SpacesAPIClient_Expecter) DeleteStorageSpace(ctx interface{}, in interface{}, opts ...interface{}) *SpacesAPIClient_DeleteStorageSpace_Call { + return &SpacesAPIClient_DeleteStorageSpace_Call{Call: _e.mock.On("DeleteStorageSpace", + append([]interface{}{ctx, in}, opts...)...)} +} + +func (_c *SpacesAPIClient_DeleteStorageSpace_Call) Run(run func(ctx context.Context, in *providerv1beta1.DeleteStorageSpaceRequest, opts ...grpc.CallOption)) *SpacesAPIClient_DeleteStorageSpace_Call { + _c.Call.Run(func(args mock.Arguments) { + variadicArgs := make([]grpc.CallOption, len(args)-2) + for i, a := range args[2:] { + if a != nil { + variadicArgs[i] = a.(grpc.CallOption) + } + } + run(args[0].(context.Context), args[1].(*providerv1beta1.DeleteStorageSpaceRequest), variadicArgs...) + }) + return _c +} + +func (_c *SpacesAPIClient_DeleteStorageSpace_Call) Return(_a0 *providerv1beta1.DeleteStorageSpaceResponse, _a1 error) *SpacesAPIClient_DeleteStorageSpace_Call { + _c.Call.Return(_a0, _a1) + return _c +} + +func (_c *SpacesAPIClient_DeleteStorageSpace_Call) RunAndReturn(run func(context.Context, *providerv1beta1.DeleteStorageSpaceRequest, ...grpc.CallOption) (*providerv1beta1.DeleteStorageSpaceResponse, error)) *SpacesAPIClient_DeleteStorageSpace_Call { + _c.Call.Return(run) + return _c +} + +// ListStorageSpaces provides a mock function with given fields: ctx, in, opts +func (_m *SpacesAPIClient) ListStorageSpaces(ctx context.Context, in *providerv1beta1.ListStorageSpacesRequest, opts ...grpc.CallOption) (*providerv1beta1.ListStorageSpacesResponse, error) { + var tmpRet mock.Arguments + if len(opts) > 0 { + tmpRet = _m.Called(ctx, in, opts) + } else { + tmpRet = _m.Called(ctx, in) + } + ret := tmpRet + + if len(ret) == 0 { + panic("no return value specified for ListStorageSpaces") + } + + var r0 *providerv1beta1.ListStorageSpacesResponse + var r1 error + if rf, ok := ret.Get(0).(func(context.Context, *providerv1beta1.ListStorageSpacesRequest, ...grpc.CallOption) (*providerv1beta1.ListStorageSpacesResponse, error)); ok { + return rf(ctx, in, opts...) + } + if rf, ok := ret.Get(0).(func(context.Context, *providerv1beta1.ListStorageSpacesRequest, ...grpc.CallOption) *providerv1beta1.ListStorageSpacesResponse); ok { + r0 = rf(ctx, in, opts...) + } else { + if ret.Get(0) != nil { + r0 = ret.Get(0).(*providerv1beta1.ListStorageSpacesResponse) + } + } + + if rf, ok := ret.Get(1).(func(context.Context, *providerv1beta1.ListStorageSpacesRequest, ...grpc.CallOption) error); ok { + r1 = rf(ctx, in, opts...) + } else { + r1 = ret.Error(1) + } + + return r0, r1 +} + +// SpacesAPIClient_ListStorageSpaces_Call is a *mock.Call that shadows Run/Return methods with type explicit version for method 'ListStorageSpaces' +type SpacesAPIClient_ListStorageSpaces_Call struct { + *mock.Call +} + +// ListStorageSpaces is a helper method to define mock.On call +// - ctx context.Context +// - in *providerv1beta1.ListStorageSpacesRequest +// - opts ...grpc.CallOption +func (_e *SpacesAPIClient_Expecter) ListStorageSpaces(ctx interface{}, in interface{}, opts ...interface{}) *SpacesAPIClient_ListStorageSpaces_Call { + return &SpacesAPIClient_ListStorageSpaces_Call{Call: _e.mock.On("ListStorageSpaces", + append([]interface{}{ctx, in}, opts...)...)} +} + +func (_c *SpacesAPIClient_ListStorageSpaces_Call) Run(run func(ctx context.Context, in *providerv1beta1.ListStorageSpacesRequest, opts ...grpc.CallOption)) *SpacesAPIClient_ListStorageSpaces_Call { + _c.Call.Run(func(args mock.Arguments) { + variadicArgs := make([]grpc.CallOption, len(args)-2) + for i, a := range args[2:] { + if a != nil { + variadicArgs[i] = a.(grpc.CallOption) + } + } + run(args[0].(context.Context), args[1].(*providerv1beta1.ListStorageSpacesRequest), variadicArgs...) + }) + return _c +} + +func (_c *SpacesAPIClient_ListStorageSpaces_Call) Return(_a0 *providerv1beta1.ListStorageSpacesResponse, _a1 error) *SpacesAPIClient_ListStorageSpaces_Call { + _c.Call.Return(_a0, _a1) + return _c +} + +func (_c *SpacesAPIClient_ListStorageSpaces_Call) RunAndReturn(run func(context.Context, *providerv1beta1.ListStorageSpacesRequest, ...grpc.CallOption) (*providerv1beta1.ListStorageSpacesResponse, error)) *SpacesAPIClient_ListStorageSpaces_Call { + _c.Call.Return(run) + return _c +} + +// UpdateStorageSpace provides a mock function with given fields: ctx, in, opts +func (_m *SpacesAPIClient) UpdateStorageSpace(ctx context.Context, in *providerv1beta1.UpdateStorageSpaceRequest, opts ...grpc.CallOption) (*providerv1beta1.UpdateStorageSpaceResponse, error) { + var tmpRet mock.Arguments + if len(opts) > 0 { + tmpRet = _m.Called(ctx, in, opts) + } else { + tmpRet = _m.Called(ctx, in) + } + ret := tmpRet + + if len(ret) == 0 { + panic("no return value specified for UpdateStorageSpace") + } + + var r0 *providerv1beta1.UpdateStorageSpaceResponse + var r1 error + if rf, ok := ret.Get(0).(func(context.Context, *providerv1beta1.UpdateStorageSpaceRequest, ...grpc.CallOption) (*providerv1beta1.UpdateStorageSpaceResponse, error)); ok { + return rf(ctx, in, opts...) + } + if rf, ok := ret.Get(0).(func(context.Context, *providerv1beta1.UpdateStorageSpaceRequest, ...grpc.CallOption) *providerv1beta1.UpdateStorageSpaceResponse); ok { + r0 = rf(ctx, in, opts...) + } else { + if ret.Get(0) != nil { + r0 = ret.Get(0).(*providerv1beta1.UpdateStorageSpaceResponse) + } + } + + if rf, ok := ret.Get(1).(func(context.Context, *providerv1beta1.UpdateStorageSpaceRequest, ...grpc.CallOption) error); ok { + r1 = rf(ctx, in, opts...) + } else { + r1 = ret.Error(1) + } + + return r0, r1 +} + +// SpacesAPIClient_UpdateStorageSpace_Call is a *mock.Call that shadows Run/Return methods with type explicit version for method 'UpdateStorageSpace' +type SpacesAPIClient_UpdateStorageSpace_Call struct { + *mock.Call +} + +// UpdateStorageSpace is a helper method to define mock.On call +// - ctx context.Context +// - in *providerv1beta1.UpdateStorageSpaceRequest +// - opts ...grpc.CallOption +func (_e *SpacesAPIClient_Expecter) UpdateStorageSpace(ctx interface{}, in interface{}, opts ...interface{}) *SpacesAPIClient_UpdateStorageSpace_Call { + return &SpacesAPIClient_UpdateStorageSpace_Call{Call: _e.mock.On("UpdateStorageSpace", + append([]interface{}{ctx, in}, opts...)...)} +} + +func (_c *SpacesAPIClient_UpdateStorageSpace_Call) Run(run func(ctx context.Context, in *providerv1beta1.UpdateStorageSpaceRequest, opts ...grpc.CallOption)) *SpacesAPIClient_UpdateStorageSpace_Call { + _c.Call.Run(func(args mock.Arguments) { + variadicArgs := make([]grpc.CallOption, len(args)-2) + for i, a := range args[2:] { + if a != nil { + variadicArgs[i] = a.(grpc.CallOption) + } + } + run(args[0].(context.Context), args[1].(*providerv1beta1.UpdateStorageSpaceRequest), variadicArgs...) + }) + return _c +} + +func (_c *SpacesAPIClient_UpdateStorageSpace_Call) Return(_a0 *providerv1beta1.UpdateStorageSpaceResponse, _a1 error) *SpacesAPIClient_UpdateStorageSpace_Call { + _c.Call.Return(_a0, _a1) + return _c +} + +func (_c *SpacesAPIClient_UpdateStorageSpace_Call) RunAndReturn(run func(context.Context, *providerv1beta1.UpdateStorageSpaceRequest, ...grpc.CallOption) (*providerv1beta1.UpdateStorageSpaceResponse, error)) *SpacesAPIClient_UpdateStorageSpace_Call { + _c.Call.Return(run) + return _c +} + +// NewSpacesAPIClient creates a new instance of SpacesAPIClient. It also registers a testing interface on the mock and a cleanup function to assert the mocks expectations. +// The first argument is typically a *testing.T value. +func NewSpacesAPIClient(t interface { + mock.TestingT + Cleanup(func()) +}) *SpacesAPIClient { + mock := &SpacesAPIClient{} + mock.Mock.Test(t) + + t.Cleanup(func() { mock.AssertExpectations(t) }) + + return mock +} diff --git a/vendor/github.com/opencloud-eu/reva/v2/tests/cs3mocks/mocks/StorageRegistryAPIClient.go b/vendor/github.com/opencloud-eu/reva/v2/tests/cs3mocks/mocks/StorageRegistryAPIClient.go new file mode 100644 index 000000000..4c1784137 --- /dev/null +++ b/vendor/github.com/opencloud-eu/reva/v2/tests/cs3mocks/mocks/StorageRegistryAPIClient.go @@ -0,0 +1,277 @@ +// Copyright 2018-2022 CERN +// +// Licensed under the Apache License, Version 2.0 (the "License"); +// you may not use this file except in compliance with the License. +// You may obtain a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, +// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +// See the License for the specific language governing permissions and +// limitations under the License. +// +// In applying this license, CERN does not waive the privileges and immunities +// granted to it by virtue of its status as an Intergovernmental Organization +// or submit itself to any jurisdiction. + +// Code generated by mockery v2.53.2. DO NOT EDIT. + +package mocks + +import ( + context "context" + + grpc "google.golang.org/grpc" + + mock "github.com/stretchr/testify/mock" + + registryv1beta1 "github.com/cs3org/go-cs3apis/cs3/storage/registry/v1beta1" +) + +// StorageRegistryAPIClient is an autogenerated mock type for the StorageRegistryAPIClient type +type StorageRegistryAPIClient struct { + mock.Mock +} + +type StorageRegistryAPIClient_Expecter struct { + mock *mock.Mock +} + +func (_m *StorageRegistryAPIClient) EXPECT() *StorageRegistryAPIClient_Expecter { + return &StorageRegistryAPIClient_Expecter{mock: &_m.Mock} +} + +// GetHome provides a mock function with given fields: ctx, in, opts +func (_m *StorageRegistryAPIClient) GetHome(ctx context.Context, in *registryv1beta1.GetHomeRequest, opts ...grpc.CallOption) (*registryv1beta1.GetHomeResponse, error) { + var tmpRet mock.Arguments + if len(opts) > 0 { + tmpRet = _m.Called(ctx, in, opts) + } else { + tmpRet = _m.Called(ctx, in) + } + ret := tmpRet + + if len(ret) == 0 { + panic("no return value specified for GetHome") + } + + var r0 *registryv1beta1.GetHomeResponse + var r1 error + if rf, ok := ret.Get(0).(func(context.Context, *registryv1beta1.GetHomeRequest, ...grpc.CallOption) (*registryv1beta1.GetHomeResponse, error)); ok { + return rf(ctx, in, opts...) + } + if rf, ok := ret.Get(0).(func(context.Context, *registryv1beta1.GetHomeRequest, ...grpc.CallOption) *registryv1beta1.GetHomeResponse); ok { + r0 = rf(ctx, in, opts...) + } else { + if ret.Get(0) != nil { + r0 = ret.Get(0).(*registryv1beta1.GetHomeResponse) + } + } + + if rf, ok := ret.Get(1).(func(context.Context, *registryv1beta1.GetHomeRequest, ...grpc.CallOption) error); ok { + r1 = rf(ctx, in, opts...) + } else { + r1 = ret.Error(1) + } + + return r0, r1 +} + +// StorageRegistryAPIClient_GetHome_Call is a *mock.Call that shadows Run/Return methods with type explicit version for method 'GetHome' +type StorageRegistryAPIClient_GetHome_Call struct { + *mock.Call +} + +// GetHome is a helper method to define mock.On call +// - ctx context.Context +// - in *registryv1beta1.GetHomeRequest +// - opts ...grpc.CallOption +func (_e *StorageRegistryAPIClient_Expecter) GetHome(ctx interface{}, in interface{}, opts ...interface{}) *StorageRegistryAPIClient_GetHome_Call { + return &StorageRegistryAPIClient_GetHome_Call{Call: _e.mock.On("GetHome", + append([]interface{}{ctx, in}, opts...)...)} +} + +func (_c *StorageRegistryAPIClient_GetHome_Call) Run(run func(ctx context.Context, in *registryv1beta1.GetHomeRequest, opts ...grpc.CallOption)) *StorageRegistryAPIClient_GetHome_Call { + _c.Call.Run(func(args mock.Arguments) { + variadicArgs := make([]grpc.CallOption, len(args)-2) + for i, a := range args[2:] { + if a != nil { + variadicArgs[i] = a.(grpc.CallOption) + } + } + run(args[0].(context.Context), args[1].(*registryv1beta1.GetHomeRequest), variadicArgs...) + }) + return _c +} + +func (_c *StorageRegistryAPIClient_GetHome_Call) Return(_a0 *registryv1beta1.GetHomeResponse, _a1 error) *StorageRegistryAPIClient_GetHome_Call { + _c.Call.Return(_a0, _a1) + return _c +} + +func (_c *StorageRegistryAPIClient_GetHome_Call) RunAndReturn(run func(context.Context, *registryv1beta1.GetHomeRequest, ...grpc.CallOption) (*registryv1beta1.GetHomeResponse, error)) *StorageRegistryAPIClient_GetHome_Call { + _c.Call.Return(run) + return _c +} + +// GetStorageProviders provides a mock function with given fields: ctx, in, opts +func (_m *StorageRegistryAPIClient) GetStorageProviders(ctx context.Context, in *registryv1beta1.GetStorageProvidersRequest, opts ...grpc.CallOption) (*registryv1beta1.GetStorageProvidersResponse, error) { + var tmpRet mock.Arguments + if len(opts) > 0 { + tmpRet = _m.Called(ctx, in, opts) + } else { + tmpRet = _m.Called(ctx, in) + } + ret := tmpRet + + if len(ret) == 0 { + panic("no return value specified for GetStorageProviders") + } + + var r0 *registryv1beta1.GetStorageProvidersResponse + var r1 error + if rf, ok := ret.Get(0).(func(context.Context, *registryv1beta1.GetStorageProvidersRequest, ...grpc.CallOption) (*registryv1beta1.GetStorageProvidersResponse, error)); ok { + return rf(ctx, in, opts...) + } + if rf, ok := ret.Get(0).(func(context.Context, *registryv1beta1.GetStorageProvidersRequest, ...grpc.CallOption) *registryv1beta1.GetStorageProvidersResponse); ok { + r0 = rf(ctx, in, opts...) + } else { + if ret.Get(0) != nil { + r0 = ret.Get(0).(*registryv1beta1.GetStorageProvidersResponse) + } + } + + if rf, ok := ret.Get(1).(func(context.Context, *registryv1beta1.GetStorageProvidersRequest, ...grpc.CallOption) error); ok { + r1 = rf(ctx, in, opts...) + } else { + r1 = ret.Error(1) + } + + return r0, r1 +} + +// StorageRegistryAPIClient_GetStorageProviders_Call is a *mock.Call that shadows Run/Return methods with type explicit version for method 'GetStorageProviders' +type StorageRegistryAPIClient_GetStorageProviders_Call struct { + *mock.Call +} + +// GetStorageProviders is a helper method to define mock.On call +// - ctx context.Context +// - in *registryv1beta1.GetStorageProvidersRequest +// - opts ...grpc.CallOption +func (_e *StorageRegistryAPIClient_Expecter) GetStorageProviders(ctx interface{}, in interface{}, opts ...interface{}) *StorageRegistryAPIClient_GetStorageProviders_Call { + return &StorageRegistryAPIClient_GetStorageProviders_Call{Call: _e.mock.On("GetStorageProviders", + append([]interface{}{ctx, in}, opts...)...)} +} + +func (_c *StorageRegistryAPIClient_GetStorageProviders_Call) Run(run func(ctx context.Context, in *registryv1beta1.GetStorageProvidersRequest, opts ...grpc.CallOption)) *StorageRegistryAPIClient_GetStorageProviders_Call { + _c.Call.Run(func(args mock.Arguments) { + variadicArgs := make([]grpc.CallOption, len(args)-2) + for i, a := range args[2:] { + if a != nil { + variadicArgs[i] = a.(grpc.CallOption) + } + } + run(args[0].(context.Context), args[1].(*registryv1beta1.GetStorageProvidersRequest), variadicArgs...) + }) + return _c +} + +func (_c *StorageRegistryAPIClient_GetStorageProviders_Call) Return(_a0 *registryv1beta1.GetStorageProvidersResponse, _a1 error) *StorageRegistryAPIClient_GetStorageProviders_Call { + _c.Call.Return(_a0, _a1) + return _c +} + +func (_c *StorageRegistryAPIClient_GetStorageProviders_Call) RunAndReturn(run func(context.Context, *registryv1beta1.GetStorageProvidersRequest, ...grpc.CallOption) (*registryv1beta1.GetStorageProvidersResponse, error)) *StorageRegistryAPIClient_GetStorageProviders_Call { + _c.Call.Return(run) + return _c +} + +// ListStorageProviders provides a mock function with given fields: ctx, in, opts +func (_m *StorageRegistryAPIClient) ListStorageProviders(ctx context.Context, in *registryv1beta1.ListStorageProvidersRequest, opts ...grpc.CallOption) (*registryv1beta1.ListStorageProvidersResponse, error) { + var tmpRet mock.Arguments + if len(opts) > 0 { + tmpRet = _m.Called(ctx, in, opts) + } else { + tmpRet = _m.Called(ctx, in) + } + ret := tmpRet + + if len(ret) == 0 { + panic("no return value specified for ListStorageProviders") + } + + var r0 *registryv1beta1.ListStorageProvidersResponse + var r1 error + if rf, ok := ret.Get(0).(func(context.Context, *registryv1beta1.ListStorageProvidersRequest, ...grpc.CallOption) (*registryv1beta1.ListStorageProvidersResponse, error)); ok { + return rf(ctx, in, opts...) + } + if rf, ok := ret.Get(0).(func(context.Context, *registryv1beta1.ListStorageProvidersRequest, ...grpc.CallOption) *registryv1beta1.ListStorageProvidersResponse); ok { + r0 = rf(ctx, in, opts...) + } else { + if ret.Get(0) != nil { + r0 = ret.Get(0).(*registryv1beta1.ListStorageProvidersResponse) + } + } + + if rf, ok := ret.Get(1).(func(context.Context, *registryv1beta1.ListStorageProvidersRequest, ...grpc.CallOption) error); ok { + r1 = rf(ctx, in, opts...) + } else { + r1 = ret.Error(1) + } + + return r0, r1 +} + +// StorageRegistryAPIClient_ListStorageProviders_Call is a *mock.Call that shadows Run/Return methods with type explicit version for method 'ListStorageProviders' +type StorageRegistryAPIClient_ListStorageProviders_Call struct { + *mock.Call +} + +// ListStorageProviders is a helper method to define mock.On call +// - ctx context.Context +// - in *registryv1beta1.ListStorageProvidersRequest +// - opts ...grpc.CallOption +func (_e *StorageRegistryAPIClient_Expecter) ListStorageProviders(ctx interface{}, in interface{}, opts ...interface{}) *StorageRegistryAPIClient_ListStorageProviders_Call { + return &StorageRegistryAPIClient_ListStorageProviders_Call{Call: _e.mock.On("ListStorageProviders", + append([]interface{}{ctx, in}, opts...)...)} +} + +func (_c *StorageRegistryAPIClient_ListStorageProviders_Call) Run(run func(ctx context.Context, in *registryv1beta1.ListStorageProvidersRequest, opts ...grpc.CallOption)) *StorageRegistryAPIClient_ListStorageProviders_Call { + _c.Call.Run(func(args mock.Arguments) { + variadicArgs := make([]grpc.CallOption, len(args)-2) + for i, a := range args[2:] { + if a != nil { + variadicArgs[i] = a.(grpc.CallOption) + } + } + run(args[0].(context.Context), args[1].(*registryv1beta1.ListStorageProvidersRequest), variadicArgs...) + }) + return _c +} + +func (_c *StorageRegistryAPIClient_ListStorageProviders_Call) Return(_a0 *registryv1beta1.ListStorageProvidersResponse, _a1 error) *StorageRegistryAPIClient_ListStorageProviders_Call { + _c.Call.Return(_a0, _a1) + return _c +} + +func (_c *StorageRegistryAPIClient_ListStorageProviders_Call) RunAndReturn(run func(context.Context, *registryv1beta1.ListStorageProvidersRequest, ...grpc.CallOption) (*registryv1beta1.ListStorageProvidersResponse, error)) *StorageRegistryAPIClient_ListStorageProviders_Call { + _c.Call.Return(run) + return _c +} + +// NewStorageRegistryAPIClient creates a new instance of StorageRegistryAPIClient. It also registers a testing interface on the mock and a cleanup function to assert the mocks expectations. +// The first argument is typically a *testing.T value. +func NewStorageRegistryAPIClient(t interface { + mock.TestingT + Cleanup(func()) +}) *StorageRegistryAPIClient { + mock := &StorageRegistryAPIClient{} + mock.Mock.Test(t) + + t.Cleanup(func() { mock.AssertExpectations(t) }) + + return mock +} diff --git a/vendor/modules.txt b/vendor/modules.txt index ef456360a..04317c130 100644 --- a/vendor/modules.txt +++ b/vendor/modules.txt @@ -316,7 +316,7 @@ github.com/crewjam/saml github.com/crewjam/saml/logger github.com/crewjam/saml/samlsp github.com/crewjam/saml/xmlenc -# github.com/cs3org/go-cs3apis v0.0.0-20260407125717-5d69ba49048b +# github.com/cs3org/go-cs3apis v0.0.0-20260422093003-c97949ae7a1d ## explicit; go 1.21 github.com/cs3org/go-cs3apis/cs3/app/provider/v1beta1 github.com/cs3org/go-cs3apis/cs3/app/registry/v1beta1 @@ -1371,7 +1371,7 @@ github.com/opencloud-eu/icap-client # github.com/opencloud-eu/libre-graph-api-go v1.0.8-0.20260310090739-853d972b282d ## explicit; go 1.18 github.com/opencloud-eu/libre-graph-api-go -# github.com/opencloud-eu/reva/v2 v2.43.0 +# github.com/opencloud-eu/reva/v2 v2.42.7-0.20260423074216-11463a55c9a4 ## explicit; go 1.25.0 github.com/opencloud-eu/reva/v2/cmd/revad/internal/grace github.com/opencloud-eu/reva/v2/cmd/revad/runtime From 59bd11d02a69cda4ecaaf8a4a590c1c6eebff685 Mon Sep 17 00:00:00 2001 From: Ralf Haferkamp Date: Mon, 11 May 2026 15:47:58 +0200 Subject: [PATCH 7/9] chore: bump reva --- go.mod | 24 +- go.sum | 48 +- vendor/filippo.io/edwards25519/README.md | 6 +- vendor/filippo.io/edwards25519/doc.go | 6 +- vendor/filippo.io/edwards25519/extra.go | 67 +- vendor/filippo.io/edwards25519/field/fe.go | 34 +- .../filippo.io/edwards25519/field/fe_amd64.go | 3 +- .../filippo.io/edwards25519/field/fe_amd64.s | 203 +- .../edwards25519/field/fe_amd64_noasm.go | 3 +- .../filippo.io/edwards25519/field/fe_arm64.go | 16 - .../filippo.io/edwards25519/field/fe_arm64.s | 42 - .../edwards25519/field/fe_arm64_noasm.go | 12 - .../edwards25519/field/fe_generic.go | 170 +- vendor/filippo.io/edwards25519/pull.sh | 53 + vendor/filippo.io/edwards25519/scalar.go | 27 +- vendor/filippo.io/edwards25519/tables.go | 4 +- .../antithesis-sdk-go/assert/assert.go | 4 +- .../antithesis-sdk-go/internal/sdk_const.go | 2 +- vendor/github.com/go-sql-driver/mysql/AUTHORS | 10 +- .../go-sql-driver/mysql/CHANGELOG.md | 19 +- .../github.com/go-sql-driver/mysql/README.md | 7 +- vendor/github.com/go-sql-driver/mysql/auth.go | 2 +- .../go-sql-driver/mysql/conncheck.go | 1 - .../go-sql-driver/mysql/conncheck_dummy.go | 1 - .../go-sql-driver/mysql/connection.go | 275 +- .../go-sql-driver/mysql/connector.go | 12 +- .../github.com/go-sql-driver/mysql/const.go | 21 +- vendor/github.com/go-sql-driver/mysql/dsn.go | 9 +- .../github.com/go-sql-driver/mysql/fields.go | 38 +- .../github.com/go-sql-driver/mysql/infile.go | 5 +- .../github.com/go-sql-driver/mysql/packets.go | 343 ++- .../github.com/go-sql-driver/mysql/result.go | 6 +- vendor/github.com/go-sql-driver/mysql/rows.go | 10 +- .../go-sql-driver/mysql/statement.go | 34 +- .../github.com/go-sql-driver/mysql/utils.go | 155 +- .../nats-io/nats-server/v2/server/auth.go | 48 +- .../nats-server/v2/server/auth_callout.go | 14 +- .../nats-server/v2/server/avl/seqset.go | 4 +- .../nats-io/nats-server/v2/server/client.go | 313 +- .../nats-io/nats-server/v2/server/const.go | 2 +- .../nats-io/nats-server/v2/server/consumer.go | 669 ++++- .../nats-io/nats-server/v2/server/cron.go | 327 +++ .../nats-io/nats-server/v2/server/errors.json | 212 +- .../nats-io/nats-server/v2/server/events.go | 32 +- .../nats-server/v2/server/feature_flags.go | 130 + .../nats-server/v2/server/filestore.go | 2560 ++++++++++++----- .../nats-io/nats-server/v2/server/gateway.go | 20 +- .../nats-io/nats-server/v2/server/gsl/gsl.go | 60 + .../nats-server/v2/server/jetstream.go | 486 +--- .../nats-server/v2/server/jetstream_api.go | 506 ++-- .../v2/server/jetstream_batching.go | 503 +++- .../v2/server/jetstream_cluster.go | 935 ++++-- .../v2/server/jetstream_errors_generated.go | 300 ++ .../nats-server/v2/server/jetstream_events.go | 14 +- .../v2/server/jetstream_versioning.go | 12 +- .../nats-io/nats-server/v2/server/jwt.go | 58 +- .../nats-io/nats-server/v2/server/leafnode.go | 408 ++- .../nats-io/nats-server/v2/server/log.go | 8 + .../nats-io/nats-server/v2/server/memstore.go | 204 +- .../nats-io/nats-server/v2/server/monitor.go | 162 +- .../nats-io/nats-server/v2/server/mqtt.go | 163 +- .../nats-io/nats-server/v2/server/msgtrace.go | 133 +- .../nats-io/nats-server/v2/server/opts.go | 172 +- .../nats-io/nats-server/v2/server/parser.go | 59 +- .../nats-io/nats-server/v2/server/raft.go | 253 +- .../nats-io/nats-server/v2/server/reload.go | 752 +++-- .../nats-server/v2/server/scheduler.go | 139 +- .../nats-io/nats-server/v2/server/server.go | 43 +- .../nats-io/nats-server/v2/server/store.go | 39 +- .../nats-io/nats-server/v2/server/stream.go | 2137 +++++++++++--- .../nats-io/nats-server/v2/server/sublist.go | 12 + .../nats-io/nats-server/v2/server/thw/thw.go | 7 +- vendor/github.com/onsi/gomega/CHANGELOG.md | 8 + vendor/github.com/onsi/gomega/gomega_dsl.go | 2 +- .../storageprovider/storageprovider.go | 10 - .../services/userprovider/userprovider.go | 14 +- .../usershareprovider/usershareprovider.go | 8 +- .../http/services/owncloud/ocdav/proppatch.go | 7 + .../opencloud-eu/reva/v2/pkg/appctx/appctx.go | 10 - .../reva/v2/pkg/errtypes/errtypes.go | 21 + .../reva/v2/pkg/events/raw/raw.go | 46 +- .../reva/v2/pkg/events/stream/nats.go | 36 +- .../reva/v2/pkg/rgrpc/status/status.go | 13 + .../v2/pkg/share/manager/jsoncs3/jsoncs3.go | 230 +- .../migrations/0001_import_spacemembers.go | 435 +++ .../manager/jsoncs3/migrations/migration.go | 353 +++ .../v2/pkg/share/manager/memory/memory.go | 3 +- .../v2/pkg/share/manager/registry/registry.go | 7 +- .../reva/v2/pkg/storage/cache/kv.go | 2 +- .../pkg/storage/fs/posix/idcache/idcache.go | 11 +- .../reva/v2/pkg/storage/fs/posix/posix.go | 12 +- .../reva/v2/pkg/storage/fs/posix/tree/tree.go | 15 - .../pkg/decomposedfs/node/permissions.go | 1 + .../pkg/storage/pkg/decomposedfs/tree/tree.go | 5 - .../storage/utils/decomposedfs/tree/tree.go | 5 - .../v2/pkg/storage/utils/metadata/disk.go | 39 +- .../reva/v2/pkg/utils/ldap/identity.go | 89 +- vendor/golang.org/x/crypto/ssh/cipher.go | 2 +- vendor/golang.org/x/crypto/ssh/client_auth.go | 10 +- .../golang.org/x/tools/go/packages/golist.go | 33 +- .../x/tools/go/packages/packages.go | 4 + vendor/modules.txt | 35 +- 102 files changed, 10788 insertions(+), 4246 deletions(-) delete mode 100644 vendor/filippo.io/edwards25519/field/fe_arm64.go delete mode 100644 vendor/filippo.io/edwards25519/field/fe_arm64.s delete mode 100644 vendor/filippo.io/edwards25519/field/fe_arm64_noasm.go create mode 100644 vendor/filippo.io/edwards25519/pull.sh create mode 100644 vendor/github.com/nats-io/nats-server/v2/server/cron.go create mode 100644 vendor/github.com/nats-io/nats-server/v2/server/feature_flags.go create mode 100644 vendor/github.com/opencloud-eu/reva/v2/pkg/share/manager/jsoncs3/migrations/0001_import_spacemembers.go create mode 100644 vendor/github.com/opencloud-eu/reva/v2/pkg/share/manager/jsoncs3/migrations/migration.go diff --git a/go.mod b/go.mod index 4dba42461..3c59fba5c 100644 --- a/go.mod +++ b/go.mod @@ -55,17 +55,17 @@ require ( github.com/mitchellh/mapstructure v1.5.0 github.com/mna/pigeon v1.3.0 github.com/mohae/deepcopy v0.0.0-20170929034955-c48cc78d4826 - github.com/nats-io/nats-server/v2 v2.12.6 + github.com/nats-io/nats-server/v2 v2.14.0 github.com/nats-io/nats.go v1.51.0 github.com/oklog/run v1.2.0 github.com/olekukonko/tablewriter v1.1.4 github.com/onsi/ginkgo v1.16.5 github.com/onsi/ginkgo/v2 v2.28.1 - github.com/onsi/gomega v1.39.1 + github.com/onsi/gomega v1.40.0 github.com/open-policy-agent/opa v1.15.2 github.com/opencloud-eu/icap-client v0.0.0-20250930132611-28a2afe62d89 github.com/opencloud-eu/libre-graph-api-go v1.0.8-0.20260310090739-853d972b282d - github.com/opencloud-eu/reva/v2 v2.43.1-0.20260424125411-c5db28365753 + github.com/opencloud-eu/reva/v2 v2.43.1-0.20260512061040-cd4be86c66b0 github.com/opensearch-project/opensearch-go/v4 v4.6.0 github.com/orcaman/concurrent-map v1.0.0 github.com/pkg/errors v0.9.1 @@ -103,14 +103,14 @@ require ( go.opentelemetry.io/otel/exporters/stdout/stdouttrace v1.43.0 go.opentelemetry.io/otel/sdk v1.43.0 go.opentelemetry.io/otel/trace v1.43.0 - golang.org/x/crypto v0.49.0 + golang.org/x/crypto v0.50.0 golang.org/x/exp v0.0.0-20250210185358-939b2ce775ac golang.org/x/image v0.38.0 golang.org/x/net v0.52.0 golang.org/x/oauth2 v0.36.0 golang.org/x/sync v0.20.0 - golang.org/x/term v0.41.0 - golang.org/x/text v0.35.0 + golang.org/x/term v0.42.0 + golang.org/x/text v0.36.0 google.golang.org/genproto/googleapis/api v0.0.0-20260401024825-9d38bb4040a9 google.golang.org/grpc v1.80.0 google.golang.org/protobuf v1.36.11 @@ -122,7 +122,7 @@ require ( require ( contrib.go.opencensus.io/exporter/prometheus v0.4.2 // indirect - filippo.io/edwards25519 v1.1.1 // indirect + filippo.io/edwards25519 v1.2.0 // indirect github.com/Azure/go-ansiterm v0.0.0-20250102033503-faa5f7b0171c // indirect github.com/Azure/go-ntlmssp v0.1.1 // indirect github.com/BurntSushi/toml v1.6.0 // indirect @@ -136,7 +136,7 @@ require ( github.com/ajg/form v1.5.1 // indirect github.com/alexedwards/argon2id v1.0.0 // indirect github.com/amoghe/go-crypt v0.0.0-20220222110647-20eada5f5964 // indirect - github.com/antithesishq/antithesis-sdk-go v0.6.0-default-no-op // indirect + github.com/antithesishq/antithesis-sdk-go v0.7.0-default-no-op // indirect github.com/armon/go-radix v1.0.0 // indirect github.com/asaskevich/govalidator v0.0.0-20230301143203-a9d515a09cc2 // indirect github.com/beorn7/perks v1.0.1 // indirect @@ -220,7 +220,7 @@ require ( github.com/go-playground/locales v0.14.1 // indirect github.com/go-playground/universal-translator v0.18.1 // indirect github.com/go-redis/redis/v8 v8.11.5 // indirect - github.com/go-sql-driver/mysql v1.9.3 // indirect + github.com/go-sql-driver/mysql v1.10.0 // indirect github.com/go-task/slim-sprig v0.0.0-20230315185526-52ccab3ef572 // indirect github.com/go-task/slim-sprig/v3 v3.0.0 // indirect github.com/go-test/deep v1.1.0 // indirect @@ -286,7 +286,7 @@ require ( github.com/miekg/dns v1.1.68 // indirect github.com/mileusna/useragent v1.3.5 // indirect github.com/minio/crc64nvme v1.1.1 // indirect - github.com/minio/highwayhash v1.0.4-0.20251030100505-070ab1a87a76 // indirect + github.com/minio/highwayhash v1.0.4 // indirect github.com/minio/md5-simd v1.1.2 // indirect github.com/minio/minio-go/v7 v7.0.99 // indirect github.com/mitchellh/copystructure v1.2.0 // indirect @@ -388,10 +388,10 @@ require ( go.uber.org/zap v1.27.0 // indirect go.yaml.in/yaml/v2 v2.4.3 // indirect go.yaml.in/yaml/v3 v3.0.4 // indirect - golang.org/x/mod v0.33.0 // indirect + golang.org/x/mod v0.34.0 // indirect golang.org/x/sys v0.43.0 // indirect golang.org/x/time v0.15.0 // indirect - golang.org/x/tools v0.42.0 // indirect + golang.org/x/tools v0.43.0 // indirect google.golang.org/genproto v0.0.0-20260128011058-8636f8732409 // indirect google.golang.org/genproto/googleapis/rpc v0.0.0-20260406210006-6f92a3bedf2d // indirect gopkg.in/cenkalti/backoff.v1 v1.1.0 // indirect diff --git a/go.sum b/go.sum index 12b0e931f..940e12755 100644 --- a/go.sum +++ b/go.sum @@ -39,8 +39,8 @@ contrib.go.opencensus.io/exporter/prometheus v0.4.2/go.mod h1:dvEHbiKmgvbr5pjaF9 dario.cat/mergo v1.0.2 h1:85+piFYR1tMbRrLcDwR18y4UKJ3aH1Tbzi24VRW1TK8= dario.cat/mergo v1.0.2/go.mod h1:E/hbnu0NxMFBjpMIE34DRGLWqDy0g5FuKDhCb31ngxA= dmitri.shuralyov.com/gpu/mtl v0.0.0-20190408044501-666a987793e9/go.mod h1:H6x//7gZCb22OMCxBHrMx7a5I7Hp++hsVxbQ4BYO7hU= -filippo.io/edwards25519 v1.1.1 h1:YpjwWWlNmGIDyXOn8zLzqiD+9TyIlPhGFG96P39uBpw= -filippo.io/edwards25519 v1.1.1/go.mod h1:BxyFTGdWcka3PhytdK4V28tE5sGfRvvvRV7EaN4VDT4= +filippo.io/edwards25519 v1.2.0 h1:crnVqOiS4jqYleHd9vaKZ+HKtHfllngJIiOpNpoJsjo= +filippo.io/edwards25519 v1.2.0/go.mod h1:xzAOLCNug/yB62zG1bQ8uziwrIqIuxhctzJT18Q77mc= github.com/Acconut/go-httptest-recorder v1.0.0 h1:TAv2dfnqp/l+SUvIaMAUK4GeN4+wqb6KZsFFFTGhoJg= github.com/Acconut/go-httptest-recorder v1.0.0/go.mod h1:CwQyhTH1kq/gLyWiRieo7c0uokpu3PXeyF/nZjUNtmM= github.com/AdaLogics/go-fuzz-headers v0.0.0-20240806141605-e8a1dd7889d6 h1:He8afgbRMd7mFxO99hRNu+6tazq8nFF9lIwo9JFroBk= @@ -117,8 +117,8 @@ github.com/andreyvit/diff v0.0.0-20170406064948-c7f18ee00883 h1:bvNMNQO63//z+xNg github.com/andreyvit/diff v0.0.0-20170406064948-c7f18ee00883/go.mod h1:rCTlJbsFo29Kk6CurOXKm700vrz8f0KW0JNfpkRJY/8= github.com/anmitsu/go-shlex v0.0.0-20200514113438-38f4b401e2be h1:9AeTilPcZAjCFIImctFaOjnTIavg87rW78vTPkQqLI8= github.com/anmitsu/go-shlex v0.0.0-20200514113438-38f4b401e2be/go.mod h1:ySMOLuWl6zY27l47sB3qLNK6tF2fkHG55UZxx8oIVo4= -github.com/antithesishq/antithesis-sdk-go v0.6.0-default-no-op h1:kpBdlEPbRvff0mDD1gk7o9BhI16b9p5yYAXRlidpqJE= -github.com/antithesishq/antithesis-sdk-go v0.6.0-default-no-op/go.mod h1:IUpT2DPAKh6i/YhSbt6Gl3v2yvUZjmKncl7U91fup7E= +github.com/antithesishq/antithesis-sdk-go v0.7.0-default-no-op h1:Z/MZK75wC/NSrkgqeNIa7jexam9uWzhLmFTSCPI/kn0= +github.com/antithesishq/antithesis-sdk-go v0.7.0-default-no-op/go.mod h1:FQyySiasQQM8735Ddel3MRojmy4dA1IqCeyJ5jmPMbI= github.com/apache/thrift v0.12.0/go.mod h1:cp2SuWMxlEZw2r+iP2GNCdIi4C1qmUzdZFSVb+bacwQ= github.com/arbovm/levenshtein v0.0.0-20160628152529-48b4e1c0c4d0 h1:jfIu9sQUG6Ig+0+Ap1h4unLjW6YQJpKZVmUzxsD4E/Q= github.com/arbovm/levenshtein v0.0.0-20160628152529-48b4e1c0c4d0/go.mod h1:t2tdKJDJF9BV14lnkjHmOQgcvEKgtqs5a1N3LNdJhGE= @@ -456,8 +456,8 @@ github.com/go-redis/redis/v8 v8.11.5/go.mod h1:gREzHqY1hg6oD9ngVRbLStwAWKhA0FEgq github.com/go-resty/resty/v2 v2.1.1-0.20191201195748-d7b97669fe48/go.mod h1:dZGr0i9PLlaaTD4H/hoZIDjQ+r6xq8mgbRzHZf7f2J8= github.com/go-resty/resty/v2 v2.17.2 h1:FQW5oHYcIlkCNrMD2lloGScxcHJ0gkjshV3qcQAyHQk= github.com/go-resty/resty/v2 v2.17.2/go.mod h1:kCKZ3wWmwJaNc7S29BRtUhJwy7iqmn+2mLtQrOyQlVA= -github.com/go-sql-driver/mysql v1.9.3 h1:U/N249h2WzJ3Ukj8SowVFjdtZKfu9vlLZxjPXV1aweo= -github.com/go-sql-driver/mysql v1.9.3/go.mod h1:qn46aNg1333BRMNU69Lq93t8du/dwxI64Gl8i5p1WMU= +github.com/go-sql-driver/mysql v1.10.0 h1:Q+1LV8DkHJvSYAdR83XzuhDaTykuDx0l6fkXxoWCWfw= +github.com/go-sql-driver/mysql v1.10.0/go.mod h1:M+cqaI7+xxXGG9swrdeUIoPG3Y3KCkF0pZej+SK+nWk= github.com/go-stack/stack v1.8.0/go.mod h1:v0f6uXyyMGvRgIKkXu+yp6POWl0qKG85gN/melR3HDY= github.com/go-task/slim-sprig v0.0.0-20210107165309-348f09dbbbc0/go.mod h1:fyg7847qk6SyHyPtNmDHnmrv/HOrqktSC+C9fM+CJOE= github.com/go-task/slim-sprig v0.0.0-20230315185526-52ccab3ef572 h1:tfuBGBXKqDEevZMzYi5KSi8KkcZtzBcTgAUUtapy0OI= @@ -839,8 +839,8 @@ github.com/mileusna/useragent v1.3.5 h1:SJM5NzBmh/hO+4LGeATKpaEX9+b4vcGg2qXGLiNG github.com/mileusna/useragent v1.3.5/go.mod h1:3d8TOmwL/5I8pJjyVDteHtgDGcefrFUX4ccGOMKNYYc= github.com/minio/crc64nvme v1.1.1 h1:8dwx/Pz49suywbO+auHCBpCtlW1OfpcLN7wYgVR6wAI= github.com/minio/crc64nvme v1.1.1/go.mod h1:eVfm2fAzLlxMdUGc0EEBGSMmPwmXD5XiNRpnu9J3bvg= -github.com/minio/highwayhash v1.0.4-0.20251030100505-070ab1a87a76 h1:KGuD/pM2JpL9FAYvBrnBBeENKZNh6eNtjqytV6TYjnk= -github.com/minio/highwayhash v1.0.4-0.20251030100505-070ab1a87a76/go.mod h1:GGYsuwP/fPD6Y9hMiXuapVvlIUEhFhMTh0rxU3ik1LQ= +github.com/minio/highwayhash v1.0.4 h1:asJizugGgchQod2ja9NJlGOWq4s7KsAWr5XUc9Clgl4= +github.com/minio/highwayhash v1.0.4/go.mod h1:GGYsuwP/fPD6Y9hMiXuapVvlIUEhFhMTh0rxU3ik1LQ= github.com/minio/md5-simd v1.1.2 h1:Gdi1DZK69+ZVMoNHRXJyNcxrMA4dSxoYHZSQbirFg34= github.com/minio/md5-simd v1.1.2/go.mod h1:MzdKDxYpY2BT9XQFocsiZf/NKVtR7nkE4RoEpN+20RM= github.com/minio/minio-go/v7 v7.0.99 h1:2vH/byrwUkIpFQFOilvTfaUpvAX3fEFhEzO+DR3DlCE= @@ -900,8 +900,8 @@ github.com/mwitkow/go-conntrack v0.0.0-20190716064945-2f068394615f/go.mod h1:qRW github.com/namedotcom/go v0.0.0-20180403034216-08470befbe04/go.mod h1:5sN+Lt1CaY4wsPvgQH/jsuJi4XO2ssZbdsIizr4CVC8= github.com/nats-io/jwt/v2 v2.8.1 h1:V0xpGuD/N8Mi+fQNDynXohVvp7ZztevW5io8CUWlPmU= github.com/nats-io/jwt/v2 v2.8.1/go.mod h1:nWnOEEiVMiKHQpnAy4eXlizVEtSfzacZ1Q43LIRavZg= -github.com/nats-io/nats-server/v2 v2.12.6 h1:Egbx9Vl7Ch8wTtpXPGqbehkZ+IncKqShUxvrt1+Enc8= -github.com/nats-io/nats-server/v2 v2.12.6/go.mod h1:4HPlrvtmSO3yd7KcElDNMx9kv5EBJBnJJzQPptXlheo= +github.com/nats-io/nats-server/v2 v2.14.0 h1:+8q0HrDFotwLLcGH/legOEOnowunhK+aZ4GYBIWpQlM= +github.com/nats-io/nats-server/v2 v2.14.0/go.mod h1:ImVUUDvfClJbb6cuJQRc1VmgDCXKM5ds0OoiG9MVOKo= github.com/nats-io/nats.go v1.51.0 h1:ByW84XTz6W03GSSsygsZcA+xgKK8vPGaa/FCAAEHnAI= github.com/nats-io/nats.go v1.51.0/go.mod h1:26HypzazeOkyO3/mqd1zZd53STJN0EjCYF9Uy2ZOBno= github.com/nats-io/nkeys v0.4.15 h1:JACV5jRVO9V856KOapQ7x+EY8Jo3qw1vJt/9Jpwzkk4= @@ -940,8 +940,8 @@ github.com/onsi/ginkgo/v2 v2.28.1/go.mod h1:CLtbVInNckU3/+gC8LzkGUb9oF+e8W8TdUsx github.com/onsi/gomega v1.4.3/go.mod h1:ex+gbHU/CVuBBDIJjb2X0qEXbFg53c61hWP/1CpauHY= github.com/onsi/gomega v1.7.1/go.mod h1:XdKZgCCFLUoM/7CFJVPcG8C1xQ1AJ0vpAezJrB7JYyY= github.com/onsi/gomega v1.10.1/go.mod h1:iN09h71vgCQne3DLsj+A5owkum+a2tYe+TOCB1ybHNo= -github.com/onsi/gomega v1.39.1 h1:1IJLAad4zjPn2PsnhH70V4DKRFlrCzGBNrNaru+Vf28= -github.com/onsi/gomega v1.39.1/go.mod h1:hL6yVALoTOxeWudERyfppUcZXjMwIMLnuSfruD2lcfg= +github.com/onsi/gomega v1.40.0 h1:Vtol0e1MghCD2ZVIilPDIg44XSL9l2QAn8ZNaljWcJc= +github.com/onsi/gomega v1.40.0/go.mod h1:M/Uqpu/8qTjtzCLUA2zJHX9Iilrau25x1PdoSRbWh5A= github.com/open-policy-agent/opa v1.15.2 h1:dS9q+0Yvruq/VNvWJc5qCvCchn715OWc3HLHXn/UCCc= github.com/open-policy-agent/opa v1.15.2/go.mod h1:c6SN+7jSsUcKJLQc5P4yhwx8YYDRbjpAiGkBOTqxaa4= github.com/opencloud-eu/go-micro-plugins/v4/store/nats-js-kv v0.0.0-20250512152754-23325793059a h1:Sakl76blJAaM6NxylVkgSzktjo2dS504iDotEFJsh3M= @@ -952,8 +952,8 @@ github.com/opencloud-eu/inotifywaitgo v0.0.0-20251111171128-a390bae3c5e9 h1:dIft github.com/opencloud-eu/inotifywaitgo v0.0.0-20251111171128-a390bae3c5e9/go.mod h1:JWyDC6H+5oZRdUJUgKuaye+8Ph5hEs6HVzVoPKzWSGI= github.com/opencloud-eu/libre-graph-api-go v1.0.8-0.20260310090739-853d972b282d h1:JcqGDiyrcaQwVyV861TUyQgO7uEmsjkhfm7aQd84dOw= github.com/opencloud-eu/libre-graph-api-go v1.0.8-0.20260310090739-853d972b282d/go.mod h1:pzatilMEHZFT3qV7C/X3MqOa3NlRQuYhlRhZTL+hN6Q= -github.com/opencloud-eu/reva/v2 v2.43.1-0.20260424125411-c5db28365753 h1:/FpQdybaNb3OAISHmHRrh/4aWYQep3nVSYKzYt2F+jE= -github.com/opencloud-eu/reva/v2 v2.43.1-0.20260424125411-c5db28365753/go.mod h1:msu4TkFw7Jxog0QRbGPxyQOJG9sago5nc+f//y+bbpI= +github.com/opencloud-eu/reva/v2 v2.43.1-0.20260512061040-cd4be86c66b0 h1:e4w34sW1gXixTKi9z+odF6IKGyvisvu97xfYEXOvRGE= +github.com/opencloud-eu/reva/v2 v2.43.1-0.20260512061040-cd4be86c66b0/go.mod h1:SoRYtNJ9ha83YdUUep5wYF7F5/OIhgED7ZSgqudhpNo= github.com/opencloud-eu/secure v0.0.0-20260312082735-b6f5cb2244e4 h1:l2oB/RctH+t8r7QBj5p8thfEHCM/jF35aAY3WQ3hADI= github.com/opencloud-eu/secure v0.0.0-20260312082735-b6f5cb2244e4/go.mod h1:BmF5hyM6tXczk3MpQkFf1hpKSRqCyhqcbiQtiAF7+40= github.com/opencontainers/go-digest v1.0.0 h1:apOUWs51W5PlhuyGyz9FCeeBIOUDA/6nW8Oi/yOhh5U= @@ -1358,8 +1358,8 @@ golang.org/x/crypto v0.0.0-20220622213112-05595931fe9d/go.mod h1:IxCIyHEi3zRg3s0 golang.org/x/crypto v0.14.0/go.mod h1:MVFd36DqK4CsrnJYDkBA3VC4m2GkXAM0PvzMCn4JQf4= golang.org/x/crypto v0.19.0/go.mod h1:Iy9bg/ha4yyC70EfRS8jz+B6ybOBKMaSxLj6P6oBDfU= golang.org/x/crypto v0.21.0/go.mod h1:0BP7YvVV9gBbVKyeTG0Gyn+gZm94bibOW5BjDEYAOMs= -golang.org/x/crypto v0.49.0 h1:+Ng2ULVvLHnJ/ZFEq4KdcDd/cfjrrjjNSXNzxg0Y4U4= -golang.org/x/crypto v0.49.0/go.mod h1:ErX4dUh2UM+CFYiXZRTcMpEcN8b/1gxEuv3nODoYtCA= +golang.org/x/crypto v0.50.0 h1:zO47/JPrL6vsNkINmLoo/PH1gcxpls50DNogFvB5ZGI= +golang.org/x/crypto v0.50.0/go.mod h1:3muZ7vA7PBCE6xgPX7nkzzjiUq87kRItoJQM1Yo8S+Q= golang.org/x/exp v0.0.0-20190121172915-509febef88a4/go.mod h1:CJ0aWSM057203Lf6IL+f9T1iT9GByDxfZKAQTCR3kQA= golang.org/x/exp v0.0.0-20190306152737-a1d7652674e8/go.mod h1:CJ0aWSM057203Lf6IL+f9T1iT9GByDxfZKAQTCR3kQA= golang.org/x/exp v0.0.0-20190510132918-efd6b22b2522/go.mod h1:ZjyILWgesfNpC6sMxTJOJm9Kp84zZh5NQWvqDGG3Qr8= @@ -1397,8 +1397,8 @@ golang.org/x/mod v0.2.0/go.mod h1:s0Qsj1ACt9ePp/hMypM3fl4fZqREWJwdYDEqhRiZZUA= golang.org/x/mod v0.3.0/go.mod h1:s0Qsj1ACt9ePp/hMypM3fl4fZqREWJwdYDEqhRiZZUA= golang.org/x/mod v0.6.0-dev.0.20220419223038-86c51ed26bb4/go.mod h1:jJ57K6gSWd91VN4djpZkiMVwK6gcyfeH4XE8wZrZaV4= golang.org/x/mod v0.8.0/go.mod h1:iBbtSCu2XBx23ZKBPSOrRkjjQPZFPuis4dIYUhu/chs= -golang.org/x/mod v0.33.0 h1:tHFzIWbBifEmbwtGz65eaWyGiGZatSrT9prnU8DbVL8= -golang.org/x/mod v0.33.0/go.mod h1:swjeQEj+6r7fODbD2cqrnje9PnziFuw4bmLbBZFrQ5w= +golang.org/x/mod v0.34.0 h1:xIHgNUUnW6sYkcM5Jleh05DvLOtwc6RitGHbDk4akRI= +golang.org/x/mod v0.34.0/go.mod h1:ykgH52iCZe79kzLLMhyCUzhMci+nQj+0XkbXpNYtVjY= golang.org/x/net v0.0.0-20180724234803-3673e40ba225/go.mod h1:mL1N/T3taQHkDXs73rZJwtUhF3w3ftmwwsq0BUmARs4= golang.org/x/net v0.0.0-20180826012351-8a410e7b638d/go.mod h1:mL1N/T3taQHkDXs73rZJwtUhF3w3ftmwwsq0BUmARs4= golang.org/x/net v0.0.0-20180906233101-161cd47e91fd/go.mod h1:mL1N/T3taQHkDXs73rZJwtUhF3w3ftmwwsq0BUmARs4= @@ -1566,8 +1566,8 @@ golang.org/x/term v0.8.0/go.mod h1:xPskH00ivmX89bAKVGSKKtLOWNx2+17Eiy94tnKShWo= golang.org/x/term v0.13.0/go.mod h1:LTmsnFJwVN6bCy1rVCoS+qHT1HhALEFxKncY3WNNh4U= golang.org/x/term v0.17.0/go.mod h1:lLRBjIVuehSbZlaOtGMbcMncT+aqLLLmKrsjNrUguwk= golang.org/x/term v0.18.0/go.mod h1:ILwASektA3OnRv7amZ1xhE/KTR+u50pbXfZ03+6Nx58= -golang.org/x/term v0.41.0 h1:QCgPso/Q3RTJx2Th4bDLqML4W6iJiaXFq2/ftQF13YU= -golang.org/x/term v0.41.0/go.mod h1:3pfBgksrReYfZ5lvYM0kSO0LIkAl4Yl2bXOkKP7Ec2A= +golang.org/x/term v0.42.0 h1:UiKe+zDFmJobeJ5ggPwOshJIVt6/Ft0rcfrXZDLWAWY= +golang.org/x/term v0.42.0/go.mod h1:Dq/D+snpsbazcBG5+F9Q1n2rXV8Ma+71xEjTRufARgY= golang.org/x/text v0.0.0-20170915032832-14c0d48ead0c/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= golang.org/x/text v0.3.0/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= golang.org/x/text v0.3.1-0.20180807135948-17ff2d5776d2/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= @@ -1580,8 +1580,8 @@ golang.org/x/text v0.7.0/go.mod h1:mrYo+phRRbMaCq/xk9113O4dZlRixOauAjOtrjsXDZ8= golang.org/x/text v0.9.0/go.mod h1:e1OnstbJyHTd6l/uOt8jFFHp6TRDWZR/bV3emEE/zU8= golang.org/x/text v0.13.0/go.mod h1:TvPlkZtksWOMsz7fbANvkp4WM8x/WCo/om8BMLbz+aE= golang.org/x/text v0.14.0/go.mod h1:18ZOQIKpY8NJVqYksKHtTdi31H5itFRjB5/qKTNYzSU= -golang.org/x/text v0.35.0 h1:JOVx6vVDFokkpaq1AEptVzLTpDe9KGpj5tR4/X+ybL8= -golang.org/x/text v0.35.0/go.mod h1:khi/HExzZJ2pGnjenulevKNX1W67CUy0AsXcNubPGCA= +golang.org/x/text v0.36.0 h1:JfKh3XmcRPqZPKevfXVpI1wXPTqbkE5f7JA92a55Yxg= +golang.org/x/text v0.36.0/go.mod h1:NIdBknypM8iqVmPiuco0Dh6P5Jcdk8lJL0CUebqK164= golang.org/x/time v0.0.0-20181108054448-85acf8d2951c/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= golang.org/x/time v0.0.0-20190308202827-9d24e82272b4/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= golang.org/x/time v0.0.0-20191024005414-555d28b269f0/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= @@ -1642,8 +1642,8 @@ golang.org/x/tools v0.0.0-20210106214847-113979e3529a/go.mod h1:emZCQorbCU4vsT4f golang.org/x/tools v0.0.0-20210112230658-8b4aab62c064/go.mod h1:emZCQorbCU4vsT4fOWvOPXz4eW1wZW4PmDk9uLelYpA= golang.org/x/tools v0.1.12/go.mod h1:hNGJHUnrk76NpqgfD5Aqm5Crs+Hm0VOH/i9J2+nxYbc= golang.org/x/tools v0.6.0/go.mod h1:Xwgl3UAJ/d3gWutnCtw505GrjyAbvKui8lOU390QaIU= -golang.org/x/tools v0.42.0 h1:uNgphsn75Tdz5Ji2q36v/nsFSfR/9BRFvqhGBaJGd5k= -golang.org/x/tools v0.42.0/go.mod h1:Ma6lCIwGZvHK6XtgbswSoWroEkhugApmsXyrUmBhfr0= +golang.org/x/tools v0.43.0 h1:12BdW9CeB3Z+J/I/wj34VMl8X+fEXBxVR90JeMX5E7s= +golang.org/x/tools v0.43.0/go.mod h1:uHkMso649BX2cZK6+RpuIPXS3ho2hZo4FVwfoy1vIk0= golang.org/x/tools/godoc v0.1.0-deprecated h1:o+aZ1BOj6Hsx/GBdJO/s815sqftjSnrZZwyYTHODvtk= golang.org/x/tools/godoc v0.1.0-deprecated/go.mod h1:qM63CriJ961IHWmnWa9CjZnBndniPt4a3CK0PVB9bIg= golang.org/x/xerrors v0.0.0-20190717185122-a985d3407aa7/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0= diff --git a/vendor/filippo.io/edwards25519/README.md b/vendor/filippo.io/edwards25519/README.md index 24e2457d8..dcdd8d85f 100644 --- a/vendor/filippo.io/edwards25519/README.md +++ b/vendor/filippo.io/edwards25519/README.md @@ -7,8 +7,10 @@ import "filippo.io/edwards25519" This library implements the edwards25519 elliptic curve, exposing the necessary APIs to build a wide array of higher-level primitives. Read the docs at [pkg.go.dev/filippo.io/edwards25519](https://pkg.go.dev/filippo.io/edwards25519). -The code is originally derived from Adam Langley's internal implementation in the Go standard library, and includes George Tankersley's [performance improvements](https://golang.org/cl/71950). It was then further developed by Henry de Valence for use in ristretto255, and was finally [merged back into the Go standard library](https://golang.org/cl/276272) as of Go 1.17. It now tracks the upstream codebase and extends it with additional functionality. +The package tracks the upstream standard library package `crypto/internal/fips140/edwards25519` and extends it with additional functionality. -Most users don't need this package, and should instead use `crypto/ed25519` for signatures, `golang.org/x/crypto/curve25519` for Diffie-Hellman, or `github.com/gtank/ristretto255` for prime order group logic. However, for anyone currently using a fork of `crypto/internal/edwards25519`/`crypto/ed25519/internal/edwards25519` or `github.com/agl/edwards25519`, this package should be a safer, faster, and more powerful alternative. +The code is originally derived from Adam Langley's internal implementation in the Go standard library, and includes George Tankersley's [performance improvements](https://golang.org/cl/71950). It was then further developed by Henry de Valence for use in ristretto255, and was finally [merged back into the Go standard library](https://golang.org/cl/276272) as of Go 1.17. + +Most users don't need this package, and should instead use `crypto/ed25519` for signatures, `crypto/ecdh` for Diffie-Hellman, or `github.com/gtank/ristretto255` for prime order group logic. However, for anyone currently using a fork of the internal `edwards25519` package or of `github.com/agl/edwards25519`, this package should be a safer, faster, and more powerful alternative. Since this package is meant to curb proliferation of edwards25519 implementations in the Go ecosystem, it welcomes requests for new APIs or reviewable performance improvements. diff --git a/vendor/filippo.io/edwards25519/doc.go b/vendor/filippo.io/edwards25519/doc.go index ab6aaebc0..dd2deb644 100644 --- a/vendor/filippo.io/edwards25519/doc.go +++ b/vendor/filippo.io/edwards25519/doc.go @@ -10,11 +10,11 @@ // the curve used by the Ed25519 signature scheme. // // Most users don't need this package, and should instead use crypto/ed25519 for -// signatures, golang.org/x/crypto/curve25519 for Diffie-Hellman, or -// github.com/gtank/ristretto255 for prime order group logic. +// signatures, crypto/ecdh for Diffie-Hellman, or github.com/gtank/ristretto255 +// for prime order group logic. // // However, developers who do need to interact with low-level edwards25519 // operations can use this package, which is an extended version of -// crypto/internal/edwards25519 from the standard library repackaged as +// crypto/internal/fips140/edwards25519 from the standard library repackaged as // an importable module. package edwards25519 diff --git a/vendor/filippo.io/edwards25519/extra.go b/vendor/filippo.io/edwards25519/extra.go index ab2e44a51..ee9b5ca5b 100644 --- a/vendor/filippo.io/edwards25519/extra.go +++ b/vendor/filippo.io/edwards25519/extra.go @@ -9,6 +9,7 @@ package edwards25519 import ( "errors" + "slices" "filippo.io/edwards25519/field" ) @@ -100,13 +101,15 @@ func (v *Point) bytesMontgomery(buf *[32]byte) []byte { // // u = (1 + y) / (1 - y) // - // where y = Y / Z. + // where y = Y / Z and therefore + // + // u = (Z + Y) / (Z - Y) - var y, recip, u field.Element + var n, r, u field.Element - y.Multiply(&v.y, y.Invert(&v.z)) // y = Y / Z - recip.Invert(recip.Subtract(feOne, &y)) // r = 1/(1 - y) - u.Multiply(u.Add(feOne, &y), &recip) // u = (1 + y)*r + n.Add(&v.z, &v.y) // n = Z + Y + r.Invert(r.Subtract(&v.z, &v.y)) // r = 1 / (Z - Y) + u.Multiply(&n, &r) // u = n * r return copyFieldElement(buf, &u) } @@ -124,7 +127,7 @@ func (v *Point) MultByCofactor(p *Point) *Point { return v.fromP1xP1(&result) } -// Given k > 0, set s = s**(2*i). +// Given k > 0, set s = s**(2*k). func (s *Scalar) pow2k(k int) { for i := 0; i < k; i++ { s.Multiply(s, s) @@ -250,12 +253,14 @@ func (v *Point) MultiScalarMult(scalars []*Scalar, points []*Point) *Point { // between each point in the multiscalar equation. // Build lookup tables for each point - tables := make([]projLookupTable, len(points)) + tables := make([]projLookupTable, 0, 2) // avoid allocation for small sizes + tables = slices.Grow(tables, len(points))[:len(points)] for i := range tables { tables[i].FromP3(points[i]) } // Compute signed radix-16 digits for each scalar - digits := make([][64]int8, len(scalars)) + digits := make([][64]int8, 0, 2) // avoid allocation for small sizes + digits = slices.Grow(digits, len(scalars))[:len(scalars)] for i := range digits { digits[i] = scalars[i].signedRadix16() } @@ -348,3 +353,49 @@ func (v *Point) VarTimeMultiScalarMult(scalars []*Scalar, points []*Point) *Poin v.fromP2(tmp2) return v } + +// Select sets v to a if cond == 1 and to b if cond == 0. +func (v *Point) Select(a, b *Point, cond int) *Point { + checkInitialized(a, b) + v.x.Select(&a.x, &b.x, cond) + v.y.Select(&a.y, &b.y, cond) + v.z.Select(&a.z, &b.z, cond) + v.t.Select(&a.t, &b.t, cond) + return v +} + +// Double sets v = p + p, and returns v. +func (v *Point) Double(p *Point) *Point { + checkInitialized(p) + + pp := new(projP2).FromP3(p) + p1 := new(projP1xP1).Double(pp) + return v.fromP1xP1(p1) +} + +func (v *Point) addCached(p *Point, qCached *projCached) *Point { + result := new(projP1xP1).Add(p, qCached) + return v.fromP1xP1(result) +} + +// ScalarMultSlow sets v = x * q, and returns v. It doesn't precompute a large +// table, so it is considerably slower, but requires less memory. +// +// The scalar multiplication is done in constant time. +func (v *Point) ScalarMultSlow(x *Scalar, q *Point) *Point { + checkInitialized(q) + + s := x.Bytes() + qCached := new(projCached).FromP3(q) + v.Set(NewIdentityPoint()) + t := new(Point) + + for i := 255; i >= 0; i-- { + v.Double(v) + t.addCached(v, qCached) + cond := (s[i/8] >> (i % 8)) & 1 + v.Select(t, v, int(cond)) + } + + return v +} diff --git a/vendor/filippo.io/edwards25519/field/fe.go b/vendor/filippo.io/edwards25519/field/fe.go index 5518ef2b9..4d52cc10d 100644 --- a/vendor/filippo.io/edwards25519/field/fe.go +++ b/vendor/filippo.io/edwards25519/field/fe.go @@ -90,11 +90,7 @@ func (v *Element) Add(a, b *Element) *Element { v.l2 = a.l2 + b.l2 v.l3 = a.l3 + b.l3 v.l4 = a.l4 + b.l4 - // Using the generic implementation here is actually faster than the - // assembly. Probably because the body of this function is so simple that - // the compiler can figure out better optimizations by inlining the carry - // propagation. - return v.carryPropagateGeneric() + return v.carryPropagate() } // Subtract sets v = a - b, and returns v. @@ -232,18 +228,22 @@ func (v *Element) bytes(out *[32]byte) []byte { t := *v t.reduce() - var buf [8]byte - for i, l := range [5]uint64{t.l0, t.l1, t.l2, t.l3, t.l4} { - bitsOffset := i * 51 - binary.LittleEndian.PutUint64(buf[:], l<= len(out) { - break - } - out[off] |= bb - } - } + // Pack five 51-bit limbs into four 64-bit words: + // + // 255 204 153 102 51 0 + // ├──l4──┼──l3──┼──l2──┼──l1──┼──l0──┤ + // ├───u3───┼───u2───┼───u1───┼───u0───┤ + // 256 192 128 64 0 + + u0 := t.l1<<51 | t.l0 + u1 := t.l2<<(102-64) | t.l1>>(64-51) + u2 := t.l3<<(153-128) | t.l2>>(128-102) + u3 := t.l4<<(204-192) | t.l3>>(192-153) + + binary.LittleEndian.PutUint64(out[0*8:], u0) + binary.LittleEndian.PutUint64(out[1*8:], u1) + binary.LittleEndian.PutUint64(out[2*8:], u2) + binary.LittleEndian.PutUint64(out[3*8:], u3) return out[:] } diff --git a/vendor/filippo.io/edwards25519/field/fe_amd64.go b/vendor/filippo.io/edwards25519/field/fe_amd64.go index edcf163c4..00bf8f447 100644 --- a/vendor/filippo.io/edwards25519/field/fe_amd64.go +++ b/vendor/filippo.io/edwards25519/field/fe_amd64.go @@ -1,7 +1,6 @@ // Code generated by command: go run fe_amd64_asm.go -out ../fe_amd64.s -stubs ../fe_amd64.go -pkg field. DO NOT EDIT. -//go:build amd64 && gc && !purego -// +build amd64,gc,!purego +//go:build !purego package field diff --git a/vendor/filippo.io/edwards25519/field/fe_amd64.s b/vendor/filippo.io/edwards25519/field/fe_amd64.s index 293f013c9..5e06e242e 100644 --- a/vendor/filippo.io/edwards25519/field/fe_amd64.s +++ b/vendor/filippo.io/edwards25519/field/fe_amd64.s @@ -1,7 +1,6 @@ // Code generated by command: go run fe_amd64_asm.go -out ../fe_amd64.s -stubs ../fe_amd64.go -pkg field. DO NOT EDIT. -//go:build amd64 && gc && !purego -// +build amd64,gc,!purego +//go:build !purego #include "textflag.h" @@ -17,32 +16,36 @@ TEXT ·feMul(SB), NOSPLIT, $0-24 MOVQ DX, SI // r0 += 19×a1×b4 - MOVQ 8(CX), AX - IMUL3Q $0x13, AX, AX - MULQ 32(BX) - ADDQ AX, DI - ADCQ DX, SI + MOVQ 8(CX), DX + LEAQ (DX)(DX*8), AX + LEAQ (DX)(AX*2), AX + MULQ 32(BX) + ADDQ AX, DI + ADCQ DX, SI // r0 += 19×a2×b3 - MOVQ 16(CX), AX - IMUL3Q $0x13, AX, AX - MULQ 24(BX) - ADDQ AX, DI - ADCQ DX, SI + MOVQ 16(CX), DX + LEAQ (DX)(DX*8), AX + LEAQ (DX)(AX*2), AX + MULQ 24(BX) + ADDQ AX, DI + ADCQ DX, SI // r0 += 19×a3×b2 - MOVQ 24(CX), AX - IMUL3Q $0x13, AX, AX - MULQ 16(BX) - ADDQ AX, DI - ADCQ DX, SI + MOVQ 24(CX), DX + LEAQ (DX)(DX*8), AX + LEAQ (DX)(AX*2), AX + MULQ 16(BX) + ADDQ AX, DI + ADCQ DX, SI // r0 += 19×a4×b1 - MOVQ 32(CX), AX - IMUL3Q $0x13, AX, AX - MULQ 8(BX) - ADDQ AX, DI - ADCQ DX, SI + MOVQ 32(CX), DX + LEAQ (DX)(DX*8), AX + LEAQ (DX)(AX*2), AX + MULQ 8(BX) + ADDQ AX, DI + ADCQ DX, SI // r1 = a0×b1 MOVQ (CX), AX @@ -57,25 +60,28 @@ TEXT ·feMul(SB), NOSPLIT, $0-24 ADCQ DX, R8 // r1 += 19×a2×b4 - MOVQ 16(CX), AX - IMUL3Q $0x13, AX, AX - MULQ 32(BX) - ADDQ AX, R9 - ADCQ DX, R8 + MOVQ 16(CX), DX + LEAQ (DX)(DX*8), AX + LEAQ (DX)(AX*2), AX + MULQ 32(BX) + ADDQ AX, R9 + ADCQ DX, R8 // r1 += 19×a3×b3 - MOVQ 24(CX), AX - IMUL3Q $0x13, AX, AX - MULQ 24(BX) - ADDQ AX, R9 - ADCQ DX, R8 + MOVQ 24(CX), DX + LEAQ (DX)(DX*8), AX + LEAQ (DX)(AX*2), AX + MULQ 24(BX) + ADDQ AX, R9 + ADCQ DX, R8 // r1 += 19×a4×b2 - MOVQ 32(CX), AX - IMUL3Q $0x13, AX, AX - MULQ 16(BX) - ADDQ AX, R9 - ADCQ DX, R8 + MOVQ 32(CX), DX + LEAQ (DX)(DX*8), AX + LEAQ (DX)(AX*2), AX + MULQ 16(BX) + ADDQ AX, R9 + ADCQ DX, R8 // r2 = a0×b2 MOVQ (CX), AX @@ -96,18 +102,20 @@ TEXT ·feMul(SB), NOSPLIT, $0-24 ADCQ DX, R10 // r2 += 19×a3×b4 - MOVQ 24(CX), AX - IMUL3Q $0x13, AX, AX - MULQ 32(BX) - ADDQ AX, R11 - ADCQ DX, R10 + MOVQ 24(CX), DX + LEAQ (DX)(DX*8), AX + LEAQ (DX)(AX*2), AX + MULQ 32(BX) + ADDQ AX, R11 + ADCQ DX, R10 // r2 += 19×a4×b3 - MOVQ 32(CX), AX - IMUL3Q $0x13, AX, AX - MULQ 24(BX) - ADDQ AX, R11 - ADCQ DX, R10 + MOVQ 32(CX), DX + LEAQ (DX)(DX*8), AX + LEAQ (DX)(AX*2), AX + MULQ 24(BX) + ADDQ AX, R11 + ADCQ DX, R10 // r3 = a0×b3 MOVQ (CX), AX @@ -134,11 +142,12 @@ TEXT ·feMul(SB), NOSPLIT, $0-24 ADCQ DX, R12 // r3 += 19×a4×b4 - MOVQ 32(CX), AX - IMUL3Q $0x13, AX, AX - MULQ 32(BX) - ADDQ AX, R13 - ADCQ DX, R12 + MOVQ 32(CX), DX + LEAQ (DX)(DX*8), AX + LEAQ (DX)(AX*2), AX + MULQ 32(BX) + ADDQ AX, R13 + ADCQ DX, R12 // r4 = a0×b4 MOVQ (CX), AX @@ -232,18 +241,22 @@ TEXT ·feSquare(SB), NOSPLIT, $0-16 MOVQ DX, BX // r0 += 38×l1×l4 - MOVQ 8(CX), AX - IMUL3Q $0x26, AX, AX - MULQ 32(CX) - ADDQ AX, SI - ADCQ DX, BX + MOVQ 8(CX), DX + LEAQ (DX)(DX*8), AX + LEAQ (DX)(AX*2), AX + SHLQ $0x01, AX + MULQ 32(CX) + ADDQ AX, SI + ADCQ DX, BX // r0 += 38×l2×l3 - MOVQ 16(CX), AX - IMUL3Q $0x26, AX, AX - MULQ 24(CX) - ADDQ AX, SI - ADCQ DX, BX + MOVQ 16(CX), DX + LEAQ (DX)(DX*8), AX + LEAQ (DX)(AX*2), AX + SHLQ $0x01, AX + MULQ 24(CX) + ADDQ AX, SI + ADCQ DX, BX // r1 = 2×l0×l1 MOVQ (CX), AX @@ -253,18 +266,21 @@ TEXT ·feSquare(SB), NOSPLIT, $0-16 MOVQ DX, DI // r1 += 38×l2×l4 - MOVQ 16(CX), AX - IMUL3Q $0x26, AX, AX - MULQ 32(CX) - ADDQ AX, R8 - ADCQ DX, DI + MOVQ 16(CX), DX + LEAQ (DX)(DX*8), AX + LEAQ (DX)(AX*2), AX + SHLQ $0x01, AX + MULQ 32(CX) + ADDQ AX, R8 + ADCQ DX, DI // r1 += 19×l3×l3 - MOVQ 24(CX), AX - IMUL3Q $0x13, AX, AX - MULQ 24(CX) - ADDQ AX, R8 - ADCQ DX, DI + MOVQ 24(CX), DX + LEAQ (DX)(DX*8), AX + LEAQ (DX)(AX*2), AX + MULQ 24(CX) + ADDQ AX, R8 + ADCQ DX, DI // r2 = 2×l0×l2 MOVQ (CX), AX @@ -280,11 +296,13 @@ TEXT ·feSquare(SB), NOSPLIT, $0-16 ADCQ DX, R9 // r2 += 38×l3×l4 - MOVQ 24(CX), AX - IMUL3Q $0x26, AX, AX - MULQ 32(CX) - ADDQ AX, R10 - ADCQ DX, R9 + MOVQ 24(CX), DX + LEAQ (DX)(DX*8), AX + LEAQ (DX)(AX*2), AX + SHLQ $0x01, AX + MULQ 32(CX) + ADDQ AX, R10 + ADCQ DX, R9 // r3 = 2×l0×l3 MOVQ (CX), AX @@ -294,18 +312,19 @@ TEXT ·feSquare(SB), NOSPLIT, $0-16 MOVQ DX, R11 // r3 += 2×l1×l2 - MOVQ 8(CX), AX - IMUL3Q $0x02, AX, AX - MULQ 16(CX) - ADDQ AX, R12 - ADCQ DX, R11 + MOVQ 8(CX), AX + SHLQ $0x01, AX + MULQ 16(CX) + ADDQ AX, R12 + ADCQ DX, R11 // r3 += 19×l4×l4 - MOVQ 32(CX), AX - IMUL3Q $0x13, AX, AX - MULQ 32(CX) - ADDQ AX, R12 - ADCQ DX, R11 + MOVQ 32(CX), DX + LEAQ (DX)(DX*8), AX + LEAQ (DX)(AX*2), AX + MULQ 32(CX) + ADDQ AX, R12 + ADCQ DX, R11 // r4 = 2×l0×l4 MOVQ (CX), AX @@ -315,11 +334,11 @@ TEXT ·feSquare(SB), NOSPLIT, $0-16 MOVQ DX, R13 // r4 += 2×l1×l3 - MOVQ 8(CX), AX - IMUL3Q $0x02, AX, AX - MULQ 24(CX) - ADDQ AX, R14 - ADCQ DX, R13 + MOVQ 8(CX), AX + SHLQ $0x01, AX + MULQ 24(CX) + ADDQ AX, R14 + ADCQ DX, R13 // r4 += l2×l2 MOVQ 16(CX), AX diff --git a/vendor/filippo.io/edwards25519/field/fe_amd64_noasm.go b/vendor/filippo.io/edwards25519/field/fe_amd64_noasm.go index ddb6c9b8f..4b81f25d1 100644 --- a/vendor/filippo.io/edwards25519/field/fe_amd64_noasm.go +++ b/vendor/filippo.io/edwards25519/field/fe_amd64_noasm.go @@ -2,8 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build !amd64 || !gc || purego -// +build !amd64 !gc purego +//go:build !amd64 || purego package field diff --git a/vendor/filippo.io/edwards25519/field/fe_arm64.go b/vendor/filippo.io/edwards25519/field/fe_arm64.go deleted file mode 100644 index af459ef51..000000000 --- a/vendor/filippo.io/edwards25519/field/fe_arm64.go +++ /dev/null @@ -1,16 +0,0 @@ -// Copyright (c) 2020 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:build arm64 && gc && !purego -// +build arm64,gc,!purego - -package field - -//go:noescape -func carryPropagate(v *Element) - -func (v *Element) carryPropagate() *Element { - carryPropagate(v) - return v -} diff --git a/vendor/filippo.io/edwards25519/field/fe_arm64.s b/vendor/filippo.io/edwards25519/field/fe_arm64.s deleted file mode 100644 index 3126a4341..000000000 --- a/vendor/filippo.io/edwards25519/field/fe_arm64.s +++ /dev/null @@ -1,42 +0,0 @@ -// Copyright (c) 2020 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:build arm64 && gc && !purego - -#include "textflag.h" - -// carryPropagate works exactly like carryPropagateGeneric and uses the -// same AND, ADD, and LSR+MADD instructions emitted by the compiler, but -// avoids loading R0-R4 twice and uses LDP and STP. -// -// See https://golang.org/issues/43145 for the main compiler issue. -// -// func carryPropagate(v *Element) -TEXT ·carryPropagate(SB),NOFRAME|NOSPLIT,$0-8 - MOVD v+0(FP), R20 - - LDP 0(R20), (R0, R1) - LDP 16(R20), (R2, R3) - MOVD 32(R20), R4 - - AND $0x7ffffffffffff, R0, R10 - AND $0x7ffffffffffff, R1, R11 - AND $0x7ffffffffffff, R2, R12 - AND $0x7ffffffffffff, R3, R13 - AND $0x7ffffffffffff, R4, R14 - - ADD R0>>51, R11, R11 - ADD R1>>51, R12, R12 - ADD R2>>51, R13, R13 - ADD R3>>51, R14, R14 - // R4>>51 * 19 + R10 -> R10 - LSR $51, R4, R21 - MOVD $19, R22 - MADD R22, R10, R21, R10 - - STP (R10, R11), 0(R20) - STP (R12, R13), 16(R20) - MOVD R14, 32(R20) - - RET diff --git a/vendor/filippo.io/edwards25519/field/fe_arm64_noasm.go b/vendor/filippo.io/edwards25519/field/fe_arm64_noasm.go deleted file mode 100644 index 234a5b2e5..000000000 --- a/vendor/filippo.io/edwards25519/field/fe_arm64_noasm.go +++ /dev/null @@ -1,12 +0,0 @@ -// Copyright (c) 2021 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:build !arm64 || !gc || purego -// +build !arm64 !gc purego - -package field - -func (v *Element) carryPropagate() *Element { - return v.carryPropagateGeneric() -} diff --git a/vendor/filippo.io/edwards25519/field/fe_generic.go b/vendor/filippo.io/edwards25519/field/fe_generic.go index 86f5fd955..ef1f15a5d 100644 --- a/vendor/filippo.io/edwards25519/field/fe_generic.go +++ b/vendor/filippo.io/edwards25519/field/fe_generic.go @@ -12,20 +12,42 @@ type uint128 struct { lo, hi uint64 } -// mul64 returns a * b. -func mul64(a, b uint64) uint128 { +// mul returns a * b. +func mul(a, b uint64) uint128 { hi, lo := bits.Mul64(a, b) return uint128{lo, hi} } -// addMul64 returns v + a * b. -func addMul64(v uint128, a, b uint64) uint128 { +// addMul returns v + a * b. +func addMul(v uint128, a, b uint64) uint128 { hi, lo := bits.Mul64(a, b) lo, c := bits.Add64(lo, v.lo, 0) hi, _ = bits.Add64(hi, v.hi, c) return uint128{lo, hi} } +// mul19 returns v * 19. +func mul19(v uint64) uint64 { + // Using this approach seems to yield better optimizations than *19. + return v + (v+v<<3)<<1 +} + +// addMul19 returns v + 19 * a * b, where a and b are at most 52 bits. +func addMul19(v uint128, a, b uint64) uint128 { + hi, lo := bits.Mul64(mul19(a), b) + lo, c := bits.Add64(lo, v.lo, 0) + hi, _ = bits.Add64(hi, v.hi, c) + return uint128{lo, hi} +} + +// addMul38 returns v + 38 * a * b, where a and b are at most 52 bits. +func addMul38(v uint128, a, b uint64) uint128 { + hi, lo := bits.Mul64(mul19(a), b*2) + lo, c := bits.Add64(lo, v.lo, 0) + hi, _ = bits.Add64(hi, v.hi, c) + return uint128{lo, hi} +} + // shiftRightBy51 returns a >> 51. a is assumed to be at most 115 bits. func shiftRightBy51(a uint128) uint64 { return (a.hi << (64 - 51)) | (a.lo >> 51) @@ -76,45 +98,40 @@ func feMulGeneric(v, a, b *Element) { // // Finally we add up the columns into wide, overlapping limbs. - a1_19 := a1 * 19 - a2_19 := a2 * 19 - a3_19 := a3 * 19 - a4_19 := a4 * 19 - // r0 = a0×b0 + 19×(a1×b4 + a2×b3 + a3×b2 + a4×b1) - r0 := mul64(a0, b0) - r0 = addMul64(r0, a1_19, b4) - r0 = addMul64(r0, a2_19, b3) - r0 = addMul64(r0, a3_19, b2) - r0 = addMul64(r0, a4_19, b1) + r0 := mul(a0, b0) + r0 = addMul19(r0, a1, b4) + r0 = addMul19(r0, a2, b3) + r0 = addMul19(r0, a3, b2) + r0 = addMul19(r0, a4, b1) // r1 = a0×b1 + a1×b0 + 19×(a2×b4 + a3×b3 + a4×b2) - r1 := mul64(a0, b1) - r1 = addMul64(r1, a1, b0) - r1 = addMul64(r1, a2_19, b4) - r1 = addMul64(r1, a3_19, b3) - r1 = addMul64(r1, a4_19, b2) + r1 := mul(a0, b1) + r1 = addMul(r1, a1, b0) + r1 = addMul19(r1, a2, b4) + r1 = addMul19(r1, a3, b3) + r1 = addMul19(r1, a4, b2) // r2 = a0×b2 + a1×b1 + a2×b0 + 19×(a3×b4 + a4×b3) - r2 := mul64(a0, b2) - r2 = addMul64(r2, a1, b1) - r2 = addMul64(r2, a2, b0) - r2 = addMul64(r2, a3_19, b4) - r2 = addMul64(r2, a4_19, b3) + r2 := mul(a0, b2) + r2 = addMul(r2, a1, b1) + r2 = addMul(r2, a2, b0) + r2 = addMul19(r2, a3, b4) + r2 = addMul19(r2, a4, b3) // r3 = a0×b3 + a1×b2 + a2×b1 + a3×b0 + 19×a4×b4 - r3 := mul64(a0, b3) - r3 = addMul64(r3, a1, b2) - r3 = addMul64(r3, a2, b1) - r3 = addMul64(r3, a3, b0) - r3 = addMul64(r3, a4_19, b4) + r3 := mul(a0, b3) + r3 = addMul(r3, a1, b2) + r3 = addMul(r3, a2, b1) + r3 = addMul(r3, a3, b0) + r3 = addMul19(r3, a4, b4) // r4 = a0×b4 + a1×b3 + a2×b2 + a3×b1 + a4×b0 - r4 := mul64(a0, b4) - r4 = addMul64(r4, a1, b3) - r4 = addMul64(r4, a2, b2) - r4 = addMul64(r4, a3, b1) - r4 = addMul64(r4, a4, b0) + r4 := mul(a0, b4) + r4 = addMul(r4, a1, b3) + r4 = addMul(r4, a2, b2) + r4 = addMul(r4, a3, b1) + r4 = addMul(r4, a4, b0) // After the multiplication, we need to reduce (carry) the five coefficients // to obtain a result with limbs that are at most slightly larger than 2⁵¹, @@ -149,7 +166,7 @@ func feMulGeneric(v, a, b *Element) { c3 := shiftRightBy51(r3) c4 := shiftRightBy51(r4) - rr0 := r0.lo&maskLow51Bits + c4*19 + rr0 := r0.lo&maskLow51Bits + mul19(c4) rr1 := r1.lo&maskLow51Bits + c0 rr2 := r2.lo&maskLow51Bits + c1 rr3 := r3.lo&maskLow51Bits + c2 @@ -158,8 +175,12 @@ func feMulGeneric(v, a, b *Element) { // Now all coefficients fit into 64-bit registers but are still too large to // be passed around as an Element. We therefore do one last carry chain, // where the carries will be small enough to fit in the wiggle room above 2⁵¹. - *v = Element{rr0, rr1, rr2, rr3, rr4} - v.carryPropagate() + + v.l0 = rr0&maskLow51Bits + mul19(rr4>>51) + v.l1 = rr1&maskLow51Bits + rr0>>51 + v.l2 = rr2&maskLow51Bits + rr1>>51 + v.l3 = rr3&maskLow51Bits + rr2>>51 + v.l4 = rr4&maskLow51Bits + rr3>>51 } func feSquareGeneric(v, a *Element) { @@ -190,44 +211,31 @@ func feSquareGeneric(v, a *Element) { // l0l4 19×l4l4 19×l3l4 19×l2l4 19×l1l4 = // -------------------------------------- // r4 r3 r2 r1 r0 - // - // With precomputed 2×, 19×, and 2×19× terms, we can compute each limb with - // only three Mul64 and four Add64, instead of five and eight. - - l0_2 := l0 * 2 - l1_2 := l1 * 2 - - l1_38 := l1 * 38 - l2_38 := l2 * 38 - l3_38 := l3 * 38 - - l3_19 := l3 * 19 - l4_19 := l4 * 19 // r0 = l0×l0 + 19×(l1×l4 + l2×l3 + l3×l2 + l4×l1) = l0×l0 + 19×2×(l1×l4 + l2×l3) - r0 := mul64(l0, l0) - r0 = addMul64(r0, l1_38, l4) - r0 = addMul64(r0, l2_38, l3) + r0 := mul(l0, l0) + r0 = addMul38(r0, l1, l4) + r0 = addMul38(r0, l2, l3) // r1 = l0×l1 + l1×l0 + 19×(l2×l4 + l3×l3 + l4×l2) = 2×l0×l1 + 19×2×l2×l4 + 19×l3×l3 - r1 := mul64(l0_2, l1) - r1 = addMul64(r1, l2_38, l4) - r1 = addMul64(r1, l3_19, l3) + r1 := mul(l0*2, l1) + r1 = addMul38(r1, l2, l4) + r1 = addMul19(r1, l3, l3) // r2 = l0×l2 + l1×l1 + l2×l0 + 19×(l3×l4 + l4×l3) = 2×l0×l2 + l1×l1 + 19×2×l3×l4 - r2 := mul64(l0_2, l2) - r2 = addMul64(r2, l1, l1) - r2 = addMul64(r2, l3_38, l4) + r2 := mul(l0*2, l2) + r2 = addMul(r2, l1, l1) + r2 = addMul38(r2, l3, l4) // r3 = l0×l3 + l1×l2 + l2×l1 + l3×l0 + 19×l4×l4 = 2×l0×l3 + 2×l1×l2 + 19×l4×l4 - r3 := mul64(l0_2, l3) - r3 = addMul64(r3, l1_2, l2) - r3 = addMul64(r3, l4_19, l4) + r3 := mul(l0*2, l3) + r3 = addMul(r3, l1*2, l2) + r3 = addMul19(r3, l4, l4) // r4 = l0×l4 + l1×l3 + l2×l2 + l3×l1 + l4×l0 = 2×l0×l4 + 2×l1×l3 + l2×l2 - r4 := mul64(l0_2, l4) - r4 = addMul64(r4, l1_2, l3) - r4 = addMul64(r4, l2, l2) + r4 := mul(l0*2, l4) + r4 = addMul(r4, l1*2, l3) + r4 = addMul(r4, l2, l2) c0 := shiftRightBy51(r0) c1 := shiftRightBy51(r1) @@ -235,32 +243,30 @@ func feSquareGeneric(v, a *Element) { c3 := shiftRightBy51(r3) c4 := shiftRightBy51(r4) - rr0 := r0.lo&maskLow51Bits + c4*19 + rr0 := r0.lo&maskLow51Bits + mul19(c4) rr1 := r1.lo&maskLow51Bits + c0 rr2 := r2.lo&maskLow51Bits + c1 rr3 := r3.lo&maskLow51Bits + c2 rr4 := r4.lo&maskLow51Bits + c3 - *v = Element{rr0, rr1, rr2, rr3, rr4} - v.carryPropagate() + v.l0 = rr0&maskLow51Bits + mul19(rr4>>51) + v.l1 = rr1&maskLow51Bits + rr0>>51 + v.l2 = rr2&maskLow51Bits + rr1>>51 + v.l3 = rr3&maskLow51Bits + rr2>>51 + v.l4 = rr4&maskLow51Bits + rr3>>51 } -// carryPropagateGeneric brings the limbs below 52 bits by applying the reduction +// carryPropagate brings the limbs below 52 bits by applying the reduction // identity (a * 2²⁵⁵ + b = a * 19 + b) to the l4 carry. -func (v *Element) carryPropagateGeneric() *Element { - c0 := v.l0 >> 51 - c1 := v.l1 >> 51 - c2 := v.l2 >> 51 - c3 := v.l3 >> 51 - c4 := v.l4 >> 51 - - // c4 is at most 64 - 51 = 13 bits, so c4*19 is at most 18 bits, and +func (v *Element) carryPropagate() *Element { + // (l4>>51) is at most 64 - 51 = 13 bits, so (l4>>51)*19 is at most 18 bits, and // the final l0 will be at most 52 bits. Similarly for the rest. - v.l0 = v.l0&maskLow51Bits + c4*19 - v.l1 = v.l1&maskLow51Bits + c0 - v.l2 = v.l2&maskLow51Bits + c1 - v.l3 = v.l3&maskLow51Bits + c2 - v.l4 = v.l4&maskLow51Bits + c3 + l0 := v.l0 + v.l0 = v.l0&maskLow51Bits + mul19(v.l4>>51) + v.l4 = v.l4&maskLow51Bits + v.l3>>51 + v.l3 = v.l3&maskLow51Bits + v.l2>>51 + v.l2 = v.l2&maskLow51Bits + v.l1>>51 + v.l1 = v.l1&maskLow51Bits + l0>>51 return v } diff --git a/vendor/filippo.io/edwards25519/pull.sh b/vendor/filippo.io/edwards25519/pull.sh new file mode 100644 index 000000000..f6217c96e --- /dev/null +++ b/vendor/filippo.io/edwards25519/pull.sh @@ -0,0 +1,53 @@ +#!/usr/bin/env bash +set -euo pipefail + +if [ "$#" -ne 1 ]; then + echo "Usage: $0 " + exit 1 +fi + +TAG="$1" +TMPDIR="$(mktemp -d)" + +cleanup() { + rm -rf "$TMPDIR" +} +trap cleanup EXIT + +command -v git >/dev/null +command -v git-filter-repo >/dev/null + +if [ -d "$HOME/go/.git" ]; then + REFERENCE=(--reference "$HOME/go" --dissociate) +else + REFERENCE=() +fi + +git -c advice.detachedHead=false clone --no-checkout "${REFERENCE[@]}" \ + -b "$TAG" https://go.googlesource.com/go.git "$TMPDIR" + +# Simplify the history graph by removing the dev.boringcrypto branches, whose +# merges end up empty after grafting anyway. This also fixes a weird quirk +# (maybe a git-filter-repo bug?) where only one file from an old path, +# src/crypto/ed25519/internal/edwards25519/const.go, would still exist in the +# filtered repo. +git -C "$TMPDIR" replace --graft f771edd7f9 99f1bf54eb +git -C "$TMPDIR" replace --graft 109c13b64f c2f96e686f +git -C "$TMPDIR" replace --graft aa4da4f189 912f075047 + +git -C "$TMPDIR" filter-repo --force \ + --paths-from-file /dev/stdin \ + --prune-empty always \ + --prune-degenerate always \ + --tag-callback 'tag.skip()' <<'EOF' +src/crypto/internal/fips140/edwards25519 +src/crypto/internal/edwards25519 +src/crypto/ed25519/internal/edwards25519 +EOF + +git fetch "$TMPDIR" +git update-ref "refs/heads/upstream/$TAG" FETCH_HEAD + +echo +echo "Fetched upstream history up to $TAG. Merge with:" +echo -e "\tgit merge --no-ff --no-commit --allow-unrelated-histories upstream/$TAG" diff --git a/vendor/filippo.io/edwards25519/scalar.go b/vendor/filippo.io/edwards25519/scalar.go index 3fd165387..f08b26245 100644 --- a/vendor/filippo.io/edwards25519/scalar.go +++ b/vendor/filippo.io/edwards25519/scalar.go @@ -7,6 +7,7 @@ package edwards25519 import ( "encoding/binary" "errors" + "math/bits" ) // A Scalar is an integer modulo @@ -179,15 +180,23 @@ func isReduced(s []byte) bool { return false } - for i := len(s) - 1; i >= 0; i-- { - switch { - case s[i] > scalarMinusOneBytes[i]: - return false - case s[i] < scalarMinusOneBytes[i]: - return true - } - } - return true + s0 := binary.LittleEndian.Uint64(s[:8]) + s1 := binary.LittleEndian.Uint64(s[8:16]) + s2 := binary.LittleEndian.Uint64(s[16:24]) + s3 := binary.LittleEndian.Uint64(s[24:]) + + l0 := binary.LittleEndian.Uint64(scalarMinusOneBytes[:8]) + l1 := binary.LittleEndian.Uint64(scalarMinusOneBytes[8:16]) + l2 := binary.LittleEndian.Uint64(scalarMinusOneBytes[16:24]) + l3 := binary.LittleEndian.Uint64(scalarMinusOneBytes[24:]) + + // Do a constant time subtraction chain scalarMinusOneBytes - s. If there is + // a borrow at the end, then s > scalarMinusOneBytes. + _, b := bits.Sub64(l0, s0, 0) + _, b = bits.Sub64(l1, s1, b) + _, b = bits.Sub64(l2, s2, b) + _, b = bits.Sub64(l3, s3, b) + return b == 0 } // SetBytesWithClamping applies the buffer pruning described in RFC 8032, diff --git a/vendor/filippo.io/edwards25519/tables.go b/vendor/filippo.io/edwards25519/tables.go index 83234bbc0..4a2b54eba 100644 --- a/vendor/filippo.io/edwards25519/tables.go +++ b/vendor/filippo.io/edwards25519/tables.go @@ -4,9 +4,7 @@ package edwards25519 -import ( - "crypto/subtle" -) +import "crypto/subtle" // A dynamic lookup table for variable-base, constant-time scalar muls. type projLookupTable struct { diff --git a/vendor/github.com/antithesishq/antithesis-sdk-go/assert/assert.go b/vendor/github.com/antithesishq/antithesis-sdk-go/assert/assert.go index 3ede0101e..eff6fa96b 100644 --- a/vendor/github.com/antithesishq/antithesis-sdk-go/assert/assert.go +++ b/vendor/github.com/antithesishq/antithesis-sdk-go/assert/assert.go @@ -14,8 +14,8 @@ // // [Antithesis Go SDK]: https://antithesis.com/docs/using_antithesis/sdk/go/ // [Antithesis platform]: https://antithesis.com -// [test properties]: https://antithesis.com/docs/using_antithesis/properties/ -// [workload]: https://antithesis.com/docs/getting_started/first_test/ +// [test properties]: https://antithesis.com/docs/properties_assertions/properties/ +// [workload]: https://antithesis.com/docs/test_templates/first_test/ // [antithesis-go-generator]: https://antithesis.com/docs/using_antithesis/sdk/go/instrumentor/ // [triage report]: https://antithesis.com/docs/reports/ // [here]: https://antithesis.com/docs/using_antithesis/sdk/fallback/ diff --git a/vendor/github.com/antithesishq/antithesis-sdk-go/internal/sdk_const.go b/vendor/github.com/antithesishq/antithesis-sdk-go/internal/sdk_const.go index 5eccf1b58..e520f1520 100644 --- a/vendor/github.com/antithesishq/antithesis-sdk-go/internal/sdk_const.go +++ b/vendor/github.com/antithesishq/antithesis-sdk-go/internal/sdk_const.go @@ -3,7 +3,7 @@ package internal // -------------------------------------------------------------------------------- // Versions // -------------------------------------------------------------------------------- -const SDK_Version = "0.6.0" +const SDK_Version = "0.7.0" const Protocol_Version = "1.1.0" // -------------------------------------------------------------------------------- diff --git a/vendor/github.com/go-sql-driver/mysql/AUTHORS b/vendor/github.com/go-sql-driver/mysql/AUTHORS index ec346e203..42c7f02c0 100644 --- a/vendor/github.com/go-sql-driver/mysql/AUTHORS +++ b/vendor/github.com/go-sql-driver/mysql/AUTHORS @@ -18,8 +18,8 @@ Alex Snast Alexey Palazhchenko Andrew Reid Animesh Ray -Arne Hormann Ariel Mashraki +Arne Hormann Artur Melanchyk Asta Xie B Lamarche @@ -38,6 +38,7 @@ Daniel Montoya Daniel Nichter Daniël van Eeden Dave Protasowski +Demouth Diego Dupin Dirkjan Bussink DisposaBoy @@ -66,6 +67,7 @@ Jeff Hodges Jeffrey Charles Jennifer Purevsuren Jerome Meyer +Jiabin Zhang Jiajia Zhong Jian Zhen Joe Mann @@ -85,10 +87,12 @@ Linh Tran Tuan Lion Yang Luca Looz Lucas Liu -Lunny Xiao Luke Scott +Lunny Xiao Maciej Zimnoch Michael Woolnough +Minh Quang +Morgan Tocker Nao Yokotsuka Nathanial Murphy Nicola Peduzzi @@ -99,7 +103,6 @@ Paul Bonser Paulius Lozys Peter Schultz Phil Porada -Minh Quang Rebecca Chin Reed Allman Richard Wilkes @@ -134,6 +137,7 @@ Ziheng Lyu # Organizations Barracuda Networks, Inc. +Block, Inc. Counting Ltd. Defined Networking Inc. DigitalOcean Inc. diff --git a/vendor/github.com/go-sql-driver/mysql/CHANGELOG.md b/vendor/github.com/go-sql-driver/mysql/CHANGELOG.md index 75674b603..b24af9bed 100644 --- a/vendor/github.com/go-sql-driver/mysql/CHANGELOG.md +++ b/vendor/github.com/go-sql-driver/mysql/CHANGELOG.md @@ -1,13 +1,26 @@ # Changelog +## v1.10.0 (2026-04-28) + +* Fix `getSystemVar("max_allowed_packet")` potentially returned wrong value. (#1754) + This affects only when `maxAllowedPacket=0` is set. + +* Bump filippo.io/edwards25519 from 1.1.1 to 1.2.0. (#1756) + While older versions have reported CVEs, they do not affect go-mysql. + +* Update Go versions to 1.24-1.26. (#1763) + +* Enhance interpolateParams to correctly handle placeholders. (#1732) + The question mark (?) within strings and comments will no longer be treated as a placeholder. + + ## v1.9.3 (2025-06-13) * `tx.Commit()` and `tx.Rollback()` returned `ErrInvalidConn` always. Now they return cached real error if present. (#1690) -* Optimize reading small resultsets to fix performance regression - introduced by compression protocol support. (#1707) - +* Optimize reading small result sets to fix a performance regression + introduced by compression protocol support. (`#1707`) * Fix `db.Ping()` on compressed connection. (#1723) diff --git a/vendor/github.com/go-sql-driver/mysql/README.md b/vendor/github.com/go-sql-driver/mysql/README.md index da4593ccf..3da0538c7 100644 --- a/vendor/github.com/go-sql-driver/mysql/README.md +++ b/vendor/github.com/go-sql-driver/mysql/README.md @@ -1,5 +1,8 @@ # Go-MySQL-Driver +[![DeepWiki](https://img.shields.io/badge/DeepWiki-go--sql--driver%2Fmysql-blue.svg?logo=data:image/png;base64,iVBORw0KGgoAAAANSUhEUgAAACwAAAAyCAYAAAAnWDnqAAAAAXNSR0IArs4c6QAAA05JREFUaEPtmUtyEzEQhtWTQyQLHNak2AB7ZnyXZMEjXMGeK/AIi+QuHrMnbChYY7MIh8g01fJoopFb0uhhEqqcbWTp06/uv1saEDv4O3n3dV60RfP947Mm9/SQc0ICFQgzfc4CYZoTPAswgSJCCUJUnAAoRHOAUOcATwbmVLWdGoH//PB8mnKqScAhsD0kYP3j/Yt5LPQe2KvcXmGvRHcDnpxfL2zOYJ1mFwrryWTz0advv1Ut4CJgf5uhDuDj5eUcAUoahrdY/56ebRWeraTjMt/00Sh3UDtjgHtQNHwcRGOC98BJEAEymycmYcWwOprTgcB6VZ5JK5TAJ+fXGLBm3FDAmn6oPPjR4rKCAoJCal2eAiQp2x0vxTPB3ALO2CRkwmDy5WohzBDwSEFKRwPbknEggCPB/imwrycgxX2NzoMCHhPkDwqYMr9tRcP5qNrMZHkVnOjRMWwLCcr8ohBVb1OMjxLwGCvjTikrsBOiA6fNyCrm8V1rP93iVPpwaE+gO0SsWmPiXB+jikdf6SizrT5qKasx5j8ABbHpFTx+vFXp9EnYQmLx02h1QTTrl6eDqxLnGjporxl3NL3agEvXdT0WmEost648sQOYAeJS9Q7bfUVoMGnjo4AZdUMQku50McDcMWcBPvr0SzbTAFDfvJqwLzgxwATnCgnp4wDl6Aa+Ax283gghmj+vj7feE2KBBRMW3FzOpLOADl0Isb5587h/U4gGvkt5v60Z1VLG8BhYjbzRwyQZemwAd6cCR5/XFWLYZRIMpX39AR0tjaGGiGzLVyhse5C9RKC6ai42ppWPKiBagOvaYk8lO7DajerabOZP46Lby5wKjw1HCRx7p9sVMOWGzb/vA1hwiWc6jm3MvQDTogQkiqIhJV0nBQBTU+3okKCFDy9WwferkHjtxib7t3xIUQtHxnIwtx4mpg26/HfwVNVDb4oI9RHmx5WGelRVlrtiw43zboCLaxv46AZeB3IlTkwouebTr1y2NjSpHz68WNFjHvupy3q8TFn3Hos2IAk4Ju5dCo8B3wP7VPr/FGaKiG+T+v+TQqIrOqMTL1VdWV1DdmcbO8KXBz6esmYWYKPwDL5b5FA1a0hwapHiom0r/cKaoqr+27/XcrS5UwSMbQAAAABJRU5ErkJggg==)](https://deepwiki.com/go-sql-driver/mysql) + + A MySQL-Driver for Go's [database/sql](https://golang.org/pkg/database/sql/) package ![Go-MySQL-Driver logo](https://raw.github.com/wiki/go-sql-driver/mysql/gomysql_m.png "Golang Gopher holding the MySQL Dolphin") @@ -42,8 +45,8 @@ A MySQL-Driver for Go's [database/sql](https://golang.org/pkg/database/sql/) pac ## Requirements -* Go 1.21 or higher. We aim to support the 3 latest versions of Go. -* MySQL (5.7+) and MariaDB (10.5+) are supported. +* Go 1.24 or higher. We aim to support the 3 latest versions of Go. +* MySQL (5.7+) and MariaDB (10.5+) are supported by maintainers. * [TiDB](https://github.com/pingcap/tidb) is supported by PingCAP. * Do not ask questions about TiDB in our issue tracker or forum. * [Document](https://docs.pingcap.com/tidb/v6.1/dev-guide-sample-application-golang) diff --git a/vendor/github.com/go-sql-driver/mysql/auth.go b/vendor/github.com/go-sql-driver/mysql/auth.go index 74e1bd03e..610044fc1 100644 --- a/vendor/github.com/go-sql-driver/mysql/auth.go +++ b/vendor/github.com/go-sql-driver/mysql/auth.go @@ -305,7 +305,7 @@ func (mc *mysqlConn) auth(authData []byte, plugin string) ([]byte, error) { if !mc.cfg.AllowNativePasswords { return nil, ErrNativePassword } - // https://dev.mysql.com/doc/internals/en/secure-password-authentication.html + // https://dev.mysql.com/doc/dev/mysql-server/8.4.5/page_protocol_connection_phase_authentication_methods_native_password_authentication.html // Native password authentication only need and will need 20-byte challenge. authResp := scramblePassword(authData[:20], mc.cfg.Passwd) return authResp, nil diff --git a/vendor/github.com/go-sql-driver/mysql/conncheck.go b/vendor/github.com/go-sql-driver/mysql/conncheck.go index 0ea721720..f9c5cb65c 100644 --- a/vendor/github.com/go-sql-driver/mysql/conncheck.go +++ b/vendor/github.com/go-sql-driver/mysql/conncheck.go @@ -7,7 +7,6 @@ // You can obtain one at http://mozilla.org/MPL/2.0/. //go:build linux || darwin || dragonfly || freebsd || netbsd || openbsd || solaris || illumos -// +build linux darwin dragonfly freebsd netbsd openbsd solaris illumos package mysql diff --git a/vendor/github.com/go-sql-driver/mysql/conncheck_dummy.go b/vendor/github.com/go-sql-driver/mysql/conncheck_dummy.go index a56c138f2..0ebf05c21 100644 --- a/vendor/github.com/go-sql-driver/mysql/conncheck_dummy.go +++ b/vendor/github.com/go-sql-driver/mysql/conncheck_dummy.go @@ -7,7 +7,6 @@ // You can obtain one at http://mozilla.org/MPL/2.0/. //go:build !linux && !darwin && !dragonfly && !freebsd && !netbsd && !openbsd && !solaris && !illumos -// +build !linux,!darwin,!dragonfly,!freebsd,!netbsd,!openbsd,!solaris,!illumos package mysql diff --git a/vendor/github.com/go-sql-driver/mysql/connection.go b/vendor/github.com/go-sql-driver/mysql/connection.go index 3e455a3ff..65204e2d2 100644 --- a/vendor/github.com/go-sql-driver/mysql/connection.go +++ b/vendor/github.com/go-sql-driver/mysql/connection.go @@ -33,7 +33,8 @@ type mysqlConn struct { connector *connector maxAllowedPacket int maxWriteSize int - flags clientFlag + capabilities capabilityFlag + extCapabilities extendedCapabilityFlag status statusFlag sequence uint8 compressSequence uint8 @@ -171,7 +172,7 @@ func (mc *mysqlConn) close() { } // Closes the network connection and unsets internal variables. Do not call this -// function after successfully authentication, call Close instead. This function +// function after successful authentication, call Close instead. This function // is called before auth or on auth failure because MySQL will have already // closed the network connection. func (mc *mysqlConn) cleanup() { @@ -223,13 +224,21 @@ func (mc *mysqlConn) Prepare(query string) (driver.Stmt, error) { columnCount, err := stmt.readPrepareResultPacket() if err == nil { if stmt.paramCount > 0 { - if err = mc.readUntilEOF(); err != nil { + if err = mc.skipColumns(stmt.paramCount); err != nil { return nil, err } } if columnCount > 0 { - err = mc.readUntilEOF() + if mc.extCapabilities&clientCacheMetadata != 0 { + if stmt.columns, err = mc.readColumns(int(columnCount), nil); err != nil { + return nil, err + } + } else { + if err = mc.skipColumns(int(columnCount)); err != nil { + return nil, err + } + } } } @@ -237,100 +246,184 @@ func (mc *mysqlConn) Prepare(query string) (driver.Stmt, error) { } func (mc *mysqlConn) interpolateParams(query string, args []driver.Value) (string, error) { - // Number of ? should be same to len(args) - if strings.Count(query, "?") != len(args) { - return "", driver.ErrSkip - } + noBackslashEscapes := (mc.status & statusNoBackslashEscapes) != 0 + const ( + stateNormal = iota + stateString + stateEscape + stateEOLComment + stateSlashStarComment + stateBacktick + ) + + const ( + QUOTE_BYTE = byte('\'') + DBL_QUOTE_BYTE = byte('"') + BACKSLASH_BYTE = byte('\\') + QUESTION_MARK_BYTE = byte('?') + SLASH_BYTE = byte('/') + STAR_BYTE = byte('*') + HASH_BYTE = byte('#') + MINUS_BYTE = byte('-') + LINE_FEED_BYTE = byte('\n') + BACKTICK_BYTE = byte('`') + ) buf, err := mc.buf.takeCompleteBuffer() if err != nil { - // can not take the buffer. Something must be wrong with the connection mc.cleanup() - // interpolateParams would be called before sending any query. - // So its safe to retry. return "", driver.ErrBadConn } buf = buf[:0] + state := stateNormal + singleQuotes := false + lastChar := byte(0) argPos := 0 + lenQuery := len(query) + lastIdx := 0 - for i := 0; i < len(query); i++ { - q := strings.IndexByte(query[i:], '?') - if q == -1 { - buf = append(buf, query[i:]...) - break - } - buf = append(buf, query[i:i+q]...) - i += q - - arg := args[argPos] - argPos++ - - if arg == nil { - buf = append(buf, "NULL"...) + for i := range lenQuery { + currentChar := query[i] + if state == stateEscape && !((currentChar == QUOTE_BYTE && singleQuotes) || (currentChar == DBL_QUOTE_BYTE && !singleQuotes)) { + state = stateString + lastChar = currentChar continue } - - switch v := arg.(type) { - case int64: - buf = strconv.AppendInt(buf, v, 10) - case uint64: - // Handle uint64 explicitly because our custom ConvertValue emits unsigned values - buf = strconv.AppendUint(buf, v, 10) - case float64: - buf = strconv.AppendFloat(buf, v, 'g', -1, 64) - case bool: - if v { - buf = append(buf, '1') - } else { - buf = append(buf, '0') + switch currentChar { + case STAR_BYTE: + if state == stateNormal && lastChar == SLASH_BYTE { + state = stateSlashStarComment } - case time.Time: - if v.IsZero() { - buf = append(buf, "'0000-00-00'"...) - } else { - buf = append(buf, '\'') - buf, err = appendDateTime(buf, v.In(mc.cfg.Loc), mc.cfg.timeTruncate) - if err != nil { - return "", err - } - buf = append(buf, '\'') + case SLASH_BYTE: + if state == stateSlashStarComment && lastChar == STAR_BYTE { + state = stateNormal + // Clear lastChar so the '/' that closed the comment isn't + // reused to start a new comment with a following '*'. + lastChar = 0 + continue } - case json.RawMessage: - buf = append(buf, '\'') - if mc.status&statusNoBackslashEscapes == 0 { - buf = escapeBytesBackslash(buf, v) - } else { - buf = escapeBytesQuotes(buf, v) + case HASH_BYTE: + if state == stateNormal { + state = stateEOLComment } - buf = append(buf, '\'') - case []byte: - if v == nil { - buf = append(buf, "NULL"...) - } else { - buf = append(buf, "_binary'"...) - if mc.status&statusNoBackslashEscapes == 0 { - buf = escapeBytesBackslash(buf, v) + case MINUS_BYTE: + if state == stateNormal && lastChar == MINUS_BYTE { + // -- only starts a comment if followed by whitespace or control char + if i+1 < lenQuery { + nextChar := query[i+1] + if nextChar == ' ' || nextChar == '\t' || nextChar == '\n' || nextChar == '\r' { + state = stateEOLComment + } } else { - buf = escapeBytesQuotes(buf, v) + state = stateEOLComment } - buf = append(buf, '\'') } - case string: - buf = append(buf, '\'') - if mc.status&statusNoBackslashEscapes == 0 { - buf = escapeStringBackslash(buf, v) - } else { - buf = escapeStringQuotes(buf, v) + case LINE_FEED_BYTE: + if state == stateEOLComment { + state = stateNormal } - buf = append(buf, '\'') - default: - return "", driver.ErrSkip - } + case DBL_QUOTE_BYTE: + if state == stateNormal { + state = stateString + singleQuotes = false + } else if state == stateString && !singleQuotes { + state = stateNormal + } else if state == stateEscape { + state = stateString + } + case QUOTE_BYTE: + if state == stateNormal { + state = stateString + singleQuotes = true + } else if state == stateString && singleQuotes { + state = stateNormal + } else if state == stateEscape { + state = stateString + } + case BACKSLASH_BYTE: + if state == stateString && !noBackslashEscapes { + state = stateEscape + } + case QUESTION_MARK_BYTE: + if state == stateNormal { + if argPos >= len(args) { + return "", driver.ErrSkip + } + buf = append(buf, query[lastIdx:i]...) + arg := args[argPos] + argPos++ - if len(buf)+4 > mc.maxAllowedPacket { - return "", driver.ErrSkip + if arg == nil { + buf = append(buf, "NULL"...) + lastIdx = i + 1 + break + } + + switch v := arg.(type) { + case int64: + buf = strconv.AppendInt(buf, v, 10) + case uint64: + buf = strconv.AppendUint(buf, v, 10) + case float64: + buf = strconv.AppendFloat(buf, v, 'g', -1, 64) + case bool: + if v { + buf = append(buf, '1') + } else { + buf = append(buf, '0') + } + case time.Time: + if v.IsZero() { + buf = append(buf, "'0000-00-00'"...) + } else { + buf = append(buf, '\'') + buf, err = appendDateTime(buf, v.In(mc.cfg.Loc), mc.cfg.timeTruncate) + if err != nil { + return "", err + } + buf = append(buf, '\'') + } + case json.RawMessage: + if noBackslashEscapes { + buf = escapeBytesQuotes(buf, v, false) + } else { + buf = escapeBytesBackslash(buf, v, false) + } + case []byte: + if v == nil { + buf = append(buf, "NULL"...) + } else { + if noBackslashEscapes { + buf = escapeBytesQuotes(buf, v, true) + } else { + buf = escapeBytesBackslash(buf, v, true) + } + } + case string: + if noBackslashEscapes { + buf = escapeStringQuotes(buf, v) + } else { + buf = escapeStringBackslash(buf, v) + } + default: + return "", driver.ErrSkip + } + + if len(buf)+4 > mc.maxAllowedPacket { + return "", driver.ErrSkip + } + lastIdx = i + 1 + } + case BACKTICK_BYTE: + if state == stateBacktick { + state = stateNormal + } else if state == stateNormal { + state = stateBacktick + } } + lastChar = currentChar } + buf = append(buf, query[lastIdx:]...) if argPos != len(args) { return "", driver.ErrSkip } @@ -370,19 +463,19 @@ func (mc *mysqlConn) exec(query string) error { } // Read Result - resLen, err := handleOk.readResultSetHeaderPacket() + resLen, _, err := handleOk.readResultSetHeaderPacket() if err != nil { return err } if resLen > 0 { // columns - if err := mc.readUntilEOF(); err != nil { + if err := mc.skipColumns(resLen); err != nil { return err } // rows - if err := mc.readUntilEOF(); err != nil { + if err := mc.skipRows(); err != nil { return err } } @@ -419,7 +512,7 @@ func (mc *mysqlConn) query(query string, args []driver.Value) (*textRows, error) // Read Result var resLen int - resLen, err = handleOk.readResultSetHeaderPacket() + resLen, _, err = handleOk.readResultSetHeaderPacket() if err != nil { return nil, err } @@ -439,21 +532,20 @@ func (mc *mysqlConn) query(query string, args []driver.Value) (*textRows, error) } // Columns - rows.rs.columns, err = mc.readColumns(resLen) + rows.rs.columns, err = mc.readColumns(resLen, nil) return rows, err } // Gets the value of the given MySQL System Variable -// The returned byte slice is only valid until the next read -func (mc *mysqlConn) getSystemVar(name string) ([]byte, error) { +func (mc *mysqlConn) getSystemVar(name string) (string, error) { // Send command handleOk := mc.clearResult() if err := mc.writeCommandPacketStr(comQuery, "SELECT @@"+name); err != nil { - return nil, err + return "", err } // Read Result - resLen, err := handleOk.readResultSetHeaderPacket() + resLen, _, err := handleOk.readResultSetHeaderPacket() if err == nil { rows := new(textRows) rows.mc = mc @@ -461,17 +553,20 @@ func (mc *mysqlConn) getSystemVar(name string) ([]byte, error) { if resLen > 0 { // Columns - if err := mc.readUntilEOF(); err != nil { - return nil, err + if err := mc.skipColumns(resLen); err != nil { + return "", err } } dest := make([]driver.Value, resLen) if err = rows.readRow(dest); err == nil { - return dest[0].([]byte), mc.readUntilEOF() + // Convert to string before skipRows, which may + // overwrite the read buffer that dest[0] points into. + val := string(dest[0].([]byte)) + return val, mc.skipRows() } } - return nil, err + return "", err } // cancel is called when the query has canceled. diff --git a/vendor/github.com/go-sql-driver/mysql/connector.go b/vendor/github.com/go-sql-driver/mysql/connector.go index bc1d46afc..3d3760477 100644 --- a/vendor/github.com/go-sql-driver/mysql/connector.go +++ b/vendor/github.com/go-sql-driver/mysql/connector.go @@ -42,7 +42,7 @@ func encodeConnectionAttributes(cfg *Config) string { } // user-defined connection attributes - for _, connAttr := range strings.Split(cfg.ConnectionAttributes, ",") { + for connAttr := range strings.SplitSeq(cfg.ConnectionAttributes, ",") { k, v, found := strings.Cut(connAttr, ":") if !found { continue @@ -131,7 +131,7 @@ func (c *connector) Connect(ctx context.Context) (driver.Conn, error) { mc.buf = newBuffer() // Reading Handshake Initialization Packet - authData, plugin, err := mc.readHandshakePacket() + authData, serverCapabilities, serverExtCapabilities, plugin, err := mc.readHandshakePacket() if err != nil { mc.cleanup() return nil, err @@ -153,6 +153,7 @@ func (c *connector) Connect(ctx context.Context) (driver.Conn, error) { return nil, err } } + mc.initCapabilities(serverCapabilities, serverExtCapabilities, mc.cfg) if err = mc.writeHandshakeResponsePacket(authResp, plugin); err != nil { mc.cleanup() return nil, err @@ -161,13 +162,14 @@ func (c *connector) Connect(ctx context.Context) (driver.Conn, error) { // Handle response to auth packet, switch methods if possible if err = mc.handleAuthResult(authData, plugin); err != nil { // Authentication failed and MySQL has already closed the connection - // (https://dev.mysql.com/doc/internals/en/authentication-fails.html). + // (https://dev.mysql.com/doc/dev/mysql-server/latest/page_protocol_connection_phase.html#sect_protocol_connection_phase_fast_path_fails). // Do not send COM_QUIT, just cleanup and return the error. mc.cleanup() return nil, err } - if mc.cfg.compress && mc.flags&clientCompress == clientCompress { + // compression is enabled after auth, not right after sending handshake response. + if mc.capabilities&clientCompress > 0 { mc.compress = true mc.compIO = newCompIO(mc) } @@ -180,7 +182,7 @@ func (c *connector) Connect(ctx context.Context) (driver.Conn, error) { mc.Close() return nil, err } - n, err := strconv.Atoi(string(maxap)) + n, err := strconv.Atoi(maxap) if err != nil { mc.Close() return nil, fmt.Errorf("invalid max_allowed_packet value (%q): %w", maxap, err) diff --git a/vendor/github.com/go-sql-driver/mysql/const.go b/vendor/github.com/go-sql-driver/mysql/const.go index 4aadcd642..6f0cdf303 100644 --- a/vendor/github.com/go-sql-driver/mysql/const.go +++ b/vendor/github.com/go-sql-driver/mysql/const.go @@ -32,7 +32,7 @@ const ( ) // MySQL constants documentation: -// http://dev.mysql.com/doc/internals/en/client-server-protocol.html +// https://dev.mysql.com/doc/dev/mysql-server/latest/PAGE_PROTOCOL.html const ( iOK byte = 0x00 @@ -42,11 +42,12 @@ const ( iERR byte = 0xff ) -// https://dev.mysql.com/doc/internals/en/capability-flags.html#packet-Protocol::CapabilityFlags -type clientFlag uint32 +// https://dev.mysql.com/doc/dev/mysql-server/latest/group__group__cs__capabilities__flags.html +// https://mariadb.com/kb/en/connection/#capabilities +type capabilityFlag uint32 const ( - clientLongPassword clientFlag = 1 << iota + clientMySQL capabilityFlag = 1 << iota clientFoundRows clientLongFlag clientConnectWithDB @@ -73,6 +74,18 @@ const ( clientDeprecateEOF ) +// https://mariadb.com/kb/en/connection/#capabilities +type extendedCapabilityFlag uint32 + +const ( + progressIndicator extendedCapabilityFlag = 1 << iota + clientComMulti + clientStmtBulkOperations + clientExtendedMetadata + clientCacheMetadata + clientUnitBulkResult +) + const ( comQuit byte = iota + 1 comInitDB diff --git a/vendor/github.com/go-sql-driver/mysql/dsn.go b/vendor/github.com/go-sql-driver/mysql/dsn.go index ecf62567a..491e10f37 100644 --- a/vendor/github.com/go-sql-driver/mysql/dsn.go +++ b/vendor/github.com/go-sql-driver/mysql/dsn.go @@ -15,6 +15,7 @@ import ( "crypto/tls" "errors" "fmt" + "maps" "math/big" "net" "net/url" @@ -157,9 +158,7 @@ func (cfg *Config) Clone() *Config { } if len(cp.Params) > 0 { cp.Params = make(map[string]string, len(cfg.Params)) - for k, v := range cfg.Params { - cp.Params[k] = v - } + maps.Copy(cp.Params, cfg.Params) } if cfg.pubKey != nil { cp.pubKey = &rsa.PublicKey{ @@ -414,7 +413,7 @@ func ParseDSN(dsn string) (cfg *Config, err error) { if dsn[j] == '@' { // username[:password] // Find the first ':' in dsn[:j] - for k = 0; k < j; k++ { + for k = 0; k < j; k++ { // We cannot use k = range j here, because we use dsn[:k] below if dsn[k] == ':' { cfg.Passwd = dsn[k+1 : j] break @@ -477,7 +476,7 @@ func ParseDSN(dsn string) (cfg *Config, err error) { // parseDSNParams parses the DSN "query string" // Values must be url.QueryEscape'ed func parseDSNParams(cfg *Config, params string) (err error) { - for _, v := range strings.Split(params, "&") { + for v := range strings.SplitSeq(params, "&") { key, value, found := strings.Cut(v, "=") if !found { continue diff --git a/vendor/github.com/go-sql-driver/mysql/fields.go b/vendor/github.com/go-sql-driver/mysql/fields.go index be5cd809a..ee9d96417 100644 --- a/vendor/github.com/go-sql-driver/mysql/fields.go +++ b/vendor/github.com/go-sql-driver/mysql/fields.go @@ -120,23 +120,24 @@ func (mf *mysqlField) typeDatabaseName() string { } var ( - scanTypeFloat32 = reflect.TypeOf(float32(0)) - scanTypeFloat64 = reflect.TypeOf(float64(0)) - scanTypeInt8 = reflect.TypeOf(int8(0)) - scanTypeInt16 = reflect.TypeOf(int16(0)) - scanTypeInt32 = reflect.TypeOf(int32(0)) - scanTypeInt64 = reflect.TypeOf(int64(0)) - scanTypeNullFloat = reflect.TypeOf(sql.NullFloat64{}) - scanTypeNullInt = reflect.TypeOf(sql.NullInt64{}) - scanTypeNullTime = reflect.TypeOf(sql.NullTime{}) - scanTypeUint8 = reflect.TypeOf(uint8(0)) - scanTypeUint16 = reflect.TypeOf(uint16(0)) - scanTypeUint32 = reflect.TypeOf(uint32(0)) - scanTypeUint64 = reflect.TypeOf(uint64(0)) - scanTypeString = reflect.TypeOf("") - scanTypeNullString = reflect.TypeOf(sql.NullString{}) - scanTypeBytes = reflect.TypeOf([]byte{}) - scanTypeUnknown = reflect.TypeOf(new(any)) + scanTypeFloat32 = reflect.TypeFor[float32]() + scanTypeFloat64 = reflect.TypeFor[float64]() + scanTypeInt8 = reflect.TypeFor[int8]() + scanTypeInt16 = reflect.TypeFor[int16]() + scanTypeInt32 = reflect.TypeFor[int32]() + scanTypeInt64 = reflect.TypeFor[int64]() + scanTypeNullFloat = reflect.TypeFor[sql.NullFloat64]() + scanTypeNullInt = reflect.TypeFor[sql.NullInt64]() + scanTypeNullUint = reflect.TypeFor[sql.Null[uint64]]() + scanTypeNullTime = reflect.TypeFor[sql.NullTime]() + scanTypeUint8 = reflect.TypeFor[uint8]() + scanTypeUint16 = reflect.TypeFor[uint16]() + scanTypeUint32 = reflect.TypeFor[uint32]() + scanTypeUint64 = reflect.TypeFor[uint64]() + scanTypeString = reflect.TypeFor[string]() + scanTypeNullString = reflect.TypeFor[sql.NullString]() + scanTypeBytes = reflect.TypeFor[[]byte]() + scanTypeUnknown = reflect.TypeFor[*any]() ) type mysqlField struct { @@ -185,6 +186,9 @@ func (mf *mysqlField) scanType() reflect.Type { } return scanTypeInt64 } + if mf.flags&flagUnsigned != 0 { + return scanTypeNullUint + } return scanTypeNullInt case fieldTypeFloat: diff --git a/vendor/github.com/go-sql-driver/mysql/infile.go b/vendor/github.com/go-sql-driver/mysql/infile.go index 453ae091e..597b5e7f6 100644 --- a/vendor/github.com/go-sql-driver/mysql/infile.go +++ b/vendor/github.com/go-sql-driver/mysql/infile.go @@ -95,10 +95,7 @@ const defaultPacketSize = 16 * 1024 // 16KB is small enough for disk readahead a func (mc *okHandler) handleInFileRequest(name string) (err error) { var rdr io.Reader - packetSize := defaultPacketSize - if mc.maxWriteSize < packetSize { - packetSize = mc.maxWriteSize - } + packetSize := min(mc.maxWriteSize, defaultPacketSize) if idx := strings.Index(name, "Reader::"); idx == 0 || (idx > 0 && name[idx-1] == '/') { // io.Reader // The server might return an an absolute path. See issue #355. diff --git a/vendor/github.com/go-sql-driver/mysql/packets.go b/vendor/github.com/go-sql-driver/mysql/packets.go index 831fca6ca..d0b21b06c 100644 --- a/vendor/github.com/go-sql-driver/mysql/packets.go +++ b/vendor/github.com/go-sql-driver/mysql/packets.go @@ -179,20 +179,22 @@ func (mc *mysqlConn) writePacket(data []byte) error { ******************************************************************************/ // Handshake Initialization Packet -// http://dev.mysql.com/doc/internals/en/connection-phase-packets.html#packet-Protocol::Handshake -func (mc *mysqlConn) readHandshakePacket() (data []byte, plugin string, err error) { +// https://dev.mysql.com/doc/dev/mysql-server/latest/page_protocol_connection_phase_packets_protocol_handshake_v10.html +// https://mariadb.com/kb/en/connection/#initial-handshake-packet +func (mc *mysqlConn) readHandshakePacket() (data []byte, capabilities capabilityFlag, extendedCapabilities extendedCapabilityFlag, plugin string, err error) { data, err = mc.readPacket() if err != nil { return } if data[0] == iERR { - return nil, "", mc.handleErrorPacket(data) + err = mc.handleErrorPacket(data) + return } // protocol version [1 byte] if data[0] < minProtocolVersion { - return nil, "", fmt.Errorf( + return nil, 0, 0, "", fmt.Errorf( "unsupported protocol version %d. Version %d or higher is required", data[0], minProtocolVersion, @@ -210,15 +212,15 @@ func (mc *mysqlConn) readHandshakePacket() (data []byte, plugin string, err erro pos += 8 + 1 // capability flags (lower 2 bytes) [2 bytes] - mc.flags = clientFlag(binary.LittleEndian.Uint16(data[pos : pos+2])) - if mc.flags&clientProtocol41 == 0 { - return nil, "", ErrOldProtocol + capabilities = capabilityFlag(binary.LittleEndian.Uint16(data[pos : pos+2])) + if capabilities&clientProtocol41 == 0 { + return nil, capabilities, 0, "", ErrOldProtocol } - if mc.flags&clientSSL == 0 && mc.cfg.TLS != nil { + if capabilities&clientSSL == 0 && mc.cfg.TLS != nil { if mc.cfg.AllowFallbackToPlaintext { mc.cfg.TLS = nil } else { - return nil, "", ErrNoTLS + return nil, capabilities, 0, "", ErrNoTLS } } pos += 2 @@ -228,11 +230,16 @@ func (mc *mysqlConn) readHandshakePacket() (data []byte, plugin string, err erro // status flags [2 bytes] pos += 3 // capability flags (upper 2 bytes) [2 bytes] - mc.flags |= clientFlag(binary.LittleEndian.Uint16(data[pos:pos+2])) << 16 + capabilities |= capabilityFlag(binary.LittleEndian.Uint16(data[pos:pos+2])) << 16 pos += 2 // length of auth-plugin-data [1 byte] - // reserved (all [00]) [10 bytes] - pos += 11 + // reserved (all [00]) [6 bytes] + pos += 7 + if capabilities&clientMySQL == 0 { + // MariaDB server extended flag + extendedCapabilities = extendedCapabilityFlag(binary.LittleEndian.Uint32(data[pos : pos+4])) + } + pos += 4 // second part of the password cipher [minimum 13 bytes], // where len=MAX(13, length of auth-plugin-data - 8) @@ -260,82 +267,72 @@ func (mc *mysqlConn) readHandshakePacket() (data []byte, plugin string, err erro // make a memory safe copy of the cipher slice var b [20]byte copy(b[:], authData) - return b[:], plugin, nil + return b[:], capabilities, extendedCapabilities, plugin, nil } // make a memory safe copy of the cipher slice var b [8]byte copy(b[:], authData) - return b[:], plugin, nil + return b[:], capabilities, 0, plugin, nil } -// Client Authentication Packet -// http://dev.mysql.com/doc/internals/en/connection-phase-packets.html#packet-Protocol::HandshakeResponse -func (mc *mysqlConn) writeHandshakeResponsePacket(authResp []byte, plugin string) error { - // Adjust client flags based on server support - clientFlags := clientProtocol41 | - clientSecureConn | - clientLongPassword | - clientTransactions | - clientLocalFiles | - clientPluginAuth | - clientMultiResults | - mc.flags&clientConnectAttrs | - mc.flags&clientLongFlag +// initCapabilities initializes the capabilities based on server support and configuration +func (mc *mysqlConn) initCapabilities(serverCapabilities capabilityFlag, serverExtCapabilities extendedCapabilityFlag, cfg *Config) { + clientCapabilities := + clientMySQL | + clientLongFlag | + clientProtocol41 | + clientSecureConn | + clientTransactions | + clientPluginAuthLenEncClientData | + clientLocalFiles | + clientPluginAuth | + clientMultiResults | + clientConnectAttrs | + clientDeprecateEOF - sendConnectAttrs := mc.flags&clientConnectAttrs != 0 - - if mc.cfg.ClientFoundRows { - clientFlags |= clientFoundRows + if cfg.ClientFoundRows { + clientCapabilities |= clientFoundRows } - if mc.cfg.compress && mc.flags&clientCompress == clientCompress { - clientFlags |= clientCompress + if cfg.compress { + clientCapabilities |= clientCompress } // To enable TLS / SSL if mc.cfg.TLS != nil { - clientFlags |= clientSSL + clientCapabilities |= clientSSL } if mc.cfg.MultiStatements { - clientFlags |= clientMultiStatements + clientCapabilities |= clientMultiStatements + } + if n := len(cfg.DBName); n > 0 { + clientCapabilities |= clientConnectWithDB } - // encode length of the auth plugin data - var authRespLEIBuf [9]byte - authRespLen := len(authResp) - authRespLEI := appendLengthEncodedInteger(authRespLEIBuf[:0], uint64(authRespLen)) - if len(authRespLEI) > 1 { - // if the length can not be written in 1 byte, it must be written as a - // length encoded integer - clientFlags |= clientPluginAuthLenEncClientData - } + // only keep client capabilities that server have + mc.capabilities = clientCapabilities & serverCapabilities - pktLen := 4 + 4 + 1 + 23 + len(mc.cfg.User) + 1 + len(authRespLEI) + len(authResp) + 21 + 1 + // set MariaDB extended clientCacheMetadata capability if server support it + mc.extCapabilities = clientCacheMetadata & serverExtCapabilities +} - // To specify a db name - if n := len(mc.cfg.DBName); n > 0 { - clientFlags |= clientConnectWithDB - pktLen += n + 1 - } - - // encode length of the connection attributes - var connAttrsLEI []byte - if sendConnectAttrs { - var connAttrsLEIBuf [9]byte - connAttrsLen := len(mc.connector.encodedAttributes) - connAttrsLEI = appendLengthEncodedInteger(connAttrsLEIBuf[:0], uint64(connAttrsLen)) - pktLen += len(connAttrsLEI) + len(mc.connector.encodedAttributes) - } - - // Calculate packet length and get buffer with that size - data, err := mc.buf.takeBuffer(pktLen + 4) +// Client Authentication Packet +// https://dev.mysql.com/doc/dev/mysql-server/latest/page_protocol_connection_phase_packets_protocol_handshake_response.html +func (mc *mysqlConn) writeHandshakeResponsePacket(authResp []byte, plugin string) error { + // packet header 4 + // capabilities 4 + // maxPacketSize 4 + // collation id 1 + // filler 23 + data, err := mc.buf.takeSmallBuffer(4*3 + 24) if err != nil { mc.cleanup() return err } + _ = data[4*3+23] // boundery check - // ClientFlags [32 bit] - binary.LittleEndian.PutUint32(data[4:], uint32(clientFlags)) + // clientCapabilities [32 bit] + binary.LittleEndian.PutUint32(data[4:], uint32(mc.capabilities)) // MaxPacketSize [32 bit] (none) binary.LittleEndian.PutUint32(data[8:], 0) @@ -353,16 +350,26 @@ func (mc *mysqlConn) writeHandshakeResponsePacket(authResp []byte, plugin string } // Filler [23 bytes] (all 0x00) + // or filler 19bytes + mariadb extCapabilities pos := 13 - for ; pos < 13+23; pos++ { - data[pos] = 0 + if mc.capabilities&clientMySQL == 0 { + for ; pos < 13+19; pos++ { + data[pos] = 0 + } + // MariaDB Extended Capabilities + binary.LittleEndian.PutUint32(data[13+19:], uint32(mc.extCapabilities)) + } else { + for ; pos < 13+23; pos++ { + data[pos] = 0 + } } // SSL Connection Request Packet - // http://dev.mysql.com/doc/internals/en/connection-phase-packets.html#packet-Protocol::SSLRequest + // https://dev.mysql.com/doc/dev/mysql-server/latest/page_protocol_connection_phase_packets_protocol_ssl_request.html + // https://mariadb.com/kb/en/connection/#sslrequest-packet if mc.cfg.TLS != nil { // Send TLS / SSL request packet - if err := mc.writePacket(data[:(4+4+1+23)+4]); err != nil { + if err := mc.writePacket(data); err != nil { return err } @@ -379,37 +386,35 @@ func (mc *mysqlConn) writeHandshakeResponsePacket(authResp []byte, plugin string // User [null terminated string] if len(mc.cfg.User) > 0 { - pos += copy(data[pos:], mc.cfg.User) + data = append(data, mc.cfg.User...) } - data[pos] = 0x00 - pos++ + data = append(data, 0) // Auth Data [length encoded integer] - pos += copy(data[pos:], authRespLEI) - pos += copy(data[pos:], authResp) + data = appendLengthEncodedInteger(data, uint64(len(authResp))) + data = append(data, authResp...) - // Databasename [null terminated string] - if len(mc.cfg.DBName) > 0 { - pos += copy(data[pos:], mc.cfg.DBName) - data[pos] = 0x00 - pos++ + // Database name [null terminated string] + if mc.capabilities&clientConnectWithDB != 0 { + data = append(data, mc.cfg.DBName...) + data = append(data, 0) } - pos += copy(data[pos:], plugin) - data[pos] = 0x00 - pos++ + data = append(data, plugin...) + data = append(data, 0) // Connection Attributes - if sendConnectAttrs { - pos += copy(data[pos:], connAttrsLEI) - pos += copy(data[pos:], []byte(mc.connector.encodedAttributes)) + if mc.capabilities&clientConnectAttrs != 0 { + connAttrsLen := len(mc.connector.encodedAttributes) + data = appendLengthEncodedInteger(data, uint64(connAttrsLen)) + data = append(data, mc.connector.encodedAttributes...) } // Send Auth packet - return mc.writePacket(data[:pos]) + return mc.writePacket(data) } -// http://dev.mysql.com/doc/internals/en/connection-phase-packets.html#packet-Protocol::AuthSwitchResponse +// https://dev.mysql.com/doc/dev/mysql-server/latest/page_protocol_connection_phase_packets_protocol_auth_switch_response.html func (mc *mysqlConn) writeAuthSwitchPacket(authData []byte) error { pktLen := 4 + len(authData) data, err := mc.buf.takeBuffer(pktLen) @@ -511,7 +516,7 @@ func (mc *mysqlConn) readAuthResult() ([]byte, string, error) { case iEOF: if len(data) == 1 { - // https://dev.mysql.com/doc/internals/en/connection-phase-packets.html#packet-Protocol::OldAuthSwitchRequest + // https://dev.mysql.com/doc/dev/mysql-server/latest/page_protocol_connection_phase_packets_protocol_old_auth_switch_request.html return nil, "mysql_old_password", nil } pluginEndIndex := bytes.IndexByte(data, 0x00) @@ -545,36 +550,41 @@ func (mc *okHandler) readResultOK() error { // Result Set Header Packet // https://dev.mysql.com/doc/dev/mysql-server/latest/page_protocol_com_query_response.html -func (mc *okHandler) readResultSetHeaderPacket() (int, error) { +func (mc *okHandler) readResultSetHeaderPacket() (int, bool, error) { // handleOkPacket replaces both values; other cases leave the values unchanged. mc.result.affectedRows = append(mc.result.affectedRows, 0) mc.result.insertIds = append(mc.result.insertIds, 0) data, err := mc.conn().readPacket() if err != nil { - return 0, err + return 0, false, err } switch data[0] { case iOK: - return 0, mc.handleOkPacket(data) + return 0, false, mc.handleOkPacket(data) case iERR: - return 0, mc.conn().handleErrorPacket(data) + return 0, false, mc.conn().handleErrorPacket(data) case iLocalInFile: - return 0, mc.handleInFileRequest(string(data[1:])) + return 0, false, mc.handleInFileRequest(string(data[1:])) } // column count // https://dev.mysql.com/doc/dev/mysql-server/latest/page_protocol_com_query_response_text_resultset.html - num, _, _ := readLengthEncodedInteger(data) + // https://mariadb.com/kb/en/result-set-packets/#column-count-packet + num, _, len := readLengthEncodedInteger(data) + + if mc.extCapabilities&clientCacheMetadata != 0 { + return int(num), data[len] == 0x01, nil + } // ignore remaining data in the packet. see #1478. - return int(num), nil + return int(num), true, nil } // Error Packet -// http://dev.mysql.com/doc/internals/en/generic-response-packets.html#packet-ERR_Packet +// https://dev.mysql.com/doc/dev/mysql-server/latest/page_protocol_basic_err_packet.html func (mc *mysqlConn) handleErrorPacket(data []byte) error { if data[0] != iERR { return ErrMalformPkt @@ -656,7 +666,7 @@ func (mc *mysqlConn) clearResult() *okHandler { } // Ok Packet -// http://dev.mysql.com/doc/internals/en/generic-response-packets.html#packet-OK_Packet +// https://dev.mysql.com/doc/dev/mysql-server/latest/page_protocol_basic_ok_packet.html func (mc *okHandler) handleOkPacket(data []byte) error { var n, m int var affectedRows, insertId uint64 @@ -690,24 +700,19 @@ func (mc *okHandler) handleOkPacket(data []byte) error { } // Read Packets as Field Packets until EOF-Packet or an Error appears -// http://dev.mysql.com/doc/internals/en/com-query-response.html#packet-Protocol::ColumnDefinition41 -func (mc *mysqlConn) readColumns(count int) ([]mysqlField, error) { +// https://dev.mysql.com/doc/dev/mysql-server/latest/page_protocol_com_query_response_text_resultset_column_definition.html#sect_protocol_com_query_response_text_resultset_column_definition_41 +func (mc *mysqlConn) readColumns(count int, old []mysqlField) ([]mysqlField, error) { columns := make([]mysqlField, count) + if len(old) != count { + old = nil + } - for i := 0; ; i++ { + for i := range count { data, err := mc.readPacket() if err != nil { return nil, err } - // EOF Packet - if data[0] == iEOF && (len(data) == 5 || len(data) == 1) { - if i == count { - return columns, nil - } - return nil, fmt.Errorf("column count mismatch n:%d len:%d", count, len(columns)) - } - // Catalog pos, err := skipLengthEncodedString(data) if err != nil { @@ -728,7 +733,12 @@ func (mc *mysqlConn) readColumns(count int) ([]mysqlField, error) { return nil, err } pos += n - columns[i].tableName = string(tableName) + if old != nil && old[i].tableName == string(tableName) { + // avoid allocating new string + columns[i].tableName = old[i].tableName + } else { + columns[i].tableName = string(tableName) + } } else { n, err = skipLengthEncodedString(data[pos:]) if err != nil { @@ -749,7 +759,12 @@ func (mc *mysqlConn) readColumns(count int) ([]mysqlField, error) { if err != nil { return nil, err } - columns[i].name = string(name) + if old != nil && old[i].name == string(name) { + // avoid allocating new string + columns[i].name = old[i].name + } else { + columns[i].name = string(name) + } pos += n // Original name [len coded string] @@ -780,17 +795,17 @@ func (mc *mysqlConn) readColumns(count int) ([]mysqlField, error) { // Decimals [uint8] columns[i].decimals = data[pos] - //pos++ - - // Default value [len coded binary] - //if pos < len(data) { - // defaultVal, _, err = bytesToLengthCodedBinary(data[pos:]) - //} } + + // skip EOF packet if client does not support deprecateEOF + if err := mc.skipEof(); err != nil { + return nil, err + } + return columns, nil } // Read Packets as Field Packets until EOF-Packet or an Error appears -// http://dev.mysql.com/doc/internals/en/com-query-response.html#packet-ProtocolText::ResultsetRow +// https://dev.mysql.com/doc/dev/mysql-server/latest/page_protocol_com_query_response_text_resultset_row.html func (rows *textRows) readRow(dest []driver.Value) error { mc := rows.mc @@ -804,9 +819,20 @@ func (rows *textRows) readRow(dest []driver.Value) error { } // EOF Packet - if data[0] == iEOF && len(data) == 5 { - // server_status [2 bytes] - rows.mc.status = readStatus(data[3:]) + // text row packets may starts with LengthEncodedString. + // In such case, 0xFE can mean string larger than 0xffffff. + // https://dev.mysql.com/doc/dev/mysql-server/latest/page_protocol_basic_dt_integers.html#sect_protocol_basic_dt_int_le + if data[0] == iEOF && len(data) <= 0xffffff { + if mc.capabilities&clientDeprecateEOF == 0 { + // Deprecated EOF packet + // https://dev.mysql.com/doc/dev/mysql-server/latest/page_protocol_basic_eof_packet.html + mc.status = readStatus(data[3:]) + } else { + // Ok Packet with an 0xFE header + _, _, n := readLengthEncodedInteger(data[1:]) // affected_rows + _, _, m := readLengthEncodedInteger(data[1+n:]) // last_insert_id + mc.status = readStatus(data[1+n+m:]) + } rows.rs.done = true if !rows.HasNextResultSet() { rows.mc = nil @@ -880,8 +906,34 @@ func (rows *textRows) readRow(dest []driver.Value) error { return nil } -// Reads Packets until EOF-Packet or an Error appears. Returns count of Packets read -func (mc *mysqlConn) readUntilEOF() error { +func (mc *mysqlConn) skipPackets(n int) error { + for range n { + if _, err := mc.readPacket(); err != nil { + return err + } + } + return nil +} + +// skips EOF packet after n * ColumnDefinition packets when clientDeprecateEOF is not set +func (mc *mysqlConn) skipEof() error { + if mc.capabilities&clientDeprecateEOF == 0 { + if _, err := mc.readPacket(); err != nil { + return err + } + } + return nil +} + +func (mc *mysqlConn) skipColumns(n int) error { + if err := mc.skipPackets(n); err != nil { + return err + } + return mc.skipEof() +} + +// Reads Packets until EOF-Packet or an Error appears. +func (mc *mysqlConn) skipRows() error { for { data, err := mc.readPacket() if err != nil { @@ -892,10 +944,20 @@ func (mc *mysqlConn) readUntilEOF() error { case iERR: return mc.handleErrorPacket(data) case iEOF: - if len(data) == 5 { - mc.status = readStatus(data[3:]) + // text row packets may starts with LengthEncodedString. + // In such case, 0xFE can mean string larger than 0xffffff. + if len(data) <= 0xffffff { + if mc.capabilities&clientDeprecateEOF == 0 { + // EOF packet + mc.status = readStatus(data[3:]) + } else { + // OK packet with an 0xFE header + _, _, n := readLengthEncodedInteger(data[1:]) // affected_rows + _, _, m := readLengthEncodedInteger(data[1+n:]) // last_insert_id + mc.status = readStatus(data[1+n+m:]) + } + return nil } - return nil } } } @@ -905,7 +967,7 @@ func (mc *mysqlConn) readUntilEOF() error { ******************************************************************************/ // Prepare Result Packets -// http://dev.mysql.com/doc/internals/en/com-stmt-prepare-response.html +// https://dev.mysql.com/doc/dev/mysql-server/latest/page_protocol_com_stmt_prepare.html#sect_protocol_com_stmt_prepare_response func (stmt *mysqlStmt) readPrepareResultPacket() (uint16, error) { data, err := stmt.mc.readPacket() if err == nil { @@ -932,7 +994,7 @@ func (stmt *mysqlStmt) readPrepareResultPacket() (uint16, error) { return 0, err } -// http://dev.mysql.com/doc/internals/en/com-stmt-send-long-data.html +// https://dev.mysql.com/doc/dev/mysql-server/latest/page_protocol_com_stmt_send_long_data.html func (stmt *mysqlStmt) writeCommandLongData(paramID int, arg []byte) error { maxLen := stmt.mc.maxAllowedPacket - 1 pktLen := maxLen @@ -979,7 +1041,7 @@ func (stmt *mysqlStmt) writeCommandLongData(paramID int, arg []byte) error { } // Execute Prepared Statement -// http://dev.mysql.com/doc/internals/en/com-stmt-execute.html +// https://dev.mysql.com/doc/dev/mysql-server/latest/page_protocol_com_stmt_execute.html func (stmt *mysqlStmt) writeExecutePacket(args []driver.Value) error { if len(args) != stmt.paramCount { return fmt.Errorf( @@ -993,10 +1055,7 @@ func (stmt *mysqlStmt) writeExecutePacket(args []driver.Value) error { mc := stmt.mc // Determine threshold dynamically to avoid packet size shortage. - longDataSize := mc.maxAllowedPacket / (stmt.paramCount + 1) - if longDataSize < 64 { - longDataSize = 64 - } + longDataSize := max(mc.maxAllowedPacket/(stmt.paramCount+1), 64) // Reset packet-sequence mc.resetSequence() @@ -1185,17 +1244,17 @@ func (stmt *mysqlStmt) writeExecutePacket(args []driver.Value) error { // mc.affectedRows and mc.insertIds. func (mc *okHandler) discardResults() error { for mc.status&statusMoreResultsExists != 0 { - resLen, err := mc.readResultSetHeaderPacket() + resLen, _, err := mc.readResultSetHeaderPacket() if err != nil { return err } if resLen > 0 { // columns - if err := mc.conn().readUntilEOF(); err != nil { + if err := mc.conn().skipColumns(resLen); err != nil { return err } // rows - if err := mc.conn().readUntilEOF(); err != nil { + if err := mc.conn().skipRows(); err != nil { return err } } @@ -1203,7 +1262,7 @@ func (mc *okHandler) discardResults() error { return nil } -// http://dev.mysql.com/doc/internals/en/binary-protocol-resultset-row.html +// https://dev.mysql.com/doc/dev/mysql-server/latest/page_protocol_binary_resultset.html#sect_protocol_binary_resultset_row func (rows *binaryRows) readRow(dest []driver.Value) error { data, err := rows.mc.readPacket() if err != nil { @@ -1212,9 +1271,17 @@ func (rows *binaryRows) readRow(dest []driver.Value) error { // packet indicator [1 byte] if data[0] != iOK { - // EOF Packet - if data[0] == iEOF && len(data) == 5 { - rows.mc.status = readStatus(data[3:]) + // EOF/OK Packet + if data[0] == iEOF { + if rows.mc.capabilities&clientDeprecateEOF == 0 { + // EOF packet + rows.mc.status = readStatus(data[3:]) + } else { + // OK Packet with an 0xFE header + _, _, n := readLengthEncodedInteger(data[1:]) + _, _, m := readLengthEncodedInteger(data[1+n:]) + rows.mc.status = readStatus(data[1+n+m:]) + } rows.rs.done = true if !rows.HasNextResultSet() { rows.mc = nil diff --git a/vendor/github.com/go-sql-driver/mysql/result.go b/vendor/github.com/go-sql-driver/mysql/result.go index d51631468..82dc0f9b6 100644 --- a/vendor/github.com/go-sql-driver/mysql/result.go +++ b/vendor/github.com/go-sql-driver/mysql/result.go @@ -8,6 +8,8 @@ package mysql +import "slices" + import "database/sql/driver" // Result exposes data not available through *connection.Result. @@ -42,9 +44,9 @@ func (res *mysqlResult) RowsAffected() (int64, error) { } func (res *mysqlResult) AllLastInsertIds() []int64 { - return append([]int64{}, res.insertIds...) // defensive copy + return slices.Clone(res.insertIds) // defensive copy } func (res *mysqlResult) AllRowsAffected() []int64 { - return append([]int64{}, res.affectedRows...) // defensive copy + return slices.Clone(res.affectedRows) // defensive copy } diff --git a/vendor/github.com/go-sql-driver/mysql/rows.go b/vendor/github.com/go-sql-driver/mysql/rows.go index df98417b8..190e75f9b 100644 --- a/vendor/github.com/go-sql-driver/mysql/rows.go +++ b/vendor/github.com/go-sql-driver/mysql/rows.go @@ -113,7 +113,7 @@ func (rows *mysqlRows) Close() (err error) { // Remove unread packets from stream if !rows.rs.done { - err = mc.readUntilEOF() + err = mc.skipRows() } if err == nil { handleOk := mc.clearResult() @@ -143,7 +143,7 @@ func (rows *mysqlRows) nextResultSet() (int, error) { // Remove unread packets from stream if !rows.rs.done { - if err := rows.mc.readUntilEOF(); err != nil { + if err := rows.mc.skipRows(); err != nil { return 0, err } rows.rs.done = true @@ -156,7 +156,7 @@ func (rows *mysqlRows) nextResultSet() (int, error) { rows.rs = resultSet{} // rows.mc.affectedRows and rows.mc.insertIds accumulate on each call to // nextResultSet. - resLen, err := rows.mc.resultUnchanged().readResultSetHeaderPacket() + resLen, _, err := rows.mc.resultUnchanged().readResultSetHeaderPacket() if err != nil { // Clean up about multi-results flag rows.rs.done = true @@ -186,7 +186,7 @@ func (rows *binaryRows) NextResultSet() error { return err } - rows.rs.columns, err = rows.mc.readColumns(resLen) + rows.rs.columns, err = rows.mc.readColumns(resLen, nil) return err } @@ -208,7 +208,7 @@ func (rows *textRows) NextResultSet() (err error) { return err } - rows.rs.columns, err = rows.mc.readColumns(resLen) + rows.rs.columns, err = rows.mc.readColumns(resLen, nil) return err } diff --git a/vendor/github.com/go-sql-driver/mysql/statement.go b/vendor/github.com/go-sql-driver/mysql/statement.go index 35df85457..0261903b9 100644 --- a/vendor/github.com/go-sql-driver/mysql/statement.go +++ b/vendor/github.com/go-sql-driver/mysql/statement.go @@ -20,6 +20,7 @@ type mysqlStmt struct { mc *mysqlConn id uint32 paramCount int + columns []mysqlField } func (stmt *mysqlStmt) Close() error { @@ -64,19 +65,26 @@ func (stmt *mysqlStmt) Exec(args []driver.Value) (driver.Result, error) { handleOk := stmt.mc.clearResult() // Read Result - resLen, err := handleOk.readResultSetHeaderPacket() + resLen, metadataFollows, err := handleOk.readResultSetHeaderPacket() if err != nil { return nil, err } if resLen > 0 { // Columns - if err = mc.readUntilEOF(); err != nil { - return nil, err + if metadataFollows && stmt.mc.extCapabilities&clientCacheMetadata != 0 { + // we can not skip column metadata because next stmt.Query() may use it. + if stmt.columns, err = mc.readColumns(resLen, stmt.columns); err != nil { + return nil, err + } + } else { + if err = mc.skipColumns(resLen); err != nil { + return nil, err + } } // Rows - if err := mc.readUntilEOF(); err != nil { + if err = mc.skipRows(); err != nil { return nil, err } } @@ -107,7 +115,7 @@ func (stmt *mysqlStmt) query(args []driver.Value) (*binaryRows, error) { // Read Result handleOk := stmt.mc.clearResult() - resLen, err := handleOk.readResultSetHeaderPacket() + resLen, metadataFollows, err := handleOk.readResultSetHeaderPacket() if err != nil { return nil, err } @@ -116,7 +124,17 @@ func (stmt *mysqlStmt) query(args []driver.Value) (*binaryRows, error) { if resLen > 0 { rows.mc = mc - rows.rs.columns, err = mc.readColumns(resLen) + if metadataFollows { + if rows.rs.columns, err = mc.readColumns(resLen, stmt.columns); err != nil { + return nil, err + } + stmt.columns = rows.rs.columns + } else { + if err = mc.skipEof(); err != nil { + return nil, err + } + rows.rs.columns = stmt.columns + } } else { rows.rs.done = true @@ -131,7 +149,7 @@ func (stmt *mysqlStmt) query(args []driver.Value) (*binaryRows, error) { return rows, err } -var jsonType = reflect.TypeOf(json.RawMessage{}) +var jsonType = reflect.TypeFor[json.RawMessage]() type converter struct{} @@ -193,7 +211,7 @@ func (c converter) ConvertValue(v any) (driver.Value, error) { return nil, fmt.Errorf("unsupported type %T, a %s", v, rv.Kind()) } -var valuerReflectType = reflect.TypeOf((*driver.Valuer)(nil)).Elem() +var valuerReflectType = reflect.TypeFor[driver.Valuer]() // callValuerValue returns vr.Value(), with one exception: // If vr.Value is an auto-generated method on a pointer type and the diff --git a/vendor/github.com/go-sql-driver/mysql/utils.go b/vendor/github.com/go-sql-driver/mysql/utils.go index 8716c26c5..2dccb7d53 100644 --- a/vendor/github.com/go-sql-driver/mysql/utils.go +++ b/vendor/github.com/go-sql-driver/mysql/utils.go @@ -182,7 +182,7 @@ func parseDateTime(b []byte, loc *time.Location) (time.Time, error) { func parseByteYear(b []byte) (int, error) { year, n := 0, 1000 - for i := 0; i < 4; i++ { + for i := range 4 { v, err := bToi(b[i]) if err != nil { return 0, err @@ -207,7 +207,7 @@ func parseByte2Digits(b1, b2 byte) (int, error) { func parseByteNanoSec(b []byte) (int, error) { ns, digit := 0, 100000 // max is 6-digits - for i := 0; i < len(b); i++ { + for i := range b { v, err := bToi(b[i]) if err != nil { return 0, err @@ -625,108 +625,80 @@ func reserveBuffer(buf []byte, appendSize int) []byte { return buf[:newSize] } -// escapeBytesBackslash escapes []byte with backslashes (\) -// This escapes the contents of a string (provided as []byte) by adding backslashes before special -// characters, and turning others into specific escape sequences, such as -// turning newlines into \n and null bytes into \0. -// https://github.com/mysql/mysql-server/blob/mysql-5.7.5/mysys/charset.c#L823-L932 -func escapeBytesBackslash(buf, v []byte) []byte { - pos := len(buf) - buf = reserveBuffer(buf, len(v)*2) +// Lookup table for backslash escapes (used for both string and bytes) +var backslashEscapeTable [256]byte - for _, c := range v { - switch c { - case '\x00': - buf[pos+1] = '0' - buf[pos] = '\\' - pos += 2 - case '\n': - buf[pos+1] = 'n' - buf[pos] = '\\' - pos += 2 - case '\r': - buf[pos+1] = 'r' - buf[pos] = '\\' - pos += 2 - case '\x1a': - buf[pos+1] = 'Z' - buf[pos] = '\\' - pos += 2 - case '\'': - buf[pos+1] = '\'' - buf[pos] = '\\' - pos += 2 - case '"': - buf[pos+1] = '"' - buf[pos] = '\\' - pos += 2 - case '\\': - buf[pos+1] = '\\' - buf[pos] = '\\' - pos += 2 - default: - buf[pos] = c - pos++ - } - } - - return buf[:pos] +func init() { + backslashEscapeTable['\x00'] = '0' + backslashEscapeTable['\n'] = 'n' + backslashEscapeTable['\r'] = 'r' + backslashEscapeTable['\x1a'] = 'Z' + backslashEscapeTable['\''] = '\'' + backslashEscapeTable['"'] = '"' + backslashEscapeTable['\\'] = '\\' } // escapeStringBackslash is similar to escapeBytesBackslash but for string. func escapeStringBackslash(buf []byte, v string) []byte { pos := len(buf) - buf = reserveBuffer(buf, len(v)*2) - + buf = reserveBuffer(buf, len(v)*2+2) + buf[pos] = '\'' + pos++ for i := 0; i < len(v); i++ { c := v[i] - switch c { - case '\x00': - buf[pos+1] = '0' + if esc := backslashEscapeTable[c]; esc != 0 { + buf[pos+1] = esc buf[pos] = '\\' pos += 2 - case '\n': - buf[pos+1] = 'n' - buf[pos] = '\\' - pos += 2 - case '\r': - buf[pos+1] = 'r' - buf[pos] = '\\' - pos += 2 - case '\x1a': - buf[pos+1] = 'Z' - buf[pos] = '\\' - pos += 2 - case '\'': - buf[pos+1] = '\'' - buf[pos] = '\\' - pos += 2 - case '"': - buf[pos+1] = '"' - buf[pos] = '\\' - pos += 2 - case '\\': - buf[pos+1] = '\\' - buf[pos] = '\\' - pos += 2 - default: + } else { buf[pos] = c pos++ } } - + buf[pos] = '\'' + pos++ return buf[:pos] } -// escapeBytesQuotes escapes apostrophes in []byte by doubling them up. -// This escapes the contents of a string by doubling up any apostrophes that -// it contains. This is used when the NO_BACKSLASH_ESCAPES SQL_MODE is in -// effect on the server. -// https://github.com/mysql/mysql-server/blob/mysql-5.7.5/mysys/charset.c#L963-L1038 -func escapeBytesQuotes(buf, v []byte) []byte { +// escapeBytesBackslash appends _binary'...' or '...' with backslash escaping for bytes. +func escapeBytesBackslash(buf, v []byte, binary bool) []byte { pos := len(buf) - buf = reserveBuffer(buf, len(v)*2) + if binary { + buf = reserveBuffer(buf, len(v)*2+9) + copy(buf[pos:], []byte("_binary'")) + pos += 8 + } else { + buf = reserveBuffer(buf, len(v)*2+2) + buf[pos] = '\'' + pos++ + } + for _, c := range v { + if esc := backslashEscapeTable[c]; esc != 0 { + buf[pos+1] = esc + buf[pos] = '\\' + pos += 2 + } else { + buf[pos] = c + pos++ + } + } + buf[pos] = '\'' + pos++ + return buf[:pos] +} +// escapeBytesQuotes appends _binary'...' or '...' with single-quote escaping for bytes. +func escapeBytesQuotes(buf, v []byte, binary bool) []byte { + pos := len(buf) + if binary { + buf = reserveBuffer(buf, len(v)*2+9) + copy(buf[pos:], []byte("_binary'")) + pos += 8 + } else { + buf = reserveBuffer(buf, len(v)*2+2) + buf[pos] = '\'' + pos++ + } for _, c := range v { if c == '\'' { buf[pos+1] = '\'' @@ -737,16 +709,18 @@ func escapeBytesQuotes(buf, v []byte) []byte { pos++ } } - + buf[pos] = '\'' + pos++ return buf[:pos] } // escapeStringQuotes is similar to escapeBytesQuotes but for string. func escapeStringQuotes(buf []byte, v string) []byte { pos := len(buf) - buf = reserveBuffer(buf, len(v)*2) - - for i := 0; i < len(v); i++ { + buf = reserveBuffer(buf, len(v)*2+2) + buf[pos] = '\'' + pos++ + for i := range len(v) { c := v[i] if c == '\'' { buf[pos+1] = '\'' @@ -757,7 +731,8 @@ func escapeStringQuotes(buf []byte, v string) []byte { pos++ } } - + buf[pos] = '\'' + pos++ return buf[:pos] } diff --git a/vendor/github.com/nats-io/nats-server/v2/server/auth.go b/vendor/github.com/nats-io/nats-server/v2/server/auth.go index b8cf69783..09fad3346 100644 --- a/vendor/github.com/nats-io/nats-server/v2/server/auth.go +++ b/vendor/github.com/nats-io/nats-server/v2/server/auth.go @@ -696,7 +696,7 @@ func (s *Server) processClientOrLeafAuthentication(c *client, opts *Options) (au // If we are here we have an auth callout defined and we have failed auth so far // so we will callout to our auth backend for processing. if !skip { - authorized, reason = s.processClientOrLeafCallout(c, opts, proxyRequired, trustedProxy) + authorized, reason = s.processClientOrLeafCallout(c, opts, proxyRequired, trustedProxy, ujwt) } // Check if we are authorized and in the auth callout account, and if so add in deny publish permissions for the auth subject. if authorized { @@ -797,26 +797,42 @@ func (s *Server) processClientOrLeafAuthentication(c *client, opts *Options) (au token = opts.Authorization } - // Check if we have trustedKeys defined in the server. If so we require a user jwt. - if s.trustedKeys != nil { - ujwt = c.opts.JWT - if ujwt == _EMPTY_ && c.isMqtt() { - // For MQTT, we pass the password as the JWT too, but do so here so it's not - // publicly exposed in the client options if it isn't a JWT. + // MQTT can carry JWTs in the password field. Reconstruct it here for auth + // processing and auth callout, but do not populate c.opts.JWT yet or it would + // be exposed through monitoring and advisory paths even when the password is + // not actually a JWT. + if ujwt == _EMPTY_ && c.isMqtt() && c.opts.JWT == _EMPTY_ { + // Don't set juc here, leave that to the next s.trustedKeys != nil block, + // so that we don't try to trust a JWT when we aren't in operator mode. We + // will allow it to be passed through auth callout though. + if _, err := jwt.DecodeUserClaims(c.opts.Password); err == nil { ujwt = c.opts.Password } - if ujwt == _EMPTY_ && opts.DefaultSentinel != _EMPTY_ { - c.opts.JWT = opts.DefaultSentinel - ujwt = c.opts.JWT + } + + // Check if we have trustedKeys defined in the server. If so we require a user jwt. + if s.trustedKeys != nil { + if ujwt == _EMPTY_ { + // Need to be sure that it's a NATS JWT, otherwise we will not correctly + // attempt the default sentinel below. + if _, err = jwt.DecodeUserClaims(c.opts.JWT); err == nil { + ujwt = c.opts.JWT + } + } + if ujwt == _EMPTY_ { + // Didn't fall through with a valid NATS JWT, so try the default sentinel + // if configured. + if opts.DefaultSentinel != _EMPTY_ { + c.opts.JWT = opts.DefaultSentinel + ujwt = c.opts.JWT + } } if ujwt == _EMPTY_ { s.mu.Unlock() c.Debugf("Authentication requires a user JWT") return false } - // So we have a valid user jwt here. - juc, err = jwt.DecodeUserClaims(ujwt) - if err != nil { + if juc, err = jwt.DecodeUserClaims(ujwt); err != nil { s.mu.Unlock() c.Debugf("User JWT not valid: %v", err) return false @@ -1015,8 +1031,10 @@ func (s *Server) processClientOrLeafAuthentication(c *client, opts *Options) (au c.Debugf("Connection type not allowed") return false } - // skip validation of nonce when presented with a bearer token - // FIXME: if BearerToken is only for WSS, need check for server with that port enabled + // Skip validation of nonce when presented with a bearer token. + // While support for bearer tokens was added for WebSockets, there is no + // security benefit in restricting their use to that client protocol: the + // client can just go use the other protocol. if !juc.BearerToken { // Verify the signature against the nonce. if c.opts.Sig == _EMPTY_ { diff --git a/vendor/github.com/nats-io/nats-server/v2/server/auth_callout.go b/vendor/github.com/nats-io/nats-server/v2/server/auth_callout.go index df903b3f2..b44fa1f8d 100644 --- a/vendor/github.com/nats-io/nats-server/v2/server/auth_callout.go +++ b/vendor/github.com/nats-io/nats-server/v2/server/auth_callout.go @@ -41,7 +41,7 @@ func titleCase(m string) string { } // Process a callout on this client's behalf. -func (s *Server) processClientOrLeafCallout(c *client, opts *Options, proxyRequired, trustedProxy bool) (authorized bool, errStr string) { +func (s *Server) processClientOrLeafCallout(c *client, opts *Options, proxyRequired, trustedProxy bool, ujwt string) (authorized bool, errStr string) { isOperatorMode := len(opts.TrustedKeys) > 0 // this is the account the user connected in, or the one running the callout @@ -374,7 +374,7 @@ func (s *Server) processClientOrLeafCallout(c *client, opts *Options, proxyRequi // Grab client info for the request. c.mu.Lock() c.fillClientInfo(&claim.ClientInformation) - c.fillConnectOpts(&claim.ConnectOptions) + c.fillConnectOpts(&claim.ConnectOptions, ujwt) // If we have a sig in the client opts, fill in nonce. if claim.ConnectOptions.SignedNonce != _EMPTY_ { claim.ClientInformation.Nonce = string(c.nonce) @@ -474,16 +474,22 @@ func (c *client) fillClientInfo(ci *jwt.ClientInformation) { // Fill in client options. // Lock should be held. -func (c *client) fillConnectOpts(opts *jwt.ConnectOptions) { +func (c *client) fillConnectOpts(opts *jwt.ConnectOptions, ujwt string) { if c == nil || (c.kind != CLIENT && c.kind != LEAF && c.kind != JETSTREAM && c.kind != ACCOUNT) { return } o := c.opts + if ujwt == _EMPTY_ { + // The caller may supply a reconstructed JWT that should be sent to auth + // callout without storing it in c.opts.JWT. If not, fall back to the client + // option as before. + ujwt = o.JWT + } // Do it this way to fail to compile if fields are added to jwt.ClientInformation. *opts = jwt.ConnectOptions{ - JWT: o.JWT, + JWT: ujwt, Nkey: o.Nkey, SignedNonce: o.Sig, Token: o.Token, diff --git a/vendor/github.com/nats-io/nats-server/v2/server/avl/seqset.go b/vendor/github.com/nats-io/nats-server/v2/server/avl/seqset.go index de281d030..f4fa127df 100644 --- a/vendor/github.com/nats-io/nats-server/v2/server/avl/seqset.go +++ b/vendor/github.com/nats-io/nats-server/v2/server/avl/seqset.go @@ -239,7 +239,7 @@ func (ss SequenceSet) EncodeLen() int { return minLen + (ss.Nodes() * ((numBuckets+1)*8 + 2)) } -func (ss SequenceSet) Encode(buf []byte) ([]byte, error) { +func (ss SequenceSet) Encode(buf []byte) []byte { nn, encLen := ss.Nodes(), ss.EncodeLen() if cap(buf) < encLen { @@ -268,7 +268,7 @@ func (ss SequenceSet) Encode(buf []byte) ([]byte, error) { le.PutUint16(buf[i:], uint16(n.h)) i += 2 }) - return buf[:i], nil + return buf[:i] } // ErrBadEncoding is returned when we can not decode properly. diff --git a/vendor/github.com/nats-io/nats-server/v2/server/client.go b/vendor/github.com/nats-io/nats-server/v2/server/client.go index 0abfd2180..162c23500 100644 --- a/vendor/github.com/nats-io/nats-server/v2/server/client.go +++ b/vendor/github.com/nats-io/nats-server/v2/server/client.go @@ -1061,18 +1061,19 @@ func (c *client) setPermissions(perms *Permissions) { return } c.perms = &permissions{} + slcache := c.srv != nil && !c.srv.getOpts().NoSublistCache // Loop over publish permissions if perms.Publish != nil { if perms.Publish.Allow != nil { - c.perms.pub.allow = NewSublistWithCache() + c.perms.pub.allow = NewSublist(slcache) } for _, pubSubject := range perms.Publish.Allow { sub := &subscription{subject: []byte(pubSubject)} c.perms.pub.allow.Insert(sub) } if len(perms.Publish.Deny) > 0 { - c.perms.pub.deny = NewSublistWithCache() + c.perms.pub.deny = NewSublist(slcache) } for _, pubSubject := range perms.Publish.Deny { sub := &subscription{subject: []byte(pubSubject)} @@ -1091,7 +1092,7 @@ func (c *client) setPermissions(perms *Permissions) { if perms.Subscribe != nil { var err error if len(perms.Subscribe.Allow) > 0 { - c.perms.sub.allow = NewSublistWithCache() + c.perms.sub.allow = NewSublist(slcache) } for _, subSubject := range perms.Subscribe.Allow { sub := &subscription{} @@ -1103,7 +1104,7 @@ func (c *client) setPermissions(perms *Permissions) { c.perms.sub.allow.Insert(sub) } if len(perms.Subscribe.Deny) > 0 { - c.perms.sub.deny = NewSublistWithCache() + c.perms.sub.deny = NewSublist(slcache) // Also hold onto this array for later. c.darray = perms.Subscribe.Deny } @@ -1200,6 +1201,7 @@ func (c *client) mergeDenyPermissions(what denyType, denyPubs []string) { if c.perms == nil { c.perms = &permissions{} } + slcache := c.srv != nil && !c.srv.getOpts().NoSublistCache var perms []*perm switch what { case pub: @@ -1211,7 +1213,7 @@ func (c *client) mergeDenyPermissions(what denyType, denyPubs []string) { } for _, p := range perms { if p.deny == nil { - p.deny = NewSublistWithCache() + p.deny = NewSublist(slcache) } FOR_DENY: for _, subj := range denyPubs { @@ -2254,12 +2256,20 @@ func (c *client) processConnect(arg []byte) error { // least ClientProtoInfo, we need to increment the following counter. // This is decremented when client is removed from the server's // clients map. - if kind == CLIENT && proto >= ClientProtoInfo { + if kind == CLIENT && proto >= ClientProtoInfo && firstConnect { srv.mu.Lock() srv.cproto++ srv.mu.Unlock() } + // A second CONNECT may move the client into a different account via + // checkAuthentication. Drop any previously-registered subscriptions + // from the current account first so they don't leak in that account's + // sublist after the client switches. + if !firstConnect { + c.clearAccountSubs(false) + } + // Check for Auth if ok := srv.checkAuthentication(c); !ok { // We may fail here because we reached max limits on an account. @@ -3273,19 +3283,20 @@ func (c *client) canSubscribe(subject string, optQueue ...string) bool { r := c.perms.sub.deny.Match(subject) allowed = len(r.psubs) == 0 - if queue != _EMPTY_ && len(r.qsubs) > 0 { + if allowed && queue != _EMPTY_ && len(r.qsubs) > 0 { // If the queue appears in the deny list, then DO NOT allow. allowed = !queueMatches(queue, r.qsubs) } // We use the actual subscription to signal us to spin up the deny mperms - // and cache. We check if the subject is a wildcard that contains any of + // and cache. We check if the subject is a wildcard that intersects any of // the deny clauses. // FIXME(dlc) - We could be smarter and track when these go away and remove. if allowed && c.mperms == nil && subjectHasWildcard(subject) { - // Whip through the deny array and check if this wildcard subject is within scope. + // Whip through the deny array and check if this wildcard subject can + // overlap with any denied deliveries. for _, sub := range c.darray { - if subjectIsSubsetMatch(sub, subject) { + if SubjectsCollide(sub, subject) { c.loadMsgDenyFilter() break } @@ -3658,14 +3669,7 @@ func (c *client) deliverMsg(prodIsMQTT bool, sub *subscription, acc *Account, su // Check if we are a leafnode and have perms to check. if client.kind == LEAF && client.perms != nil { - var subjectToCheck []byte - if subject[0] == '_' && bytes.HasPrefix(subject, []byte(gwReplyPrefix)) { - subjectToCheck = subject[gwSubjectOffset:] - } else if subject[0] == '$' && bytes.HasPrefix(subject, []byte(oldGWReplyPrefix)) { - subjectToCheck = subject[oldGWReplyStart:] - } else { - subjectToCheck = subject - } + subjectToCheck, _ := getGWRoutedSubjectOrSelf(subject) if !client.pubAllowedFullCheck(string(subjectToCheck), true, true) { mt.addEgressEvent(client, sub, errMsgTracePubViolation) client.mu.Unlock() @@ -4068,7 +4072,7 @@ func (c *client) allowedMsgTraceDest(hdr []byte, hasLock bool) (string, bool) { return _EMPTY_, true } td := sliceHeader(MsgTraceDest, hdr) - if len(td) == 0 { + if len(td) == 0 || bytes.Equal(td, traceDestDisabledAsBytes) { return _EMPTY_, true } dest := bytesToString(td) @@ -4131,17 +4135,7 @@ func (c *client) pubAllowedFullCheck(subject string, fullCheck, hasLock bool) bo if !hasLock { c.mu.Lock() } - if resp := c.replies[subject]; resp != nil { - resp.n++ - // Check if we have sent too many responses. - if c.perms.resp.MaxMsgs > 0 && resp.n > c.perms.resp.MaxMsgs { - delete(c.replies, subject) - } else if c.perms.resp.Expires > 0 && time.Since(resp.t) > c.perms.resp.Expires { - delete(c.replies, subject) - } else { - allowed = true - } - } + allowed = c.responseAllowed(subject) if !hasLock { c.mu.Unlock() } @@ -4155,6 +4149,25 @@ func (c *client) pubAllowedFullCheck(subject string, fullCheck, hasLock bool) bo return allowed } +// Returns true if this subject matches a tracked dynamic reply permission. +// Lock must be held. +func (c *client) responseAllowed(subject string) bool { + if c.perms == nil || c.perms.resp == nil { + return false + } + if resp := c.replies[subject]; resp != nil { + resp.n++ + if c.perms.resp.MaxMsgs > 0 && resp.n > c.perms.resp.MaxMsgs { + delete(c.replies, subject) + } else if c.perms.resp.Expires > 0 && time.Since(resp.t) > c.perms.resp.Expires { + delete(c.replies, subject) + } else { + return true + } + } + return false +} + // Test whether a reply subject is a service import reply. func isServiceReply(reply []byte) bool { // This function is inlined and checking this way is actually faster @@ -4162,16 +4175,51 @@ func isServiceReply(reply []byte) bool { return len(reply) > 3 && bytesToString(reply[:4]) == replyPrefix } +// Test whether a subject is a JetStream ACK. +func isJSAckSubject(subject []byte) bool { + return len(subject) > jsAckPreLen && bytesToString(subject[:jsAckPreLen]) == jsAckPre +} + +// jsAckDeliverIdx returns the byte offset of the `@` separator in an encoded +// `$JS.ACK....@` reply, or -1 if reply is not in that form. Stream, +// consumer, and subject tokens may legally contain `@`, so we accept only the +// first `@` that follows the eight dots of the JS ACK token: +// +// $JS.ACK.......@ +func jsAckDeliverIdx(reply []byte) int { + if !isJSAckSubject(reply) { + return -1 + } + dots := 0 + for i, b := range reply { + switch b { + case '.': + dots++ + case '@': + if dots >= 8 { + return i + } + } + } + return -1 +} + +// replyHasJSAckSuffix reports whether reply is already in `$JS.ACK....@` +// form, so callers don't double-append the suffix on a re-entrant pass +// (service-import or chained JS push). +func replyHasJSAckSuffix(reply []byte) bool { + return jsAckDeliverIdx(reply) != -1 +} + // Test whether a reply subject is a service import or a gateway routed reply. func isReservedReply(reply []byte) bool { if isServiceReply(reply) { return true } - rLen := len(reply) // Faster to check with string([:]) than byte-by-byte - if rLen > jsAckPreLen && bytesToString(reply[:jsAckPreLen]) == jsAckPre { + if isJSAckSubject(reply) { return true - } else if rLen > gwReplyPrefixLen && bytesToString(reply[:gwReplyPrefixLen]) == gwReplyPrefix { + } else if len(reply) > gwReplyPrefixLen && bytesToString(reply[:gwReplyPrefixLen]) == gwReplyPrefix { return true } return false @@ -4370,7 +4418,7 @@ func (c *client) processInboundClientMsg(msg []byte) (bool, bool) { // Now deal with gateways if c.srv.gateway.enabled { reply := c.pa.reply - if len(c.pa.deliver) > 0 && c.kind == JETSTREAM && len(c.pa.reply) > 0 { + if len(c.pa.deliver) > 0 && c.kind == JETSTREAM && len(reply) > 0 && !replyHasJSAckSuffix(reply) { reply = append(reply, '@') reply = append(reply, c.pa.deliver...) } @@ -4418,7 +4466,7 @@ func (c *client) handleGWReplyMap(msg []byte) bool { } if c.srv.gateway.enabled { reply := c.pa.reply - if len(c.pa.deliver) > 0 && c.kind == JETSTREAM && len(c.pa.reply) > 0 { + if len(c.pa.deliver) > 0 && c.kind == JETSTREAM && len(reply) > 0 && !replyHasJSAckSuffix(reply) { reply = append(reply, '@') reply = append(reply, c.pa.deliver...) } @@ -4531,7 +4579,8 @@ func (c *client) setHeader(key, value string, msg []byte) []byte { // Write original header if present. if c.pa.hdr > LEN_CR_LF { omi = c.pa.hdr - hdr := removeHeaderIfPresent(msg[:c.pa.hdr-LEN_CR_LF], key) + // Need to copy since we're removing the header in place. + hdr := removeHeaderIfPresent(copyBytes(msg[:c.pa.hdr-LEN_CR_LF]), key) if len(hdr) == 0 { bb.WriteString(hdrLine) } else { @@ -4825,6 +4874,12 @@ func (c *client) processServiceImport(si *serviceImport, acc *Account, msg []byt // but the local server must replace it with the identity of the // authenticated leaf connection instead of trusting forwarded values. ci = c.getClientInfo(share) + if hadPrevSi && cis != nil && cis.Reply != _EMPTY_ { + ci.Reply = cis.Reply + } else if bytes.HasSuffix(c.pa.reply, []byte(FastBatchSuffix)) { + // Fast batch requires knowledge of the original reply subject. + ci.Reply = bytesToString(c.pa.reply) + } if hadPrevSi { ci.Service = acc.Name if !share && (si.share || isSysImport) { @@ -4843,6 +4898,10 @@ func (c *client) processServiceImport(si *serviceImport, acc *Account, msg []byt } } else if c.kind != LEAF || c.pa.hdr < 0 || len(sliceHeader(ClientInfoHdr, msg[:c.pa.hdr])) == 0 { ci = c.getClientInfo(share) + // Fast batch requires knowledge of the original reply subject. + if bytes.HasSuffix(c.pa.reply, []byte(FastBatchSuffix)) { + ci.Reply = bytesToString(c.pa.reply) + } // If we did not share but the imports destination is the system account add in the server and cluster info. if !share && isSysImport { c.addServerAndClusterInfo(ci) @@ -4902,8 +4961,7 @@ func (c *client) processServiceImport(si *serviceImport, acc *Account, msg []byt // We also need to disable the message trace headers so that // if the message is routed, it does not initialize tracing in the // remote. - positions := disableTraceHeaders(c, msg) - defer enableTraceHeaders(msg, positions) + msg = c.setHeader(MsgTraceDest, MsgTraceDestDisabled, msg) } } } @@ -5037,21 +5095,9 @@ func (c *client) processMsgResults(acc *Account, r *SublistResult, msg, deliver, // Check for JetStream encoded reply subjects. // For now these will only be on $JS.ACK prefixed reply subjects. var remapped bool - if len(creply) > 0 && c.kind != CLIENT && !isInternalClient(c.kind) && bytes.HasPrefix(creply, []byte(jsAckPre)) { + if len(creply) > 0 && c.kind != CLIENT && !isInternalClient(c.kind) { // We need to rewrite the subject and the reply. - // But, we must be careful that the stream name, consumer name, and subject can contain '@' characters. - // JS ACK contains at least 8 dots, find the first @ after this prefix. - // - $JS.ACK....... - counter := 0 - li := bytes.IndexFunc(creply, func(rn rune) bool { - if rn == '.' { - counter++ - } else if rn == '@' { - return counter >= 8 - } - return false - }) - if li != -1 && li < len(creply)-1 { + if li := jsAckDeliverIdx(creply); li != -1 && li < len(creply)-1 { remapped = true subj, creply = creply[li+1:], creply[:li] } @@ -5471,7 +5517,7 @@ sendToRoutesOrLeafs: // at the end of the reply subject if it exists. But only if this wasn't // already performed, otherwise we'd end up with a duplicate '@' suffix // resulting in a protocol error. - if len(deliver) > 0 && len(reply) > 0 && !remapped { + if len(deliver) > 0 && len(reply) > 0 && !remapped && !replyHasJSAckSuffix(reply) { reply = append(reply, '@') reply = append(reply, deliver...) } @@ -5754,11 +5800,12 @@ func (c *client) clearAuthTimer() bool { return stopped } -// We may reuse atmr for expiring user jwts, -// so check connectReceived. +// Track whether the parser should still enforce pre-CONNECT rules. +// This is handshake state, not timer state, since some handshakes +// use a different timer while still expecting CONNECT. // Lock assume held on entry. func (c *client) awaitingAuth() bool { - return !c.flags.isSet(connectReceived) && c.atmr != nil + return c.flags.isSet(expectConnect) && !c.flags.isSet(connectReceived) } // This will set the atmr for the JWT expiration time. @@ -5987,37 +6034,12 @@ func (c *client) closeConnection(reason ClosedState) { srv = c.srv noReconnect = c.flags.isSet(noReconnect) acc = c.acc - spoke bool ) - - // Snapshot for use if we are a client connection. - // FIXME(dlc) - we can just stub in a new one for client - // and reference existing one. - var subs []*subscription - if kind == CLIENT || kind == LEAF || kind == JETSTREAM { - var _subs [32]*subscription - subs = _subs[:0] - // Do not set c.subs to nil or delete the sub from c.subs here because - // it will be needed in saveClosedClient (which has been started as a - // go routine in markConnAsClosed). Cleanup will be done there. - for _, sub := range c.subs { - // Auto-unsubscribe subscriptions must be unsubscribed forcibly. - sub.max = 0 - sub.close() - subs = append(subs, sub) - } - spoke = c.isSpokeLeafNode() - } - c.mu.Unlock() - // Remove client's or leaf node or jetstream subscriptions. - if acc != nil && (kind == CLIENT || kind == LEAF || kind == JETSTREAM) { - acc.sl.RemoveBatch(subs) - } else if kind == ROUTER { + if kind == ROUTER { c.removeRemoteSubs() } - if srv != nil { // Unregister srv.removeClient(c) @@ -6025,45 +6047,11 @@ func (c *client) closeConnection(reason ClosedState) { if acc != nil { // Update remote subscriptions. if kind == CLIENT || kind == LEAF || kind == JETSTREAM { - qsubs := map[string]*qsub{} - for _, sub := range subs { - // Call unsubscribe here to cleanup shadow subscriptions and such. - c.unsubscribe(acc, sub, true, false) - // Update route as normal for a normal subscriber. - if sub.queue == nil { - if !spoke { - srv.updateRouteSubscriptionMap(acc, sub, -1) - if srv.gateway.enabled { - srv.gatewayUpdateSubInterest(acc.Name, sub, -1) - } - } - acc.updateLeafNodes(sub, -1) - } else { - // We handle queue subscribers special in case we - // have a bunch we can just send one update to the - // connected routes. - num := int32(1) - if kind == LEAF { - num = sub.qw - } - key := keyFromSub(sub) - if esub, ok := qsubs[key]; ok { - esub.n += num - } else { - qsubs[key] = &qsub{sub, num} - } - } - } - // Process any qsubs here. - for _, esub := range qsubs { - if !spoke { - srv.updateRouteSubscriptionMap(acc, esub.sub, -(esub.n)) - if srv.gateway.enabled { - srv.gatewayUpdateSubInterest(acc.Name, esub.sub, -(esub.n)) - } - } - acc.updateLeafNodes(esub.sub, -(esub.n)) - } + // Remove client's subscriptions from the account and unregister + // client from that account. Keep c.subs populated because + // saveClosedClient (started as a goroutine in markConnAsClosed) + // still needs to read it. + c.clearAccountSubs(true) } // Always remove from the account, otherwise we can leak clients. // Note that SYSTEM and ACCOUNT types from above cleanup their own subs. @@ -6090,6 +6078,87 @@ func (c *client) closeConnection(reason ClosedState) { c.reconnect() } +// clearAccountSubs removes the client's subscriptions from its current account +// and unregisters it from that account. If close is true, c.subs is left +// populated for saveClosedClient; otherwise c.subs is cleared and c.acc +// registered back to the global account. +// Client lock MUST NOT be held on entry. +func (c *client) clearAccountSubs(close bool) { + c.mu.Lock() + kind := c.kind + srv := c.srv + acc := c.acc + if acc == nil || (kind != CLIENT && kind != LEAF && kind != JETSTREAM) { + c.mu.Unlock() + return + } + var _subs [32]*subscription + subs := _subs[:0] + // Do not set c.subs to nil or delete the sub from c.subs here because + // it will be needed in saveClosedClient (which has been started as a + // go routine in markConnAsClosed). Cleanup will be done there. + for _, sub := range c.subs { + // Auto-unsubscribe subscriptions must be unsubscribed forcibly. + sub.max = 0 + sub.close() + subs = append(subs, sub) + if !close { + delete(c.subs, string(sub.sid)) + } + } + spoke := c.isSpokeLeafNode() + c.mu.Unlock() + + acc.sl.RemoveBatch(subs) + + if srv != nil { + qsubs := map[string]*qsub{} + for _, sub := range subs { + // Call unsubscribe here to cleanup shadow subscriptions and such. + c.unsubscribe(acc, sub, true, false) + // Update route as normal for a normal subscriber. + if sub.queue == nil { + if !spoke { + srv.updateRouteSubscriptionMap(acc, sub, -1) + if srv.gateway.enabled { + srv.gatewayUpdateSubInterest(acc.Name, sub, -1) + } + } + acc.updateLeafNodes(sub, -1) + } else { + // We handle queue subscribers special in case we + // have a bunch we can just send one update to the + // connected routes. + num := int32(1) + if kind == LEAF { + num = sub.qw + } + key := keyFromSub(sub) + if esub, ok := qsubs[key]; ok { + esub.n += num + } else { + qsubs[key] = &qsub{sub, num} + } + } + } + // Process any qsubs here. + for _, esub := range qsubs { + if !spoke { + srv.updateRouteSubscriptionMap(acc, esub.sub, -(esub.n)) + if srv.gateway.enabled { + srv.gatewayUpdateSubInterest(acc.Name, esub.sub, -(esub.n)) + } + } + acc.updateLeafNodes(esub.sub, -(esub.n)) + } + } + + if !close { + // Register back to global account, mimicking the state after client initialization. + c.registerWithAccount(srv.globalAccount()) + } +} + // Depending on the kind of connections, this may attempt to recreate a connection. // The actual reconnect attempt will be started in a go routine. func (c *client) reconnect() { @@ -6180,7 +6249,7 @@ func (c *client) reconnect() { srv.Debugf("Gateway %q not in configuration, not attempting reconnect", gwName) } } else if leafCfg != nil { - // Check if this is a solicited leaf node. Start up a reconnect. + // This is a solicited leaf node. Start up a reconnect. srv.startGoRoutine(func() { srv.reConnectToRemoteLeafNode(leafCfg) }) } } diff --git a/vendor/github.com/nats-io/nats-server/v2/server/const.go b/vendor/github.com/nats-io/nats-server/v2/server/const.go index 410fc5e60..b173aa2a7 100644 --- a/vendor/github.com/nats-io/nats-server/v2/server/const.go +++ b/vendor/github.com/nats-io/nats-server/v2/server/const.go @@ -66,7 +66,7 @@ func init() { const ( // VERSION is the current version for the server. - VERSION = "2.12.6" + VERSION = "2.14.0" // PROTO is the currently supported protocol. // 0 was the original diff --git a/vendor/github.com/nats-io/nats-server/v2/server/consumer.go b/vendor/github.com/nats-io/nats-server/v2/server/consumer.go index 82233d926..dba951741 100644 --- a/vendor/github.com/nats-io/nats-server/v2/server/consumer.go +++ b/vendor/github.com/nats-io/nats-server/v2/server/consumer.go @@ -125,7 +125,8 @@ type ConsumerConfig struct { MemoryStorage bool `json:"mem_storage,omitempty"` // Don't add to general clients. - Direct bool `json:"direct,omitempty"` + Direct bool `json:"direct,omitempty"` + Sourcing bool `json:"sourcing,omitempty"` // Metadata is additional metadata for the Consumer. Metadata map[string]string `json:"metadata,omitempty"` @@ -336,6 +337,8 @@ const ( AckAll // AckExplicit requires ack or nack for all messages. AckExplicit + // AckFlowControl functions like AckAll, but acks based on responses to flow control. + AckFlowControl ) func (a AckPolicy) String() string { @@ -344,6 +347,8 @@ func (a AckPolicy) String() string { return "none" case AckAll: return "all" + case AckFlowControl: + return "flow_control" default: return "explicit" } @@ -436,17 +441,27 @@ type consumer struct { lss *lastSeqSkipList rlimit *rate.Limiter reqSub *subscription + resetSub *subscription + ackSubOld *subscription + ackReplyOldT string + ackSubjOld string ackSub *subscription ackReplyT string ackSubj string + fcPreOld string + fcSubjOld string + fcPre string + fcSubj string nextMsgSubj string nextMsgReqs *ipQueue[*nextMsgReq] + resetSubj string maxp int pblimit int maxpb int pbytes int fcsz int fcid string + fcSubOld *subscription fcSub *subscription outq *jsOutQ pending map[uint64]*Pending @@ -465,6 +480,7 @@ type consumer struct { store ConsumerStore active bool replay bool + useV2Ack bool dtmr *time.Timer uptmr *time.Timer // Unpause timer gwdtmr *time.Timer @@ -489,6 +505,7 @@ type consumer struct { infoSub *subscription lqsent time.Time prm map[string]struct{} + rsm map[string]bool // Reset requests that need to be responded to on the internal sys account (if true). prOk bool uch chan struct{} retention RetentionPolicy @@ -649,7 +666,7 @@ func setConsumerConfigDefaults(config *ConsumerConfig, streamCfg *StreamConfig, config.InactiveThreshold = streamCfg.ConsumerLimits.InactiveThreshold } // Set proper default for max ack pending if we are ack explicit and none has been set. - if (config.AckPolicy == AckExplicit || config.AckPolicy == AckAll) && config.MaxAckPending == 0 { + if config.MaxAckPending == 0 && config.AckPolicy != AckNone { ackPending := JsDefaultMaxAckPending if lim.MaxAckPending > 0 && lim.MaxAckPending < ackPending { ackPending = lim.MaxAckPending @@ -671,6 +688,12 @@ func setConsumerConfigDefaults(config *ConsumerConfig, streamCfg *StreamConfig, if config.PriorityPolicy == PriorityPinnedClient && config.PinnedTTL == 0 { config.PinnedTTL = JsDefaultPinnedTTL } + + // Set default values for flow control policy. + if config.AckPolicy == AckFlowControl && !pedantic { + config.FlowControl = true + config.Heartbeat = sourceHealthHB + } return nil } @@ -684,6 +707,13 @@ func checkConsumerCfg( isRecovering bool, ) *ApiError { + if config.Name != _EMPTY_ && !isValidAssetName(config.Name) { + return NewJSStreamInvalidConfigError(errors.New("consumer name can not contain '.', '*', '>', '\\', '/'")) + } + if config.Durable != _EMPTY_ && !isValidAssetName(config.Durable) { + return NewJSStreamInvalidConfigError(errors.New("consumer durable name can not contain '.', '*', '>', '\\', '/'")) + } + // Check if replicas is defined but exceeds parent stream. if config.Replicas > 0 && config.Replicas > cfg.Replicas { return NewJSConsumerReplicasExceedsStreamError() @@ -720,6 +750,31 @@ func checkConsumerCfg( return NewJSConsumerAckWaitNegativeError() } + // Ack Flow Control policy requires push-based flow-controlled consumer. + if config.AckPolicy == AckFlowControl { + if config.DeliverSubject == _EMPTY_ { + return NewJSConsumerAckFCRequiresPushError() + } + if !config.FlowControl { + return NewJSConsumerAckFCRequiresFCError() + } + // We currently limit using heartbeat of 1s, since those are used for ephemeral sourcing consumers as well. + // We could decide to relax this in the future, but need to be careful to not allow a heartbeat larger + // than the stalled source timeout. + if config.Heartbeat != sourceHealthHB { + return NewJSStreamInvalidConfigError(fmt.Errorf("flow control ack policy heartbeat needs to be 1s")) + } + if config.MaxAckPending <= 0 { + return NewJSConsumerAckFCRequiresMaxAckPendingError() + } + if config.AckWait != 0 || len(config.BackOff) > 0 { + return NewJSConsumerAckFCRequiresNoAckWaitError() + } + if config.MaxDeliver > 0 { + return NewJSConsumerAckFCRequiresNoMaxDeliverError() + } + } + // Check if we have a BackOff defined that MaxDeliver is within range etc. if lbo := len(config.BackOff); lbo > 0 && config.MaxDeliver != -1 && lbo > config.MaxDeliver { return NewJSConsumerMaxDeliverBackoffError() @@ -962,7 +1017,7 @@ func (mset *stream) addConsumerWithAssignment(config *ConsumerConfig, oname stri } mset.mu.RLock() - s, js, jsa, cfg, acc := mset.srv, mset.js, mset.jsa, mset.cfg, mset.acc + s, js, jsa, cfg, acc, lseq := mset.srv, mset.js, mset.jsa, mset.cfg, mset.acc, mset.lseq mset.mu.RUnlock() // If we do not have the consumer currently assigned to us in cluster mode we will proceed but warn. @@ -1058,10 +1113,12 @@ func (mset *stream) addConsumerWithAssignment(config *ConsumerConfig, oname stri return nil, NewJSConsumerDoesNotExistError() } + standalone := !s.JetStreamIsClustered() && s.standAloneMode() + // If we're clustered we've already done this check, only do this if we're a standalone server. // But if we're standalone, only enforce if we're not recovering, since the MaxConsumers could've // been updated while we already had more consumers on disk. - if !s.JetStreamIsClustered() && s.standAloneMode() && !isRecovering { + if standalone && !isRecovering { // Check for any limits, if the config for the consumer sets a limit we check against that // but if not we use the value from account limits, if account limits is more restrictive // than stream config we prefer the account limits to handle cases where account limits are @@ -1070,21 +1127,21 @@ func (mset *stream) addConsumerWithAssignment(config *ConsumerConfig, oname stri if maxc <= 0 || (selectedLimits.MaxConsumers > 0 && selectedLimits.MaxConsumers < maxc) { maxc = selectedLimits.MaxConsumers } - if maxc > 0 && mset.numPublicConsumers() >= maxc { + if maxc > 0 && mset.numLimitableConsumers() >= maxc { mset.mu.Unlock() return nil, NewJSMaximumConsumersLimitError() } } // Check on stream type conflicts with WorkQueues. - if cfg.Retention == WorkQueuePolicy && !config.Direct { + if cfg.Retention == WorkQueuePolicy && !config.Direct && !config.Sourcing { // Force explicit acks here. - if config.AckPolicy != AckExplicit { + if config.AckPolicy != AckExplicit && config.AckPolicy != AckFlowControl { mset.mu.Unlock() return nil, NewJSConsumerWQRequiresExplicitAckError() } - if len(mset.consumers) > 0 { + if mset.numLimitableConsumers() > 0 { subjects := gatherSubjectFilters(config.FilterSubject, config.FilterSubjects) if len(subjects) == 0 { mset.mu.Unlock() @@ -1191,7 +1248,7 @@ func (mset *stream) addConsumerWithAssignment(config *ConsumerConfig, oname stri o.nakEventT = JSAdvisoryConsumerMsgNakPre + "." + o.stream + "." + o.name o.deliveryExcEventT = JSAdvisoryConsumerMaxDeliveryExceedPre + "." + o.stream + "." + o.name - if !isValidName(o.name) { + if !isValidAssetName(o.name) { mset.mu.Unlock() o.deleteWithoutAdvisory() return nil, NewJSConsumerBadDurableNameError() @@ -1232,10 +1289,55 @@ func (mset *stream) addConsumerWithAssignment(config *ConsumerConfig, oname stri // Restore our saved state. o.mu.Lock() o.readStoredState() + + replicas := o.cfg.replicas(&mset.cfg) + + // Starting sequence represents the next sequence to be delivered, so decrement it + // since that's the minimum amount the stream should have as its last sequence. + sseq := o.sseq + if sseq > 0 { + sseq-- + } + o.mu.Unlock() - } else { - // Select starting sequence number - o.selectStartingSeqNo() + + // A stream observing data loss rolls back in its sequence. Check if we need to reconcile the consumer state + // to ensure new messages aren't skipped. + // Only performed for non-replicated consumers for now. + if replicas == 1 && lseq < sseq && isRecovering { + s.Warnf("JetStream consumer '%s > %s > %s' delivered sequence %d past last stream sequence of %d", + o.acc.Name, o.stream, o.name, sseq, lseq) + + o.mu.Lock() + o.reconcileStateWithStream(lseq) + + // Save the reconciled state + state := &ConsumerState{ + Delivered: SequencePair{ + Stream: o.sseq - 1, + Consumer: o.dseq - 1, + }, + AckFloor: SequencePair{ + Stream: o.asflr, + Consumer: o.adflr, + }, + Pending: o.pending, + Redelivered: o.rdc, + } + err := o.store.ForceUpdate(state) + o.mu.Unlock() + if err != nil { + s.Errorf("JetStream consumer '%s > %s > %s' errored while updating state: %v", o.acc.Name, o.stream, o.name, err) + mset.mu.Unlock() + return nil, NewJSConsumerStoreFailedError(err) + } + } + } else if config.Direct || standalone { + // Clustered non-direct consumers defer this to setLeader so the + // expensive store scans don't block the meta apply goroutine. + if err := o.selectStartingSeqNo(); err != nil { + return nil, err + } } // Now register with mset and create the ack subscription. @@ -1271,10 +1373,32 @@ func (mset *stream) addConsumerWithAssignment(config *ConsumerConfig, oname stri // Escape '%' in consumer and stream names, as `pre` is used as a template later // in consumer.ackReply(), resulting in erroneous formatting of the ack subject. mn := strings.ReplaceAll(cfg.Name, "%", "%%") - pre := fmt.Sprintf(jsAckT, mn, strings.ReplaceAll(o.name, "%", "%%")) + on := strings.ReplaceAll(o.name, "%", "%%") + domain := strings.ReplaceAll(o.srv.getOpts().JetStreamDomain, "%", "%%") + if domain == _EMPTY_ { + domain = "_" + } + accHash := getHash(accName) + + o.useV2Ack = s.getOpts().getFeatureFlag(FeatureFlagJsAckFormatV2) + + // v1 format: $JS.(ACK|FC)...etc. + o.fcPreOld = jsFlowControlPre + o.fcSubjOld = fmt.Sprintf(jsFlowControl, cfg.Name, o.name) + preOld := fmt.Sprintf(jsAckT, mn, on) + o.ackReplyOldT = fmt.Sprintf("%s.%%d.%%d.%%d.%%d.%%d", preOld) + o.ackSubjOld = fmt.Sprintf("%s.*.*.*.*.*", preOld) + + // v2 format: $JS.(ACK|FC).....etc. + o.fcPre = fmt.Sprintf("%s%s.%s.", jsFlowControlPre, domain, accHash) + o.fcSubj = fmt.Sprintf(jsFlowControlV2, domain, accHash, cfg.Name, o.name) + pre := fmt.Sprintf(jsAckTv2, domain, accHash, mn, on) o.ackReplyT = fmt.Sprintf("%s.%%d.%%d.%%d.%%d.%%d", pre) - o.ackSubj = fmt.Sprintf("%s.*.*.*.*.*", pre) + // Subscribe on this ack subject for v2, we require 11 tokens, but allow for more tokens/extension. + o.ackSubj = fmt.Sprintf("%s.*.*.*.*.>", pre) + o.nextMsgSubj = fmt.Sprintf(JSApiRequestNextT, mn, o.name) + o.resetSubj = fmt.Sprintf(JSApiConsumerResetT, mn, o.name) // Check/update the inactive threshold o.updateInactiveThreshold(&o.cfg) @@ -1304,7 +1428,10 @@ func (mset *stream) addConsumerWithAssignment(config *ConsumerConfig, oname stri mset.setConsumer(o) mset.mu.Unlock() - if config.Direct || (!s.JetStreamIsClustered() && s.standAloneMode()) { + if config.Sourcing && standalone { + o.resetStartingSeq(0, _EMPTY_, false) + } + if config.Direct || standalone { o.setLeader(true) } @@ -1315,7 +1442,7 @@ func (mset *stream) addConsumerWithAssignment(config *ConsumerConfig, oname stri if !s.standAloneMode() && ca == nil { suppress = true } else if ca != nil { - suppress = ca.responded + suppress = ca.hasResponded() } if !suppress { o.sendCreateAdvisory() @@ -1472,18 +1599,39 @@ func (o *consumer) isLeader() bool { return o.leader.Load() } -func (o *consumer) setLeader(isLeader bool) { +func (o *consumer) setLeader(isLeader bool) error { o.mu.RLock() mset, closed := o.mset, o.closed movingToClustered := o.node != nil && o.pch == nil movingToNonClustered := o.node == nil && o.pch != nil wasLeader := o.leader.Swap(isLeader) + + // For clustered new consumers, starting seq selection was deferred from + // addConsumerWithAssignment so the scan wouldn't block the meta apply + // goroutine, run it here on leader-elect instead. + needsSelect := isLeader && !wasLeader && o.dseq == 0 && (o.store == nil || !o.store.HasState()) o.mu.RUnlock() // If we are here we have a change in leader status. if isLeader { if closed || mset == nil { - return + return nil + } + + if needsSelect { + o.mu.Lock() + if err := o.selectStartingSeqNo(); err != nil { + o.srv.Errorf("JetStream consumer '%s > %s > %s' select starting seq failed: %v", + o.acc.Name, o.stream, o.name, err) + o.leader.Store(false) + node := o.node + o.mu.Unlock() + if node != nil { + _ = node.StepDown() + } + return err + } + o.mu.Unlock() } if wasLeader { @@ -1512,7 +1660,7 @@ func (o *consumer) setLeader(isLeader bool) { } o.mu.Unlock() } - return + return nil } mset.mu.RLock() @@ -1548,10 +1696,14 @@ func (o *consumer) setLeader(isLeader bool) { } var err error - if o.cfg.AckPolicy != AckNone { + if o.cfg.AckPolicy != AckNone && o.cfg.AckPolicy != AckFlowControl { + if o.ackSubOld, err = o.subscribeInternal(o.ackSubjOld, o.pushAck); err != nil { + o.mu.Unlock() + return nil + } if o.ackSub, err = o.subscribeInternal(o.ackSubj, o.pushAck); err != nil { o.mu.Unlock() - return + return nil } } @@ -1559,16 +1711,23 @@ func (o *consumer) setLeader(isLeader bool) { // Will error if wrong mode to provide feedback to users. if o.reqSub, err = o.subscribeInternal(o.nextMsgSubj, o.processNextMsgReq); err != nil { o.mu.Unlock() - return + return nil + } + if o.resetSub, err = o.subscribeInternal(o.resetSubj, o.processResetReq); err != nil { + o.mu.Unlock() + return nil } // Check on flow control settings. if o.cfg.FlowControl { o.setMaxPendingBytes(JsFlowControlMaxPending) - fcsubj := fmt.Sprintf(jsFlowControl, stream, o.name) - if o.fcSub, err = o.subscribeInternal(fcsubj, o.processFlowControl); err != nil { + if o.fcSubOld, err = o.subscribeInternal(o.fcSubjOld, o.processFlowControl); err != nil { o.mu.Unlock() - return + return nil + } + if o.fcSub, err = o.subscribeInternal(o.fcSubj, o.processFlowControl); err != nil { + o.mu.Unlock() + return nil } } @@ -1676,12 +1835,16 @@ func (o *consumer) setLeader(isLeader bool) { o.rdq = nil o.rdqi.Empty() o.pending = nil + o.rsm = nil o.resetPendingDeliveries() // ok if they are nil, we protect inside unsubscribe() + o.unsubscribe(o.ackSubOld) o.unsubscribe(o.ackSub) o.unsubscribe(o.reqSub) + o.unsubscribe(o.resetSub) + o.unsubscribe(o.fcSubOld) o.unsubscribe(o.fcSub) - o.ackSub, o.reqSub, o.fcSub = nil, nil, nil + o.ackSubOld, o.ackSub, o.reqSub, o.resetSub, o.fcSubOld, o.fcSub = nil, nil, nil, nil, nil, nil if o.infoSub != nil { o.srv.sysUnsubscribe(o.infoSub) o.infoSub = nil @@ -1704,6 +1867,7 @@ func (o *consumer) setLeader(isLeader bool) { } o.mu.Unlock() } + return nil } // This is coming on the wire so do not block here. @@ -2074,16 +2238,15 @@ func (o *consumer) deleteNotActive() { if !isDirect && s.JetStreamIsClustered() { js.mu.RLock() var ( - cca consumerAssignment meta RaftNode removeEntry []byte ) ca, cc := js.consumerAssignment(acc, stream, name), js.cluster if ca != nil && cc != nil { meta = cc.meta - cca = *ca + cca := ca.clone() cca.Reply = _EMPTY_ - removeEntry = encodeDeleteConsumerAssignment(&cca) + removeEntry = encodeDeleteConsumerAssignment(cca) meta.ForwardProposal(removeEntry) } js.mu.RUnlock() @@ -2452,6 +2615,9 @@ func (o *consumer) updateConfig(cfg *ConsumerConfig) error { // Allowed but considered no-op, [Description, SampleFrequency, MaxWaiting, HeadersOnly] o.cfg = *cfg + if cfg.Sourcing && (!o.srv.JetStreamIsClustered() && o.srv.standAloneMode()) { + o.resetStartingSeqLocked(0, _EMPTY_, false) + } if updatedFilters { // Cleanup messages that lost interest. if o.retention == InterestPolicy { @@ -2557,7 +2723,7 @@ func (o *consumer) processAck(subject, reply string, hdr int, rmsg []byte) { msg = rmsg } - sseq, dseq, dc := ackReplyInfo(subject) + sseq, dseq, dc, _, _ := ackReplyInfo(subject) skipAckReply := sseq == 0 @@ -2617,6 +2783,92 @@ func (o *consumer) updateSkipped(seq uint64) { o.propose(b[:]) } +func (o *consumer) resetStartingSeq(seq uint64, reply string, internal bool) (uint64, bool, error) { + o.mu.Lock() + defer o.mu.Unlock() + return o.resetStartingSeqLocked(seq, reply, internal) +} + +// Lock should be held. +func (o *consumer) resetStartingSeqLocked(seq uint64, reply string, internal bool) (uint64, bool, error) { + // Reset to a specific sequence, or back to the ack floor. + if seq == 0 { + seq = o.asflr + 1 + } else if o.cfg.DeliverPolicy == DeliverAll { + // Always allowed. + goto VALID + } else if o.cfg.DeliverPolicy == DeliverByStartSequence { + // Only allowed if not going below what's configured. + if seq < o.cfg.OptStartSeq { + return 0, false, errors.New("below start seq") + } + goto VALID + } else if o.cfg.DeliverPolicy == DeliverByStartTime && o.mset != nil { + // Only allowed if not going below what's configured. + nseq := o.mset.store.GetSeqFromTime(*o.cfg.OptStartTime) + if seq < nseq { + return 0, false, errors.New("below start time") + } + goto VALID + } else { + return 0, false, errors.New("not allowed") + } + +VALID: + // Must be a minimum of 1. + if seq <= 0 { + seq = 1 + } + // The replicated path requires quorum first before the reset actually takes effect. + if o.node != nil { + if !o.isLeader() { + return 0, false, nil + } + b := make([]byte, 1+8+len(reply)) + b[0] = byte(resetSeqOp) + var le = binary.LittleEndian + le.PutUint64(b[1:], seq) + copy(b[1+8:], reply) + o.propose(b[:]) + if reply != _EMPTY_ { + if o.rsm == nil { + o.rsm = make(map[string]bool, 1) + } + o.rsm[reply] = internal + } + return seq, false, nil + } + o.resetLocalStartingSeq(seq) + if o.store != nil { + o.store.Reset(seq - 1) + // Cleanup messages that lost interest. + if o.retention == InterestPolicy { + if mset := o.mset; mset != nil { + o.mu.Unlock() + ss := mset.state() + o.checkStateForInterestStream(&ss) + o.mu.Lock() + } + } + + // Recalculate pending, and re-trigger message delivery. + o.streamNumPending() + o.signalNewMessages() + return seq, true, nil + } + return seq, false, nil +} + +// Lock should be held. +func (o *consumer) resetLocalStartingSeq(seq uint64) { + o.pending, o.rdc = nil, nil + o.rdq = nil + o.rdqi.Empty() + o.sseq, o.dseq = seq, 1 + o.adflr, o.asflr = o.dseq-1, o.sseq-1 + o.ldt, o.lat = time.Time{}, time.Time{} +} + func (o *consumer) loopAndForwardProposals(qch chan struct{}) { // On exit make sure we nil out pch. defer func() { @@ -2948,11 +3200,17 @@ func (o *consumer) processNak(sseq, dseq, dc uint64, nak []byte) { // to the client, or `false` if there was an error or the ack is replicated (in which // case the reply will be sent later). func (o *consumer) processTerm(sseq, dseq, dc uint64, reason, reply string) bool { - // Treat like an ack to suppress redelivery. - ackedInPlace := o.processAckMsg(sseq, dseq, dc, reply, false) + return o.processTermLocked(sseq, dseq, dc, reason, reply, true) +} - o.mu.Lock() - defer o.mu.Unlock() +func (o *consumer) processTermLocked(sseq, dseq, dc uint64, reason, reply string, needLock bool) bool { + // Treat like an ack to suppress redelivery. + ackedInPlace := o.processAckMsgLocked(sseq, dseq, dc, reply, false, needLock) + + if needLock { + o.mu.Lock() + defer o.mu.Unlock() + } // Deliver an advisory e := JSConsumerDeliveryTerminatedAdvisory{ @@ -3161,6 +3419,14 @@ func (o *consumer) infoWithSnapAndReply(snap bool, reply string) *ConsumerInfo { return nil } + dseq, sseq := o.dseq, o.sseq + if dseq <= 0 { + dseq = 1 + } + if sseq <= 0 { + sseq = 1 + } + cfg := o.cfg info := &ConsumerInfo{ Stream: o.stream, @@ -3168,8 +3434,8 @@ func (o *consumer) infoWithSnapAndReply(snap bool, reply string) *ConsumerInfo { Created: o.created, Config: &cfg, Delivered: SequenceInfo{ - Consumer: o.dseq - 1, - Stream: o.sseq - 1, + Consumer: dseq - 1, + Stream: sseq - 1, }, AckFloor: SequenceInfo{ Consumer: o.adflr, @@ -3305,20 +3571,36 @@ func (o *consumer) sampleAck(sseq, dseq, dc uint64) { // to the client, or `false` if there was an error or the ack is replicated (in which // case the reply will be sent later). func (o *consumer) processAckMsg(sseq, dseq, dc uint64, reply string, doSample bool) bool { - o.mu.Lock() + return o.processAckMsgLocked(sseq, dseq, dc, reply, doSample, true) +} + +func (o *consumer) processAckMsgLocked(sseq, dseq, dc uint64, reply string, doSample bool, needLock bool) bool { + lock := func() { + if needLock { + o.mu.Lock() + } + } + unlock := func() { + if needLock { + o.mu.Unlock() + } + } + lock() if o.closed { - o.mu.Unlock() + unlock() return false } mset := o.mset if mset == nil || mset.closed.Load() { - o.mu.Unlock() + unlock() return false } // Check if this ack is above the current pointer to our next to deliver. - if sseq >= o.sseq { + // Ignore if it's a flow-controlled consumer, its state could end up further ahead + // since its state is not replicated before delivery. + if sseq >= o.sseq && !o.cfg.FlowControl { // Let's make sure this is valid. // This is only received on the consumer leader, so should never be higher // than the last stream sequence. But could happen if we've just become @@ -3333,14 +3615,16 @@ func (o *consumer) processAckMsg(sseq, dseq, dc uint64, reply string, doSample b // Even though another leader must have delivered a message with this sequence, we must not adjust // the current pointer. This could otherwise result in a stuck consumer, where messages below this // sequence can't be redelivered, and we'll have incorrect pending state and ack floors. - o.mu.Unlock() + unlock() return false } // Let the owning stream know if we are interest or workqueue retention based. // If this consumer is clustered (o.node != nil) this will be handled by // processReplicatedAck after the ack has propagated. - ackInPlace := o.node == nil && o.retention != LimitsPolicy + // If we're already holding the lock we can't ack in place, since that will + // violate lock ordering with respect to the stream. + ackInPlace := o.node == nil && o.retention != LimitsPolicy && needLock var sgap, floor uint64 var needSignal bool @@ -3376,10 +3660,10 @@ func (o *consumer) processAckMsg(sseq, dseq, dc uint64, reply string, doSample b } delete(o.rdc, sseq) o.removeFromRedeliverQueue(sseq) - case AckAll: + case AckAll, AckFlowControl: // no-op if dseq <= o.adflr || sseq <= o.asflr { - o.mu.Unlock() + unlock() // Return true to let caller respond back to the client. return true } @@ -3412,7 +3696,7 @@ func (o *consumer) processAckMsg(sseq, dseq, dc uint64, reply string, doSample b } case AckNone: // FIXME(dlc) - This is error but do we care? - o.mu.Unlock() + unlock() return ackInPlace } @@ -3423,7 +3707,7 @@ func (o *consumer) processAckMsg(sseq, dseq, dc uint64, reply string, doSample b } // Update underlying store. o.updateAcks(dseq, sseq, reply) - o.mu.Unlock() + unlock() if ackInPlace { if sgap > 1 { @@ -3536,7 +3820,7 @@ func (o *consumer) needAck(sseq uint64, subj string) bool { } switch o.cfg.AckPolicy { - case AckNone, AckAll: + case AckNone, AckAll, AckFlowControl: needAck = sseq > asflr case AckExplicit: if sseq > asflr { @@ -4162,6 +4446,42 @@ func (o *consumer) processNextMsgReq(_ *subscription, c *client, _ *Account, _, o.nextMsgReqs.push(newNextMsgReq(reply, copyBytes(msg))) } +// processResetReq will reset a consumer to a new starting sequence. +func (o *consumer) processResetReq(_ *subscription, c *client, a *Account, _, reply string, rmsg []byte) { + if reply == _EMPTY_ { + return + } + + s := o.srv + var resp = JSApiConsumerResetResponse{ApiResponse: ApiResponse{Type: JSApiConsumerResetResponseType}} + + hdr, msg := c.msgParts(rmsg) + if errorOnRequiredApiLevel(hdr) { + resp.Error = NewJSRequiredApiLevelError() + s.sendInternalAccountMsg(a, reply, s.jsonResponse(&resp)) + return + } + + // An empty message resets back to the ack floor, otherwise a custom sequence can be used. + var req JSApiConsumerResetRequest + if len(msg) > 0 { + if err := json.Unmarshal(msg, &req); err != nil { + resp.Error = NewJSInvalidJSONError(err) + s.sendInternalAccountMsg(a, reply, s.jsonResponse(&resp)) + return + } + } + resetSeq, canRespond, err := o.resetStartingSeq(req.Seq, reply, false) + if err != nil { + resp.Error = NewJSConsumerInvalidResetError(err) + s.sendInternalAccountMsg(a, reply, s.jsonResponse(&resp)) + } else if canRespond { + resp.ConsumerInfo = setDynamicConsumerInfoMetadata(o.info()) + resp.ResetSeq = resetSeq + s.sendInternalAccountMsg(a, reply, s.jsonResponse(&resp)) + } +} + func (o *consumer) processNextMsgRequest(reply string, msg []byte) { o.mu.Lock() defer o.mu.Unlock() @@ -4451,7 +4771,7 @@ func (o *consumer) getNextMsg() (*jsPubMsg, uint64, error) { sm, err := o.mset.store.LoadMsg(seq, &pmsg.StoreMsg) if sm == nil || err != nil { pmsg.returnToPool() - pmsg, dc = nil, 0 + pmsg = nil // Adjust back deliver count. o.decDeliveryCount(seq) } @@ -4459,10 +4779,14 @@ func (o *consumer) getNextMsg() (*jsPubMsg, uint64, error) { if err == ErrStoreMsgNotFound || err == errDeletedMsg { // This is a race condition where the message is still in o.pending and // scheduled for redelivery, but it has been removed from the stream. - // o.processTerm is called in a goroutine so could run after we get here. + // o.processTerm is called in a goroutine so would normally run. However, + // if we get here this likely didn't fire, or we are replicated and changed leaders. // That will correct the pending state and delivery/ack floors, so just skip here. pmsg.returnToPool() pmsg = nil + if p, ok := o.pending[seq]; ok { + o.processTermLocked(seq, p.Sequence, dc-1, ackTermUnackedLimitsReason, _EMPTY_, false) + } continue } return pmsg, dc, err @@ -4968,19 +5292,9 @@ func (o *consumer) loopAndGatherMsgs(qch chan struct{}) { wrn, wrb = wr.n, wr.b dsubj = wr.reply if o.cfg.PriorityPolicy == PriorityPinnedClient { - // FIXME(jrm): Can we make this prettier? - if len(pmsg.hdr) == 0 { - pmsg.hdr = genHeader(pmsg.hdr, JSPullRequestNatsPinId, o.currentPinId) - pmsg.buf = append(pmsg.hdr, pmsg.msg...) - } else { - pmsg.hdr = genHeader(pmsg.hdr, JSPullRequestNatsPinId, o.currentPinId) - bufLen := len(pmsg.hdr) + len(pmsg.msg) - pmsg.buf = make([]byte, bufLen) - pmsg.buf = append(pmsg.hdr, pmsg.msg...) - } - + pmsg.hdr = genHeader(pmsg.hdr, JSPullRequestNatsPinId, o.currentPinId) + pmsg.buf = append(pmsg.hdr, pmsg.msg...) sz = len(pmsg.subj) + len(ackReply) + len(pmsg.hdr) + len(pmsg.msg) - } if done := wr.recycleIfDone(); done && o.node != nil { o.removeClusterPendingRequest(dsubj) @@ -5097,9 +5411,13 @@ func (o *consumer) loopAndGatherMsgs(qch chan struct{}) { o.mu.Unlock() case <-hbc: if o.isActive() { - o.mu.RLock() + o.mu.Lock() o.sendIdleHeartbeat(odsubj) - o.mu.RUnlock() + // Send flow control on EOS if it's used for acknowledgements. + if o.cfg.AckPolicy == AckFlowControl && len(o.pending) > 0 && o.fcid == _EMPTY_ { + o.sendFlowControl() + } + o.mu.Unlock() } // Reset our idle heartbeat timer. hb.Reset(hbd) @@ -5121,7 +5439,10 @@ func (o *consumer) sendIdleHeartbeat(subj string) { } func (o *consumer) ackReply(sseq, dseq, dc uint64, ts int64, pending uint64) string { - return fmt.Sprintf(o.ackReplyT, dc, sseq, dseq, ts, pending) + if o.useV2Ack { + return fmt.Sprintf(o.ackReplyT, dc, sseq, dseq, ts, pending) + } + return fmt.Sprintf(o.ackReplyOldT, dc, sseq, dseq, ts, pending) } // Used mostly for testing. Sets max pending bytes for flow control setups. @@ -5275,11 +5596,11 @@ func (o *consumer) deliverMsg(dsubj, ackReply string, pmsg *jsPubMsg, dc uint64, // Update delivered first. o.updateDelivered(dseq, seq, dc, ts) - if ap == AckExplicit || ap == AckAll { - o.trackPending(seq, dseq) - } else if ap == AckNone { + if ap == AckNone { o.adflr = dseq o.asflr = seq + } else { + o.trackPending(seq, dseq) } // Send message. @@ -5327,6 +5648,10 @@ func (o *consumer) needFlowControl(sz int) bool { if o.fcid == _EMPTY_ && o.pbytes > o.maxpb/2 { return true } + // Or, when acking based on flow control, we need to send it if we've hit the max pending limit earlier. + if o.fcid == _EMPTY_ && o.cfg.AckPolicy == AckFlowControl && o.maxp > 0 && len(o.pending) >= o.maxp { + return true + } // If we have an existing outstanding FC, check to see if we need to expand the o.fcsz if o.fcid != _EMPTY_ && (o.pbytes-o.fcsz) >= o.maxpb { o.fcsz += sz @@ -5334,12 +5659,12 @@ func (o *consumer) needFlowControl(sz int) bool { return false } -func (o *consumer) processFlowControl(_ *subscription, c *client, _ *Account, subj, _ string, _ []byte) { +func (o *consumer) processFlowControl(_ *subscription, c *client, _ *Account, subj, _ string, rmsg []byte) { o.mu.Lock() - defer o.mu.Unlock() // Ignore if not the latest we have sent out. if subj != o.fcid { + o.mu.Unlock() return } @@ -5359,12 +5684,35 @@ func (o *consumer) processFlowControl(_ *subscription, c *client, _ *Account, su o.fcid, o.fcsz = _EMPTY_, 0 o.signalNewMessages() + ackFlowControl := o.cfg.AckPolicy == AckFlowControl + o.mu.Unlock() + + if !ackFlowControl { + return + } + hdr, _ := c.msgParts(rmsg) + if len(hdr) > 0 { + ldseq := parseInt64(sliceHeader(JSLastConsumerSeq, hdr)) + lsseq := parseInt64(sliceHeader(JSLastStreamSeq, hdr)) + if lsseq > 0 { + // Delivered sequence is allowed to be zero as a response + // to flow control without any deliveries. + if ldseq <= 0 { + ldseq = 0 + } + o.processAckMsg(uint64(lsseq), uint64(ldseq), 1, _EMPTY_, false) + } + } } // Lock should be held. func (o *consumer) fcReply() string { var sb strings.Builder - sb.WriteString(jsFlowControlPre) + if o.useV2Ack { + sb.WriteString(o.fcPre) + } else { + sb.WriteString(o.fcPreOld) + } sb.WriteString(o.stream) sb.WriteByte(btsep) sb.WriteString(o.name) @@ -5542,8 +5890,9 @@ func (o *consumer) checkPending() { defer o.mu.Unlock() mset := o.mset + ttl := int64(o.cfg.AckWait) // On stop, mset and timer will be nil. - if o.closed || mset == nil || o.ptmr == nil { + if o.closed || mset == nil || o.ptmr == nil || ttl == 0 { o.stopAndClearPtmr() return } @@ -5554,7 +5903,6 @@ func (o *consumer) checkPending() { fseq := state.FirstSeq now := time.Now().UnixNano() - ttl := int64(o.cfg.AckWait) next := int64(o.ackWait(0)) // However, if there is backoff, initializes with the largest backoff. // It will be adjusted as needed. @@ -5657,13 +6005,13 @@ func (o *consumer) checkPending() { // SeqFromReply will extract a sequence number from a reply subject. func (o *consumer) seqFromReply(reply string) uint64 { - _, dseq, _ := ackReplyInfo(reply) + _, dseq, _, _, _ := ackReplyInfo(reply) return dseq } // StreamSeqFromReply will extract the stream sequence from the reply subject. func (o *consumer) streamSeqFromReply(reply string) uint64 { - sseq, _, _ := ackReplyInfo(reply) + sseq, _, _, _, _ := ackReplyInfo(reply) return sseq } @@ -5681,11 +6029,14 @@ func parseAckReplyNum(d string) (n int64) { return n } -const expectedNumReplyTokens = 9 +const ( + expectedNumReplyTokensV1 = 9 + expectedNumReplyTokensV2 = 11 +) // Grab encoded information in the reply subject for a delivered message. -func replyInfo(subject string) (sseq, dseq, dc uint64, ts int64, pending uint64) { - tsa := [expectedNumReplyTokens]string{} +func ackReplyInfo(subject string) (sseq, dseq, dc uint64, ts int64, pending uint64) { + tsa := [expectedNumReplyTokensV2]string{} start, tokens := 0, tsa[:0] for i := 0; i < len(subject); i++ { if subject[i] == btsep { @@ -5694,38 +6045,23 @@ func replyInfo(subject string) (sseq, dseq, dc uint64, ts int64, pending uint64) } } tokens = append(tokens, subject[start:]) - if len(tokens) != expectedNumReplyTokens || tokens[0] != "$JS" || tokens[1] != "ACK" { + if (len(tokens) != expectedNumReplyTokensV1 && len(tokens) < expectedNumReplyTokensV2) || tokens[0] != "$JS" || tokens[1] != "ACK" { return 0, 0, 0, 0, 0 } + offset := 2 + if len(tokens) >= expectedNumReplyTokensV2 { + offset = 4 + } // TODO(dlc) - Should we error if we do not match consumer name? - // stream is tokens[2], consumer is 3. - dc = uint64(parseAckReplyNum(tokens[4])) - sseq, dseq = uint64(parseAckReplyNum(tokens[5])), uint64(parseAckReplyNum(tokens[6])) - ts = parseAckReplyNum(tokens[7]) - pending = uint64(parseAckReplyNum(tokens[8])) + // stream is tokens[offset], consumer is offset+1. + dc = uint64(parseAckReplyNum(tokens[offset+2])) + sseq, dseq = uint64(parseAckReplyNum(tokens[offset+3])), uint64(parseAckReplyNum(tokens[offset+4])) + ts = parseAckReplyNum(tokens[offset+5]) + pending = uint64(parseAckReplyNum(tokens[offset+6])) return sseq, dseq, dc, ts, pending } -func ackReplyInfo(subject string) (sseq, dseq, dc uint64) { - tsa := [expectedNumReplyTokens]string{} - start, tokens := 0, tsa[:0] - for i := 0; i < len(subject); i++ { - if subject[i] == btsep { - tokens = append(tokens, subject[start:i]) - start = i + 1 - } - } - tokens = append(tokens, subject[start:]) - if len(tokens) != expectedNumReplyTokens || tokens[0] != "$JS" || tokens[1] != "ACK" { - return 0, 0, 0 - } - dc = uint64(parseAckReplyNum(tokens[4])) - sseq, dseq = uint64(parseAckReplyNum(tokens[5])), uint64(parseAckReplyNum(tokens[6])) - - return sseq, dseq, dc -} - // NextSeq returns the next delivered sequence number for this consumer. func (o *consumer) nextSeq() uint64 { o.mu.RLock() @@ -5746,8 +6082,69 @@ func (o *consumer) hasSkipListPending() bool { return o.lss != nil && len(o.lss.seqs) > 0 } +// reconcileStateWithStream reconciles consumer state when the stream has reverted +// due to data loss (e.g., VM crash). This handles the case where consumer state +// is ahead of the stream's last sequence. +// Lock should be held. +func (o *consumer) reconcileStateWithStream(streamLastSeq uint64) { + // If an ack floor is higher than stream last sequence, + // reset back down but keep the highest known sequences. + if o.asflr > streamLastSeq { + o.asflr = streamLastSeq + // Delivery floor is one below the delivered sequence, + // but if it is zero somehow, ensure we don't underflow. + o.adflr = o.dseq + if o.adflr > 0 { + o.adflr-- + } + o.pending = nil + o.rdc = nil + } + + // Remove pending entries that are beyond the stream's last sequence + if len(o.pending) > 0 { + for seq := range o.pending { + if seq > streamLastSeq { + delete(o.pending, seq) + } + } + } + + // Remove redelivered entries that are beyond the stream's last sequence + if len(o.rdc) > 0 { + for seq := range o.rdc { + if seq > streamLastSeq { + delete(o.rdc, seq) + } + } + } + + // Update starting sequence and delivery sequence based on pending state + if len(o.pending) == 0 { + o.sseq = o.asflr + 1 + o.dseq = o.adflr + 1 + } else { + // Find highest stream sequence in pending + var maxStreamSeq uint64 + var maxConsumerSeq uint64 + + for streamSeq, p := range o.pending { + if streamSeq > maxStreamSeq { + maxStreamSeq = streamSeq + } + if p.Sequence > maxConsumerSeq { + maxConsumerSeq = p.Sequence + } + } + + // Set next sequences based on highest pending + o.sseq = maxStreamSeq + 1 + o.dseq = maxConsumerSeq + 1 + } +} + // Will select the starting sequence. -func (o *consumer) selectStartingSeqNo() { +func (o *consumer) selectStartingSeqNo() error { if o.mset == nil || o.mset.store == nil { o.sseq = 1 } else { @@ -5762,7 +6159,10 @@ func (o *consumer) selectStartingSeqNo() { } else { // If we are partitioned here this will be properly set when we become leader. for _, filter := range o.subjf { - ss := o.mset.store.FilteredState(1, filter.subject) + ss, err := o.mset.store.FilteredState(1, filter.subject) + if err != nil { + return err + } if ss.Last > o.sseq { o.sseq = ss.Last } @@ -5808,7 +6208,10 @@ func (o *consumer) selectStartingSeqNo() { nseq := state.LastSeq for _, filter := range o.subjf { // Use first sequence since this is more optimized atm. - ss := o.mset.store.FilteredState(state.FirstSeq, filter.subject) + ss, err := o.mset.store.FilteredState(state.FirstSeq, filter.subject) + if err != nil { + return err + } if ss.First >= o.sseq && ss.First < nseq { nseq = ss.First } @@ -5850,8 +6253,11 @@ func (o *consumer) selectStartingSeqNo() { // Set our starting sequence state. // But only if we're not clustered, if clustered we propose upon becoming leader. if o.store != nil && o.sseq > 0 && o.cfg.replicas(&o.mset.cfg) == 1 { - o.store.SetStarting(o.sseq - 1) + if err := o.store.SetStarting(o.sseq - 1); err != nil { + return err + } } + return nil } // Test whether a config represents a durable subscriber. @@ -5884,6 +6290,41 @@ func createConsumerName() string { return getHash(nuid.Next()) } +// Lock should be held. +func (mset *stream) createStableConsumerHash() string { + id := fmt.Sprintf("%s %s", mset.cfg.Name, mset.acc.Name) + if domain := mset.srv.getOpts().JetStreamDomain; domain != _EMPTY_ { + id = fmt.Sprintf("%s %s", id, domain) + } + return getHash(id) +} + +// Lock should be held. +func (mset *stream) createSourcingConsumerHash(ssi *StreamSource, sources []*StreamSource) string { + id := mset.createStableConsumerHash() + + // If the stream sources contain the same stream at least twice, we use a more strict hash of + // an ID that also contains filter subjects etc. If the stream name is only used once, we can + // support the stable identifier above. + var once bool + for _, src := range sources { + if src.Name == ssi.Name { + if once { + if ssi.iname == _EMPTY_ { + ssi.setIndexName() + } + // Append identifying information of the filter subjects, etc. to make it unique + id = fmt.Sprintf("%s %s", id, ssi.iname) + break + } else { + once = true + } + } + } + + return getHash(id) +} + // deleteConsumer will delete the consumer from this stream. func (mset *stream) deleteConsumer(o *consumer) error { return o.delete() @@ -6108,11 +6549,17 @@ func (o *consumer) stopWithFlags(dflag, sdflag, doSignal, advisory bool) error { mset := o.mset o.mset = nil o.active = false + o.unsubscribe(o.ackSubOld) o.unsubscribe(o.ackSub) o.unsubscribe(o.reqSub) + o.unsubscribe(o.resetSub) + o.unsubscribe(o.fcSubOld) o.unsubscribe(o.fcSub) + o.ackSubOld = nil o.ackSub = nil o.reqSub = nil + o.resetSub = nil + o.fcSubOld = nil o.fcSub = nil if o.infoSub != nil { o.srv.sysUnsubscribe(o.infoSub) @@ -6577,6 +7024,12 @@ func (o *consumer) checkStateForInterestStream(ss *StreamState) error { } func (o *consumer) resetPtmr(delay time.Duration) { + // A delay of zero means it should be stopped. + if delay == 0 { + o.stopAndClearPtmr() + return + } + if o.ptmr == nil { o.ptmr = time.AfterFunc(delay, o.checkPending) } else { @@ -6586,6 +7039,10 @@ func (o *consumer) resetPtmr(delay time.Duration) { } func (o *consumer) stopAndClearPtmr() { + // If the end time is unset, short-circuit since the timer will already be stopped. + if o.ptmrEnd.IsZero() { + return + } stopAndClearTimer(&o.ptmr) o.ptmrEnd = time.Time{} } diff --git a/vendor/github.com/nats-io/nats-server/v2/server/cron.go b/vendor/github.com/nats-io/nats-server/v2/server/cron.go new file mode 100644 index 000000000..558e2a790 --- /dev/null +++ b/vendor/github.com/nats-io/nats-server/v2/server/cron.go @@ -0,0 +1,327 @@ +// Copyright 2025 The NATS Authors +// Licensed under the Apache License, Version 2.0 (the "License"); +// you may not use this file except in compliance with the License. +// You may obtain a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, +// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +// See the License for the specific language governing permissions and +// limitations under the License. +// +// Based on code from https://github.com/robfig/cron +// Copyright (C) 2012 Rob Figueiredo +// All Rights Reserved. +// +// MIT LICENSE +// +// Permission is hereby granted, free of charge, to any person obtaining a copy of +// this software and associated documentation files (the "Software"), to deal in +// the Software without restriction, including without limitation the rights to +// use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of +// the Software, and to permit persons to whom the Software is furnished to do so, +// subject to the following conditions: +// +// The above copyright notice and this permission notice shall be included in all +// copies or substantial portions of the Software. +// +// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS +// FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR +// COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER +// IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN +// CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + +package server + +import ( + "errors" + "fmt" + "math" + "strconv" + "strings" + "time" +) + +// parseCron parses the given cron pattern and returns the next time it will fire based on the provided ts. +func parseCron(pattern string, loc *time.Location, ts int64) (time.Time, error) { + fields := strings.Fields(pattern) + if len(fields) != 6 { + return time.Time{}, fmt.Errorf("pattern requires 6 fields, got %d", len(fields)) + } + + // If no time zone is passed, default to UTC. + if loc == nil { + loc = time.UTC + } + + // Parse each field. + var err error + var second, minute, hour, dayOfMonth, month, dayOfWeek uint64 + if second, err = getField(fields[0], seconds); err != nil { + return time.Time{}, err + } + if minute, err = getField(fields[1], minutes); err != nil { + return time.Time{}, err + } + if hour, err = getField(fields[2], hours); err != nil { + return time.Time{}, err + } + if dayOfMonth, err = getField(fields[3], dom); err != nil { + return time.Time{}, err + } + if month, err = getField(fields[4], months); err != nil { + return time.Time{}, err + } + if dayOfWeek, err = getField(fields[5], dow); err != nil { + return time.Time{}, err + } + + // General approach + // + // For Month, Day, Hour, Minute, Second: + // Check if the time value matches. If yes, continue to the next field. + // If the field doesn't match the schedule, then increment the field until it matches. + // While incrementing the field, a wrap-around brings it back to the beginning + // of the field list (since it is necessary to re-verify previous field values) + next := time.Unix(0, ts).In(loc) + + // Start at the earliest possible time (the upcoming second). + next = next.Truncate(time.Second).Add(time.Second) + + // This flag indicates whether a field has been truncated at one point. + truncated := false + + // If no time is found within five years, return error. + yearLimit := next.Year() + 5 + +WRAP: + if next.Year() > yearLimit { + return time.Time{}, errors.New("pattern exceeds maximum range") + } + for 1< 1 { + extra = 0 + } + default: + return 0, fmt.Errorf("too many slashes: %s", expr) + } + + if start < r.min { + return 0, fmt.Errorf("beginning of range (%d) below minimum (%d): %s", start, r.min, expr) + } + if end > r.max { + return 0, fmt.Errorf("end of range (%d) above maximum (%d): %s", end, r.max, expr) + } + if start > end { + return 0, fmt.Errorf("beginning of range (%d) beyond end of range (%d): %s", start, end, expr) + } + if step == 0 { + return 0, fmt.Errorf("step of range should be a positive number: %s", expr) + } + return getBits(start, end, step) | extra, nil +} + +// parseIntOrName returns the (possibly-named) integer contained in expr. +func parseIntOrName(expr string, names map[string]uint) (uint, error) { + if names != nil { + if namedInt, ok := names[strings.ToLower(expr)]; ok { + return namedInt, nil + } + } + return mustParseInt(expr) +} + +// mustParseInt parses the given expression as an int or returns an error. +func mustParseInt(expr string) (uint, error) { + num, err := strconv.Atoi(expr) + if err != nil { + return 0, fmt.Errorf("failed to parse int from %s: %s", expr, err) + } + if num < 0 { + return 0, fmt.Errorf("negative number (%d) not allowed: %s", num, expr) + } + return uint(num), nil +} + +// getBits sets all bits in the range [min, max], modulo the given step size. +func getBits(min, max, step uint) uint64 { + var bits uint64 + + // If step is 1, use shifts. + if step == 1 { + return ^(math.MaxUint64 << (max + 1)) & (math.MaxUint64 << min) + } + + // Else, use a simple loop. + for i := min; i <= max; i += step { + bits |= 1 << i + } + return bits +} + +// bounds provides a range of acceptable values (plus a map of name to value). +type bounds struct { + min, max uint + names map[string]uint +} + +// The bounds for each field. +var ( + seconds = bounds{0, 59, nil} + minutes = bounds{0, 59, nil} + hours = bounds{0, 23, nil} + dom = bounds{1, 31, nil} + months = bounds{1, 12, map[string]uint{ + "jan": 1, + "feb": 2, + "mar": 3, + "apr": 4, + "may": 5, + "jun": 6, + "jul": 7, + "aug": 8, + "sep": 9, + "oct": 10, + "nov": 11, + "dec": 12, + }} + dow = bounds{0, 6, map[string]uint{ + "sun": 0, + "mon": 1, + "tue": 2, + "wed": 3, + "thu": 4, + "fri": 5, + "sat": 6, + }} +) + +const ( + // Set the top bit if a star was included in the expression. + starBit = 1 << 63 +) + +// dayMatches returns true if the schedule's day-of-week and day-of-month +// restrictions are satisfied by the given time. +func dayMatches(dayOfMonth, dayOfWeek uint64, t time.Time) bool { + var ( + domMatch = 1< 0 + dowMatch = 1< 0 + ) + if dayOfMonth&starBit > 0 || dayOfWeek&starBit > 0 { + return domMatch && dowMatch + } + return domMatch || dowMatch +} diff --git a/vendor/github.com/nats-io/nats-server/v2/server/errors.json b/vendor/github.com/nats-io/nats-server/v2/server/errors.json index 97c21c7ee..49c45a705 100644 --- a/vendor/github.com/nats-io/nats-server/v2/server/errors.json +++ b/vendor/github.com/nats-io/nats-server/v2/server/errors.json @@ -2008,5 +2008,215 @@ "help": "", "url": "", "deprecates": "" + }, + { + "constant": "JSMessageSchedulesSourceInvalidErr", + "code": 400, + "error_code": 10203, + "description": "message schedules source is invalid", + "comment": "", + "help": "", + "url": "", + "deprecates": "" + }, + { + "constant": "JSConsumerInvalidResetErr", + "code": 400, + "error_code": 10204, + "description": "invalid reset: {err}", + "comment": "", + "help": "", + "url": "", + "deprecates": "" + }, + { + "constant": "JSBatchPublishDisabledErr", + "code": 400, + "error_code": 10205, + "description": "batch publish is disabled", + "comment": "", + "help": "", + "url": "", + "deprecates": "" + }, + { + "constant": "JSBatchPublishInvalidPatternErr", + "code": 400, + "error_code": 10206, + "description": "batch publish pattern is invalid", + "comment": "", + "help": "", + "url": "", + "deprecates": "" + }, + { + "constant": "JSBatchPublishInvalidBatchIDErr", + "code": 400, + "error_code": 10207, + "description": "batch publish ID is invalid", + "comment": "", + "help": "", + "url": "", + "deprecates": "" + }, + { + "constant": "JSBatchPublishUnknownBatchIDErr", + "code": 400, + "error_code": 10208, + "description": "batch publish ID unknown", + "comment": "", + "help": "", + "url": "", + "deprecates": "" + }, + { + "constant": "JSMirrorWithBatchPublishErr", + "code": 400, + "error_code": 10209, + "description": "stream mirrors can not also use batch publishing", + "comment": "", + "help": "", + "url": "", + "deprecates": "" + }, + { + "constant": "JSAtomicPublishTooManyInflight", + "code": 429, + "error_code": 10210, + "description": "atomic publish too many inflight", + "comment": "", + "help": "", + "url": "", + "deprecates": "" + }, + { + "constant": "JSBatchPublishTooManyInflight", + "code": 429, + "error_code": 10211, + "description": "batch publish too many inflight", + "comment": "", + "help": "", + "url": "", + "deprecates": "" + }, + { + "constant": "JSMessageSchedulesSchedulerInvalidErr", + "code": 400, + "error_code": 10212, + "description": "message schedules invalid scheduler", + "comment": "", + "help": "", + "url": "", + "deprecates": "" + }, + { + "constant": "JSMirrorDurableConsumerCfgInvalid", + "code": 400, + "error_code": 10213, + "description": "stream mirror consumer config is invalid", + "comment": "", + "help": "", + "url": "", + "deprecates": "" + }, + { + "constant": "JSMirrorConsumerRequiresAckFCErr", + "code": 400, + "error_code": 10214, + "description": "stream mirror consumer requires flow control ack policy", + "comment": "", + "help": "", + "url": "", + "deprecates": "" + }, + { + "constant": "JSSourceDurableConsumerCfgInvalid", + "code": 400, + "error_code": 10215, + "description": "stream source consumer config is invalid", + "comment": "", + "help": "", + "url": "", + "deprecates": "" + }, + { + "constant": "JSSourceDurableConsumerDuplicateDetected", + "code": 400, + "error_code": 10216, + "description": "duplicate stream source consumer detected", + "comment": "", + "help": "", + "url": "", + "deprecates": "" + }, + { + "constant": "JSSourceConsumerRequiresAckFCErr", + "code": 400, + "error_code": 10217, + "description": "stream source consumer requires flow control ack policy", + "comment": "", + "help": "", + "url": "", + "deprecates": "" + }, + { + "constant": "JSConsumerAckFCRequiresPushErr", + "code": 400, + "error_code": 10218, + "description": "flow control ack policy requires a push based consumer", + "comment": "", + "help": "", + "url": "", + "deprecates": "" + }, + { + "constant": "JSConsumerAckFCRequiresFCErr", + "code": 400, + "error_code": 10219, + "description": "flow control ack policy requires flow control", + "comment": "", + "help": "", + "url": "", + "deprecates": "" + }, + { + "constant": "JSConsumerAckFCRequiresMaxAckPendingErr", + "code": 400, + "error_code": 10220, + "description": "flow control ack policy requires max ack pending", + "comment": "", + "help": "", + "url": "", + "deprecates": "" + }, + { + "constant": "JSConsumerAckFCRequiresNoAckWaitErr", + "code": 400, + "error_code": 10221, + "description": "flow control ack policy requires unset ack wait", + "comment": "", + "help": "", + "url": "", + "deprecates": "" + }, + { + "constant": "JSConsumerAckFCRequiresNoMaxDeliverErr", + "code": 400, + "error_code": 10222, + "description": "flow control ack policy requires unset max deliver", + "comment": "", + "help": "", + "url": "", + "deprecates": "" + }, + { + "constant": "JSMessageSchedulesTimeZoneInvalidErr", + "code": 400, + "error_code": 10223, + "description": "message schedules time zone is invalid", + "comment": "", + "help": "", + "url": "", + "deprecates": "" } -] +] \ No newline at end of file diff --git a/vendor/github.com/nats-io/nats-server/v2/server/events.go b/vendor/github.com/nats-io/nats-server/v2/server/events.go index bfe190cd0..8bc9bcd51 100644 --- a/vendor/github.com/nats-io/nats-server/v2/server/events.go +++ b/vendor/github.com/nats-io/nats-server/v2/server/events.go @@ -247,14 +247,15 @@ type ServerCapability uint64 // ServerInfo identifies remote servers. type ServerInfo struct { - Name string `json:"name"` - Host string `json:"host"` - ID string `json:"id"` - Cluster string `json:"cluster,omitempty"` - Domain string `json:"domain,omitempty"` - Version string `json:"ver"` - Tags []string `json:"tags,omitempty"` - Metadata map[string]string `json:"metadata,omitempty"` + Name string `json:"name"` + Host string `json:"host"` + ID string `json:"id"` + Cluster string `json:"cluster,omitempty"` + Domain string `json:"domain,omitempty"` + Version string `json:"ver"` + Tags []string `json:"tags,omitempty"` + Metadata map[string]string `json:"metadata,omitempty"` + FeatureFlags map[string]bool `json:"feature_flags,omitempty"` // Whether JetStream is enabled (deprecated in favor of the `ServerCapability`). JetStream bool `json:"jetstream"` // Generic capability flags @@ -328,6 +329,7 @@ type ClientInfo struct { ClientType string `json:"client_type,omitempty"` MQTTClient string `json:"client_id,omitempty"` // This is the MQTT client ID Nonce string `json:"nonce,omitempty"` + Reply string `json:"reply,omitempty"` // Original reply subject after a service import (only when needed). } // forAssignmentSnap returns the minimum amount of ClientInfo we need for assignment snapshots. @@ -518,7 +520,7 @@ RESET: // Grab tags and metadata. opts := s.getOpts() - tags, metadata := opts.Tags, opts.Metadata + tags, metadata, featureFlags := opts.Tags, opts.Metadata, opts.getMergedFeatureFlags() for s.eventsRunning() { select { @@ -536,6 +538,7 @@ RESET: si.Time = time.Now().UTC() si.Tags = tags si.Metadata = metadata + si.FeatureFlags = featureFlags si.Flags = 0 if js { // New capability based flags. @@ -1052,8 +1055,15 @@ func (s *Server) sendStatsz(subj string) { Size: mg.ClusterSize(), } } - if ipq := s.jsAPIRoutedReqs; ipq != nil && jStat.Meta != nil { - jStat.Meta.Pending = ipq.len() + if jStat.Meta != nil { + if ipq := s.jsAPIRoutedReqs; ipq != nil { + jStat.Meta.PendingRequests = ipq.len() + } + if ipq := s.jsAPIRoutedInfoReqs; ipq != nil { + jStat.Meta.PendingInfos = ipq.len() + } + jStat.Meta.Pending = jStat.Meta.PendingRequests + jStat.Meta.PendingInfos + jStat.Meta.Snapshot = s.metaClusterSnapshotStats(js, mg) } } jStat.Limits = &s.getOpts().JetStreamLimits diff --git a/vendor/github.com/nats-io/nats-server/v2/server/feature_flags.go b/vendor/github.com/nats-io/nats-server/v2/server/feature_flags.go new file mode 100644 index 000000000..a0744adc5 --- /dev/null +++ b/vendor/github.com/nats-io/nats-server/v2/server/feature_flags.go @@ -0,0 +1,130 @@ +// Copyright 2026 The NATS Authors +// Licensed under the Apache License, Version 2.0 (the "License"); +// you may not use this file except in compliance with the License. +// You may obtain a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, +// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +// See the License for the specific language governing permissions and +// limitations under the License. + +package server + +import ( + "maps" + "slices" + "strings" +) + +const ( + FeatureFlagJsAckFormatV2 = "js_ack_fc_v2" + FeatureFlagJsRaftDeleteRange = "js_raft_delete_range" +) + +var featureFlags = map[string]bool{ + // Use v2 format for `$JS.ACK.>` and `$JS.FC.>`. + // - Introduced: 2.14.0, both v1 and v2 supported, only using v1. + // - Enabled: TBD, both supported, v2 becomes the default. + // + // - v1: $JS.ACK....... + // - v2: $JS.ACK......... + // See also: https://github.com/nats-io/nats-architecture-and-design/blob/main/adr/ADR-15.md#jsack + FeatureFlagJsAckFormatV2: false, + + // Propose delete range gaps as a single `deleteRangeOp` Raft append entry + // instead of one entry per deleted sequence. Dramatically reduces Raft cost + // on mirrors whose origin has a large number of interior deletes. + // - Introduced: 2.14.0, apply-side always supports receiving `deleteRangeOp`. + // - Enabled: TBD, once all supported versions carry the apply-side. + // + // WARNING: Only enable once every peer in the cluster is on a version that + // supports receiving `deleteRangeOp`. Older peers panic on apply of an + // unknown stream entry operation. + FeatureFlagJsRaftDeleteRange: false, +} + +// getFeatureFlag is used to retrieve either the default or overwritten value for a feature flag. +// The user's value takes precedence over the system's default. However, if the flag doesn't exist, it's disabled. +// The *Options returned by Server.getOpts() is treated as immutable, mutations go through setOpts, +// so no lock is required on the map read here. +func (o *Options) getFeatureFlag(k string) bool { + defaultValue, ok := featureFlags[k] + if !ok { + return false // Not supported. + } + if userValue, ok := o.FeatureFlags[k]; ok { + return userValue + } + return defaultValue +} + +// getMergedFeatureFlags returns a merged map of feature flags, with the user's values taking precedence. +func (o *Options) getMergedFeatureFlags() map[string]bool { + merged := make(map[string]bool) + for k, v := range featureFlags { + merged[k] = v + } + for k, v := range o.FeatureFlags { + if _, ok := featureFlags[k]; !ok { + continue + } + merged[k] = v + } + return merged +} + +// printFeatureFlags logs the currently used feature flags on server startup. +func (s *Server) printFeatureFlags(o *Options) { + if len(o.FeatureFlags) == 0 { + return + } + keys := slices.Sorted(maps.Keys(o.FeatureFlags)) + + var ( + configured strings.Builder + unsupported strings.Builder + ) + + for _, k := range keys { + // Unsupported + defaultValue, ok := featureFlags[k] + if !ok { + if unsupported.Len() > 0 { + unsupported.WriteString(", ") + } + unsupported.WriteString(k) + continue + } + + v := o.FeatureFlags[k] + if configured.Len() > 0 { + configured.WriteString(", ") + } + configured.WriteString(k) + configured.WriteString(" (") + if defaultValue { + if v { + configured.WriteString("enabled") + } else { + configured.WriteString("opt-out") + } + } else if v { + configured.WriteString("opt-in") + } else { + configured.WriteString("disabled") + } + configured.WriteString(")") + } + if configured.Len() == 0 { + configured.WriteString("none") + } + + s.Noticef(" Feature flags:") + s.Noticef(" Configured: %s", configured.String()) + if unsupported.Len() > 0 { + s.Noticef(" Unsupported: %s", unsupported.String()) + } +} diff --git a/vendor/github.com/nats-io/nats-server/v2/server/filestore.go b/vendor/github.com/nats-io/nats-server/v2/server/filestore.go index f68e5d761..c6108ad68 100644 --- a/vendor/github.com/nats-io/nats-server/v2/server/filestore.go +++ b/vendor/github.com/nats-io/nats-server/v2/server/filestore.go @@ -33,6 +33,7 @@ import ( "os" "path/filepath" "runtime" + "runtime/debug" "slices" "sort" "strings" @@ -40,6 +41,7 @@ import ( "sync/atomic" "time" + "github.com/antithesishq/antithesis-sdk-go/assert" "github.com/klauspost/compress/s2" "github.com/minio/highwayhash" "github.com/nats-io/nats-server/v2/server/ats" @@ -192,12 +194,15 @@ type fileStore struct { bim map[uint32]*msgBlock psim *stree.SubjectTree[psi] tsl int - adml int + wfsmu sync.Mutex // Only one writeFullState at a time to protect from overwrites. + wfsrun atomic.Int64 // Is writeFullState already running? For timer check only + wfsadml int // writeFullState average dmap length, protected by wfsmu. hh *highwayhash.Digest64 qch chan struct{} fsld chan struct{} cmu sync.RWMutex cfs []ConsumerStore + werr error sips int dirty int closing bool @@ -295,6 +300,8 @@ const ( msgDir = "msgs" // This is where we temporarily move the messages dir. purgeDir = "__msgs__" + // This is where we temporarily move the new message block during purge. + newMsgDir = "__new_msgs__" // used to scan blk file names. blkScan = "%d.blk" // suffix of a block file @@ -313,9 +320,6 @@ const ( consumerState = "o.dat" // The suffix that will be given to a new temporary block for compression or when rewriting the full file. blkTmpSuffix = ".tmp" - // This is where we keep state on templates. - // Deprecated: stream templates are deprecated and will be removed in a future version. - tmplsDir = "templates" // default cache buffer expiration defaultCacheBufferExpiration = 10 * time.Second // default sync interval @@ -566,7 +570,10 @@ func newFileStoreWithCreated(fcfg FileStoreConfig, cfg StreamConfig, created tim // Check if we have any left over tombstones to process. if len(fs.tombs) > 0 { for _, seq := range fs.tombs { - fs.removeMsg(seq, false, true, false) + _, err = fs.removeMsg(seq, false, true, false) + if err != nil && err != ErrStoreEOF && err != ErrStoreMsgNotFound { + return nil, err + } fs.removeFromLostData(seq) } // Not needed after this phase. @@ -574,13 +581,16 @@ func newFileStoreWithCreated(fcfg FileStoreConfig, cfg StreamConfig, created tim } // Limits checks and enforcement. - fs.enforceMsgLimit() - fs.enforceBytesLimit() + if err = fs.enforceMsgLimit(); err != nil { + return nil, err + } + if err = fs.enforceBytesLimit(); err != nil { + return nil, err + } // Do age checks too, make sure to call in place. if fs.cfg.MaxAge != 0 { - err := fs.expireMsgsOnRecover() - if isPermissionError(err) { + if err = fs.expireMsgsOnRecover(); err != nil { return nil, err } fs.startAgeChk() @@ -588,7 +598,9 @@ func newFileStoreWithCreated(fcfg FileStoreConfig, cfg StreamConfig, created tim // If we have max msgs per subject make sure the is also enforced. if fs.cfg.MaxMsgsPer > 0 { - fs.enforceMsgPerSubjectLimit(false) + if err = fs.enforceMsgPerSubjectLimit(false); err != nil { + return nil, err + } } // Grab first sequence for check below while we have lock. @@ -690,20 +702,32 @@ func (fs *fileStore) UpdateConfig(cfg *StreamConfig) error { // Create or delete the THW if needed. if cfg.AllowMsgTTL && fs.ttls == nil { - fs.recoverTTLState() + if err := fs.recoverTTLState(); err != nil { + fs.mu.Unlock() + return err + } } else if !cfg.AllowMsgTTL && fs.ttls != nil { fs.ttls = nil } // Create or delete the message scheduling state if needed. if cfg.AllowMsgSchedules && fs.scheduling == nil { - fs.recoverMsgSchedulingState() + if err := fs.recoverMsgSchedulingState(); err != nil { + fs.mu.Unlock() + return err + } } else if !cfg.AllowMsgSchedules && fs.scheduling != nil { fs.scheduling = nil } // Limits checks and enforcement. - fs.enforceMsgLimit() - fs.enforceBytesLimit() + if err := fs.enforceMsgLimit(); err != nil { + fs.mu.Unlock() + return err + } + if err := fs.enforceBytesLimit(); err != nil { + fs.mu.Unlock() + return err + } // Do age timers. if fs.ageChk == nil && fs.cfg.MaxAge != 0 { @@ -716,7 +740,10 @@ func (fs *fileStore) UpdateConfig(cfg *StreamConfig) error { } if fs.cfg.MaxMsgsPer > 0 && (old_cfg.MaxMsgsPer == 0 || fs.cfg.MaxMsgsPer < old_cfg.MaxMsgsPer) { - fs.enforceMsgPerSubjectLimit(true) + if err := fs.enforceMsgPerSubjectLimit(true); err != nil { + fs.mu.Unlock() + return err + } } if lmb := fs.lmb; lmb != nil { @@ -742,8 +769,12 @@ func (fs *fileStore) UpdateConfig(cfg *StreamConfig) error { close(lmb.qch) lmb.qch = nil } - lmb.flushPendingMsgsLocked() + _, err := lmb.flushPendingMsgsLocked() lmb.mu.Unlock() + if err != nil { + fs.mu.Unlock() + return err + } } // Set flush in place to AsyncFlush which by default is false. fs.fip = !fs.fcfg.AsyncFlush @@ -1161,7 +1192,9 @@ func (fs *fileStore) recoverMsgBlock(index uint32) (*msgBlock, error) { } // Make sure encryption loaded if needed. - fs.loadEncryptionForMsgBlock(mb) + if err = fs.loadEncryptionForMsgBlock(mb); err != nil { + return nil, err + } // Grab last checksum from main block file. var lchk [8]byte @@ -1175,12 +1208,14 @@ func (fs *fileStore) recoverMsgBlock(index uint32) (*msgBlock, error) { } // We can recycle it now. recycleMsgBlockBuf(buf) - } else { - file.ReadAt(lchk[:], int64(mb.rbytes)-checksumSize) + } else if _, err = file.ReadAt(lchk[:], int64(mb.rbytes)-checksumSize); err != nil { + return nil, err } } - file.Close() + if err = file.Close(); err != nil { + return nil, err + } // Read our index file. Use this as source of truth if possible. // This not applicable in >= 2.10 servers. Here for upgrade paths from < 2.10. @@ -1189,7 +1224,9 @@ func (fs *fileStore) recoverMsgBlock(index uint32) (*msgBlock, error) { // Note this only checks that the message blk file is not newer then this file, or is empty and we expect empty. if (mb.rbytes == 0 && mb.msgs == 0) || bytes.Equal(lchk[:], mb.lchk[:]) { if mb.msgs > 0 && !mb.noTrack && fs.psim != nil { - fs.populateGlobalPerSubjectInfo(mb) + if err = fs.populateGlobalPerSubjectInfo(mb); err != nil { + return nil, err + } // Try to dump any state we needed on recovery. mb.tryForceExpireCacheLocked() } @@ -1199,8 +1236,10 @@ func (fs *fileStore) recoverMsgBlock(index uint32) (*msgBlock, error) { } // If we get data loss rebuilding the message block state record that with the fs itself. - ld, tombs, _ := mb.rebuildState() - if ld != nil { + ld, tombs, err := mb.rebuildState() + if err != nil { + return nil, err + } else if ld != nil { fs.addLostData(ld) } // Collect all tombstones. @@ -1209,12 +1248,16 @@ func (fs *fileStore) recoverMsgBlock(index uint32) (*msgBlock, error) { } if mb.msgs > 0 && !mb.noTrack && fs.psim != nil { - fs.populateGlobalPerSubjectInfo(mb) + if err = fs.populateGlobalPerSubjectInfo(mb); err != nil { + return nil, err + } // Try to dump any state we needed on recovery. mb.tryForceExpireCacheLocked() } - mb.closeFDs() + if err = mb.closeFDs(); err != nil { + return nil, err + } fs.addMsgBlock(mb) return mb, nil @@ -1458,6 +1501,10 @@ func (mb *msgBlock) rebuildStateLocked() (*LostStreamData, []uint64, error) { defer recycleMsgBlockBuf(buf) if err != nil || len(buf) == 0 { + // Only allow continuing to mark lost data if the file itself doesn't exist, or was empty. + if err != nil && err != errNoBlkData { + return nil, nil, err + } var ld *LostStreamData // No data to rebuild from here. if mb.msgs > 0 { @@ -1474,7 +1521,7 @@ func (mb *msgBlock) rebuildStateLocked() (*LostStreamData, []uint64, error) { mb.dmap.Empty() atomic.StoreUint64(&mb.first.seq, atomic.LoadUint64(&mb.last.seq)+1) } - return ld, nil, err + return ld, nil, nil } // Check if we need to decrypt. @@ -1508,15 +1555,37 @@ func (mb *msgBlock) rebuildStateFromBufLocked(buf []byte, allowTruncate bool) (* mb.dmap.Insert(seq) } + // For tombstones that we find and collect. + var ( + tombstones []uint64 + maxTombstoneSeq uint64 + maxTombstoneTs int64 + ) + + defer func() { + // For empty msg blocks make sure we recover last seq correctly based off of first. + // Or if we seem to have no messages but had a tombstone, which we use to remember + // sequences and timestamps now, use that to properly setup the first and last. + if mb.msgs == 0 { + fseq := atomic.LoadUint64(&mb.first.seq) + if fseq > 0 { + atomic.StoreUint64(&mb.last.seq, fseq-1) + } else if fseq == 0 && maxTombstoneSeq > 0 { + atomic.StoreUint64(&mb.first.seq, maxTombstoneSeq+1) + mb.first.ts = 0 + if mb.last.seq == 0 { + atomic.StoreUint64(&mb.last.seq, maxTombstoneSeq) + mb.last.ts = maxTombstoneTs + } + } + } + }() + var le = binary.LittleEndian - truncate := func(index uint32) { - // There are cases where we're not allowed to truncate, like for an encrypted or compressed - // block since the index will be the decrypted and decompressed index. - if !allowTruncate { - return - } - + // There are cases where we're not allowed to truncate, like for an encrypted or compressed + // block since the index will be the decrypted and decompressed index. + truncate := func(index uint32) error { var fd *os.File if mb.mfd != nil { fd = mb.mfd @@ -1529,17 +1598,24 @@ func (mb *msgBlock) rebuildStateFromBufLocked(buf []byte, allowTruncate bool) (* } } if fd == nil { - return + return nil } - if err := fd.Truncate(int64(index)); err == nil { - // Update our checksum. - if index >= 8 { - var lchk [8]byte - fd.ReadAt(lchk[:], int64(index-8)) - copy(mb.lchk[0:], lchk[:]) + if err := fd.Truncate(int64(index)); err != nil { + return err + } + + // Update our checksum. + if index >= 8 { + var lchk [8]byte + if _, err = fd.ReadAt(lchk[:], int64(index-8)); err != nil { + return err } - fd.Sync() + copy(mb.lchk[0:], lchk[:]) } + if err = fd.Sync(); err != nil { + return err + } + return nil } gatherLost := func(lb uint32) *LostStreamData { @@ -1551,13 +1627,6 @@ func (mb *msgBlock) rebuildStateFromBufLocked(buf []byte, allowTruncate bool) (* return &ld } - // For tombstones that we find and collect. - var ( - tombstones []uint64 - maxTombstoneSeq uint64 - maxTombstoneTs int64 - ) - // To detect gaps from compaction, and to ensure the sequence keeps moving up. var last uint64 var hb [highwayhash.Size64]byte @@ -1581,8 +1650,13 @@ func (mb *msgBlock) rebuildStateFromBufLocked(buf []byte, allowTruncate bool) (* for index, lbuf := uint32(0), uint32(len(buf)); index < lbuf; { if index+msgHdrSize > lbuf { - truncate(index) - return gatherLost(lbuf - index), tombstones, nil + err = errBadMsg{mb.mfn, fmt.Sprintf("message overrun (index %d lbuf %d)", index, lbuf)} + if allowTruncate { + if err = truncate(index); err != nil { + return nil, nil, err + } + } + return gatherLost(lbuf - index), tombstones, err } hdr := buf[index : index+msgHdrSize] @@ -1598,8 +1672,13 @@ func (mb *msgBlock) rebuildStateFromBufLocked(buf []byte, allowTruncate bool) (* dlen := int(rl) - msgHdrSize // Do some quick sanity checks here. if dlen < 0 || shlen > (dlen-recordHashSize) || dlen > int(rl) || index+rl > lbuf || rl > rlBadThresh { - truncate(index) - return gatherLost(lbuf - index), tombstones, errBadMsg{mb.mfn, fmt.Sprintf("sanity check failed (dlen %d slen %d rl %d index %d lbuf %d)", dlen, slen, rl, index, lbuf)} + err = errBadMsg{mb.mfn, fmt.Sprintf("sanity check failed (dlen %d slen %d rl %d index %d lbuf %d)", dlen, slen, rl, index, lbuf)} + if allowTruncate { + if err = truncate(index); err != nil { + return nil, nil, err + } + } + return gatherLost(lbuf - index), tombstones, err } // Check for checksum failures before additional processing. @@ -1616,8 +1695,13 @@ func (mb *msgBlock) rebuildStateFromBufLocked(buf []byte, allowTruncate bool) (* } checksum := hh.Sum(hb[:0]) if !bytes.Equal(checksum, data[len(data)-recordHashSize:]) { - truncate(index) - return gatherLost(lbuf - index), tombstones, errBadMsg{mb.mfn, "invalid checksum"} + err = errBadMsg{mb.mfn, "invalid checksum"} + if allowTruncate { + if err = truncate(index); err != nil { + return nil, nil, err + } + } + return gatherLost(lbuf - index), tombstones, err } copy(mb.lchk[0:], checksum) } @@ -1712,6 +1796,26 @@ func (fs *fileStore) warn(format string, args ...any) { fs.srv.Warnf(fmt.Sprintf("Filestore [%s] %s", fs.cfg.Name, format), args...) } +// For doing rate-limited warn logging. +// Lock should be held. +func (fs *fileStore) rateLimitWarn(format string, args ...any) { + // No-op if no server configured. + if fs.srv == nil { + return + } + fs.srv.RateLimitWarnf(fmt.Sprintf("Filestore [%s] %s", fs.cfg.Name, format), args...) +} + +// For doing error logging. +// Lock should be held. +func (fs *fileStore) error(format string, args ...any) { + // No-op if no server configured. + if fs.srv == nil { + return + } + fs.srv.Errorf(fmt.Sprintf("Filestore [%s] %s", fs.cfg.Name, format), args...) +} + // For doing debug logging. // Lock should be held. func (fs *fileStore) debug(format string, args ...any) { @@ -1756,9 +1860,9 @@ func (fs *fileStore) recoverFullState() (rerr error) { // Check for any left over purged messages. <-dios - pdir := filepath.Join(fs.fcfg.StoreDir, purgeDir) - if _, err := os.Stat(pdir); err == nil { - os.RemoveAll(pdir) + if err := fs.recoverPartialPurge(); err != nil { + dios <- struct{}{} + return err } // Grab our stream state file and load it in. fn := filepath.Join(fs.fcfg.StoreDir, msgDir, streamStreamStateFile) @@ -1774,7 +1878,7 @@ func (fs *fileStore) recoverFullState() (rerr error) { const minLen = 32 if len(buf) < minLen { - os.Remove(fn) + _ = os.Remove(fn) fs.warn("Stream state too short (%d bytes)", len(buf)) return errCorruptState } @@ -1786,7 +1890,7 @@ func (fs *fileStore) recoverFullState() (rerr error) { fs.hh.Write(buf) var hb [highwayhash.Size64]byte if !bytes.Equal(h, fs.hh.Sum(hb[:0])) { - os.Remove(fn) + _ = os.Remove(fn) fs.warn("Stream state checksum did not match") return errCorruptState } @@ -1805,7 +1909,7 @@ func (fs *fileStore) recoverFullState() (rerr error) { version := buf[1] if buf[0] != fullStateMagic || version < fullStateMinVersion || version > fullStateVersion { - os.Remove(fn) + _ = os.Remove(fn) fs.warn("Stream state magic and version mismatch") return errCorruptState } @@ -1860,7 +1964,7 @@ func (fs *fileStore) recoverFullState() (rerr error) { for i := 0; i < numSubjects; i++ { if lsubj := int(readU64()); lsubj > 0 { if bi+lsubj > len(buf) { - os.Remove(fn) + _ = os.Remove(fn) fs.warn("Stream state bad subject len (%d)", lsubj) return errCorruptState } @@ -1871,13 +1975,13 @@ func (fs *fileStore) recoverFullState() (rerr error) { // We had a bug that could cause memory corruption in the PSIM that could have gotten stored to disk. // Only would affect subjects, so do quick check. if !isValidSubject(bytesToString(subj), true) { - os.Remove(fn) + _ = os.Remove(fn) fs.warn("Stream state corrupt subject detected") return errCorruptState } bi += lsubj psi := psi{total: readU64(), fblk: uint32(readU64())} - if psi.total > 1 { + if psi.total > 1 || version >= 4 { psi.lblk = uint32(readU64()) } else { psi.lblk = psi.fblk @@ -1905,7 +2009,7 @@ func (fs *fileStore) recoverFullState() (rerr error) { schedules = readU64() } if bi < 0 { - os.Remove(fn) + _ = os.Remove(fn) return errCorruptState } mb := fs.initMsgBlock(index) @@ -1918,7 +2022,7 @@ func (fs *fileStore) recoverFullState() (rerr error) { if numDeleted > 0 { dmap, n, err := avl.Decode(buf[bi:]) if err != nil { - os.Remove(fn) + _ = os.Remove(fn) fs.warn("Stream state error decoding avl dmap: %v", err) return errCorruptState } @@ -1957,7 +2061,7 @@ func (fs *fileStore) recoverFullState() (rerr error) { // Check if we had any errors. if bi < 0 { - os.Remove(fn) + _ = os.Remove(fn) fs.warn("Stream state has no checksum present") return errCorruptState } @@ -1970,7 +2074,7 @@ func (fs *fileStore) recoverFullState() (rerr error) { var matched bool mb := fs.lmb if mb == nil || mb.index != blkIndex { - os.Remove(fn) + _ = os.Remove(fn) fs.warn("Stream state block does not exist or index mismatch") return errCorruptState } @@ -2032,7 +2136,7 @@ func (fs *fileStore) recoverFullState() (rerr error) { // We check first and last seq and number of msgs and bytes. If there is a difference, // return and error so we rebuild from the message block state on disk. if !trackingStatesEqual(&fs.state, &mstate) { - os.Remove(fn) + _ = os.Remove(fn) fs.warn("Stream state encountered internal inconsistency on recover") return errCorruptState } @@ -2059,7 +2163,7 @@ func (fs *fileStore) recoverTTLState() error { ttlseq, err = fs.ttls.Decode(buf) if err != nil { fs.warn("Error decoding TTL state: %s", err) - os.Remove(fn) + _ = os.Remove(fn) } } @@ -2140,7 +2244,7 @@ func (fs *fileStore) recoverMsgSchedulingState() error { schedSeq, err = fs.scheduling.decode(buf) if err != nil { fs.warn("Error decoding message scheduling state: %s", err) - os.Remove(fn) + _ = os.Remove(fn) } } @@ -2193,8 +2297,9 @@ func (fs *fileStore) recoverMsgSchedulingState() error { if len(msg.hdr) == 0 { continue } - if schedule, ok := getMessageSchedule(sm.hdr); ok && !schedule.IsZero() { - fs.scheduling.init(seq, sm.subj, schedule.UnixNano()) + if schedule, apiErr := nextMessageSchedule(sm.hdr, sm.ts); apiErr == nil && !schedule.IsZero() { + // Copy the subject, as it's stored in the scheduling maps and the backing cache could be reused in the meantime. + fs.scheduling.init(seq, copyString(sm.subj), schedule.UnixNano()) } } } @@ -2218,7 +2323,7 @@ func (mb *msgBlock) lastChecksum() []byte { return lchk[:] } // Encrypted? - if err := mb.checkAndLoadEncryption(); err != nil { + if err = mb.checkAndLoadEncryption(); err != nil { return nil } if mb.bek != nil { @@ -2227,9 +2332,11 @@ func (mb *msgBlock) lastChecksum() []byte { return nil } copy(lchk[0:], buf[len(buf)-checksumSize:]) + } else { + return nil } - } else { - f.ReadAt(lchk[:], int64(mb.rbytes)-checksumSize) + } else if _, err = f.ReadAt(lchk[:], int64(mb.rbytes)-checksumSize); err != nil { + return nil } return lchk[:] } @@ -2268,9 +2375,9 @@ func (fs *fileStore) recoverMsgs() error { // Check for any left over purged messages. <-dios - pdir := filepath.Join(fs.fcfg.StoreDir, purgeDir) - if _, err := os.Stat(pdir); err == nil { - os.RemoveAll(pdir) + if err := fs.recoverPartialPurge(); err != nil { + dios <- struct{}{} + return err } mdir := filepath.Join(fs.fcfg.StoreDir, msgDir) f, err := os.Open(mdir) @@ -2307,7 +2414,10 @@ func (fs *fileStore) recoverMsgs() error { // out from underneath of us this is possible. mb.mu.Lock() if atomic.LoadUint64(&mb.first.seq) == 0 { - mb.dirtyCloseWithRemove(true) + if err := mb.dirtyCloseWithRemove(true); err != nil { + mb.mu.Unlock() + return err + } fs.removeMsgBlockFromList(mb) mb.mu.Unlock() continue @@ -2354,8 +2464,8 @@ func (fs *fileStore) recoverMsgs() error { if len(fs.blks) > 0 { fs.lmb = fs.blks[len(fs.blks)-1] - } else { - _, err = fs.newMsgBlockForWrite() + } else if _, err = fs.newMsgBlockForWrite(); err != nil { + return err } // Check if we encountered any lost data. @@ -2369,15 +2479,14 @@ func (fs *fileStore) recoverMsgs() error { for _, mb := range emptyBlks { // Need the mb lock here. mb.mu.Lock() - fs.removeMsgBlock(mb) + err = fs.forceRemoveMsgBlock(mb) mb.mu.Unlock() + if err != nil { + return err + } } } - if err != nil { - return err - } - // Check for keyfiles orphans. if kms, err := filepath.Glob(filepath.Join(mdir, keyScanAll)); err == nil && len(kms) > 0 { valid := make(map[uint32]bool) @@ -2431,7 +2540,9 @@ func (fs *fileStore) expireMsgsOnRecover() error { last.ts = mb.last.ts } // Make sure we do subject cleanup as well. - mb.ensurePerSubjectInfoLoaded() + if err := mb.ensurePerSubjectInfoLoaded(); err != nil { + return err + } mb.fss.IterOrdered(func(bsubj []byte, ss *SimpleState) bool { subj := bytesToString(bsubj) for i := uint64(0); i < ss.Msgs; i++ { @@ -2439,8 +2550,7 @@ func (fs *fileStore) expireMsgsOnRecover() error { } return true }) - err := mb.dirtyCloseWithRemove(true) - if isPermissionError(err) { + if err := mb.dirtyCloseWithRemove(true); err != nil { return err } deleted++ @@ -2460,7 +2570,7 @@ func (fs *fileStore) expireMsgsOnRecover() error { bytes += mb.bytes err := deleteEmptyBlock(mb) mb.mu.Unlock() - if isPermissionError(err) { + if err != nil { return err } continue @@ -2470,7 +2580,7 @@ func (fs *fileStore) expireMsgsOnRecover() error { // This will load fss as well. if err := mb.loadMsgsWithLock(); err != nil { mb.mu.Unlock() - break + return err } var smv StoreMsg @@ -2524,7 +2634,11 @@ func (fs *fileStore) expireMsgsOnRecover() error { } // Update fss // Make sure we have fss loaded. - mb.removeSeqPerSubject(sm.subj, seq) + if _, err = mb.removeSeqPerSubject(sm.subj, seq); err != nil { + mb.finishedWithCache() + mb.mu.Unlock() + return err + } fs.removePerSubject(sm.subj) } // Make sure we have a proper next first sequence. @@ -2532,11 +2646,15 @@ func (fs *fileStore) expireMsgsOnRecover() error { mb.selectNextFirst() } // Check if empty after processing, could happen if tail of messages are all deleted. + var err error if mb.msgs == 0 { - deleteEmptyBlock(mb) + err = deleteEmptyBlock(mb) } mb.finishedWithCache() mb.mu.Unlock() + if err != nil { + return err + } break } @@ -2572,13 +2690,20 @@ func (fs *fileStore) expireMsgsOnRecover() error { fs.state.Bytes = 0 } // Make sure to we properly set the fs first sequence and timestamp. - fs.selectNextFirst() + if err := fs.selectNextFirst(); err != nil { + return err + } // Check if we have no messages and blocks left. if fs.lmb == nil && last.seq != 0 { - if lmb, _ := fs.newMsgBlockForWrite(); lmb != nil { - fs.writeTombstone(last.seq, last.ts) + if lmb, err := fs.newMsgBlockForWrite(); err != nil || lmb == nil { + if err == nil { + err = errors.New("lmb missing") + } + return err + } else if err = fs.writeTombstone(last.seq, last.ts); err != nil { + return err } // Clear any global subject state. fs.psim, fs.tsl = fs.psim.Empty(), 0 @@ -2710,7 +2835,9 @@ func (mb *msgBlock) firstMatchingMulti(sl *gsl.SimpleSublist, start uint64, sm * } if ss.firstNeedsUpdate || ss.lastNeedsUpdate { // mb is already loaded into the cache so should be fast-ish. - mb.recalculateForSubj(bytesToString(subj), ss) + if ierr = mb.recalculateForSubj(bytesToString(subj), ss); ierr != nil { + return + } } first := max(start, ss.First) if first > ss.Last || first >= hseq { @@ -2883,17 +3010,28 @@ func (mb *msgBlock) firstMatching(filter string, wc bool, start uint64, sm *Stor // If we have a wildcard match against all tracked subjects we know about. fseq = lseq + 1 if bfilter := stringToBytes(filter); wc { + var ierr error mb.fss.Match(bfilter, func(bsubj []byte, ss *SimpleState) { + if ierr != nil { + return + } if ss.firstNeedsUpdate || ss.lastNeedsUpdate { - mb.recalculateForSubj(bytesToString(bsubj), ss) + if ierr = mb.recalculateForSubj(bytesToString(bsubj), ss); ierr != nil { + return + } } if start <= ss.Last { fseq = min(fseq, max(start, ss.First)) } }) + if ierr != nil { + return nil, false, ierr + } } else if ss, _ := mb.fss.Find(bfilter); ss != nil { if ss.firstNeedsUpdate || ss.lastNeedsUpdate { - mb.recalculateForSubj(filter, ss) + if err := mb.recalculateForSubj(filter, ss); err != nil { + return nil, false, err + } } if start <= ss.Last { fseq = min(fseq, max(start, ss.First)) @@ -2987,10 +3125,16 @@ func (mb *msgBlock) prevMatchingMulti(sl *gsl.SimpleSublist, start uint64, sm *S if uint64(mb.fss.Size()) < start-lseq { // If there are no subject matches then this is effectively no-op. hseq := uint64(0) + var ierr error stree.IntersectGSL(mb.fss, sl, func(subj []byte, ss *SimpleState) { + if ierr != nil { + return + } if ss.firstNeedsUpdate || ss.lastNeedsUpdate { // mb is already loaded into the cache so should be fast-ish. - mb.recalculateForSubj(bytesToString(subj), ss) + if ierr = mb.recalculateForSubj(bytesToString(subj), ss); ierr != nil { + return + } } first := min(start, ss.Last) // Skip if cutoff is before this subject's first, or if we already @@ -3034,6 +3178,9 @@ func (mb *msgBlock) prevMatchingMulti(sl *gsl.SimpleSublist, start uint64, sm *S mb.llseq = llseq } }) + if ierr != nil { + return nil, false, ierr + } if hseq > 0 && sm != nil { return sm, didLoad && start == lseq, nil } @@ -3064,7 +3211,7 @@ func (mb *msgBlock) prevMatchingMulti(sl *gsl.SimpleSublist, start uint64, sm *S } // This will traverse a message block and generate the filtered pending. -func (mb *msgBlock) filteredPending(subj string, wc bool, seq uint64) (total, first, last uint64) { +func (mb *msgBlock) filteredPending(subj string, wc bool, seq uint64) (total, first, last uint64, err error) { mb.mu.Lock() defer mb.mu.Unlock() return mb.filteredPendingLocked(subj, wc, seq) @@ -3072,14 +3219,14 @@ func (mb *msgBlock) filteredPending(subj string, wc bool, seq uint64) (total, fi // This will traverse a message block and generate the filtered pending. // Lock should be held. -func (mb *msgBlock) filteredPendingLocked(filter string, wc bool, sseq uint64) (total, first, last uint64) { +func (mb *msgBlock) filteredPendingLocked(filter string, wc bool, sseq uint64) (total, first, last uint64, err error) { isAll := filter == _EMPTY_ || filter == fwcs // First check if we can optimize this part. // This means we want all and the starting sequence was before this block. if isAll { if fseq := atomic.LoadUint64(&mb.first.seq); sseq <= fseq { - return mb.msgs, fseq, atomic.LoadUint64(&mb.last.seq) + return mb.msgs, fseq, atomic.LoadUint64(&mb.last.seq), nil } } @@ -3098,7 +3245,9 @@ func (mb *msgBlock) filteredPendingLocked(filter string, wc bool, sseq uint64) ( } // Make sure we have fss loaded. - mb.ensurePerSubjectInfoLoaded() + if err = mb.ensurePerSubjectInfoLoaded(); err != nil { + return 0, 0, 0, err + } var havePartial bool @@ -3106,7 +3255,9 @@ func (mb *msgBlock) filteredPendingLocked(filter string, wc bool, sseq uint64) ( if !wc { if ss, ok := mb.fss.Find(stringToBytes(filter)); ok && ss != nil { if ss.firstNeedsUpdate || ss.lastNeedsUpdate { - mb.recalculateForSubj(filter, ss) + if err = mb.recalculateForSubj(filter, ss); err != nil { + return 0, 0, 0, err + } } if sseq <= ss.First { update(ss) @@ -3117,12 +3268,17 @@ func (mb *msgBlock) filteredPendingLocked(filter string, wc bool, sseq uint64) ( } } else { mb.fss.Match(stringToBytes(filter), func(bsubj []byte, ss *SimpleState) { + if err != nil { + return + } if havePartial { // If we already found a partial then don't do anything else. return } if ss.firstNeedsUpdate || ss.lastNeedsUpdate { - mb.recalculateForSubj(bytesToString(bsubj), ss) + if err = mb.recalculateForSubj(bytesToString(bsubj), ss); err != nil { + return + } } if sseq <= ss.First { update(ss) @@ -3131,11 +3287,14 @@ func (mb *msgBlock) filteredPendingLocked(filter string, wc bool, sseq uint64) ( havePartial = true } }) + if err != nil { + return 0, 0, 0, err + } } // If we did not encounter any partials we can return here. if !havePartial { - return total, first, last + return total, first, last, nil } // If we are here we need to scan the msgs. @@ -3145,7 +3304,9 @@ func (mb *msgBlock) filteredPendingLocked(filter string, wc bool, sseq uint64) ( // If we load the cache for a linear scan we want to expire that cache upon exit. var shouldExpire bool if mb.cacheNotLoaded() { - mb.loadMsgsWithLock() + if err = mb.loadMsgsWithLock(); err != nil { + return 0, 0, 0, err + } shouldExpire = true } defer mb.finishedWithCache() @@ -3189,11 +3350,11 @@ func (mb *msgBlock) filteredPendingLocked(filter string, wc bool, sseq uint64) ( mb.tryForceExpireCacheLocked() } - return total, first, last + return total, first, last, nil } // FilteredState will return the SimpleState associated with the filtered subject and a proposed starting sequence. -func (fs *fileStore) FilteredState(sseq uint64, subj string) SimpleState { +func (fs *fileStore) FilteredState(sseq uint64, subj string) (SimpleState, error) { fs.mu.RLock() defer fs.mu.RUnlock() @@ -3210,14 +3371,16 @@ func (fs *fileStore) FilteredState(sseq uint64, subj string) SimpleState { // Make sure we track sequences ss.First = fs.state.FirstSeq ss.Last = fs.state.LastSeq - return ss + return ss, nil } // If we want all msgs that match we can shortcircuit. // TODO(dlc) - This can be extended for all cases but would // need to be careful on total msgs calculations etc. if sseq == fs.state.FirstSeq { - fs.numFilteredPending(subj, &ss) + if err := fs.numFilteredPending(subj, &ss); err != nil { + return ss, err + } } else { wc := subjectHasWildcard(subj) // Tracking subject state. @@ -3227,7 +3390,10 @@ func (fs *fileStore) FilteredState(sseq uint64, subj string) SimpleState { if sseq > atomic.LoadUint64(&mb.last.seq) { continue } - t, f, l := mb.filteredPending(subj, wc, sseq) + t, f, l, err := mb.filteredPending(subj, wc, sseq) + if err != nil { + return ss, err + } ss.Msgs += t if ss.First == 0 || (f > 0 && f < ss.First) { ss.First = f @@ -3238,7 +3404,7 @@ func (fs *fileStore) FilteredState(sseq uint64, subj string) SimpleState { } } - return ss + return ss, nil } // This is used to see if we can selectively jump start blocks based on filter subject and a starting block index. @@ -3310,20 +3476,20 @@ func (fs *fileStore) selectSkipFirstBlock(bi int, start, stop uint32) (int, erro // Optimized way for getting all num pending matching a filter subject. // Lock should be held. -func (fs *fileStore) numFilteredPending(filter string, ss *SimpleState) { - fs.numFilteredPendingWithLast(filter, true, ss) +func (fs *fileStore) numFilteredPending(filter string, ss *SimpleState) error { + return fs.numFilteredPendingWithLast(filter, true, ss) } // Optimized way for getting all num pending matching a filter subject and first sequence only. // Lock should be held. -func (fs *fileStore) numFilteredPendingNoLast(filter string, ss *SimpleState) { - fs.numFilteredPendingWithLast(filter, false, ss) +func (fs *fileStore) numFilteredPendingNoLast(filter string, ss *SimpleState) error { + return fs.numFilteredPendingWithLast(filter, false, ss) } // Optimized way for getting all num pending matching a filter subject. // Optionally look up last sequence. Sometimes do not need last and this avoids cost. // Read lock should be held. -func (fs *fileStore) numFilteredPendingWithLast(filter string, last bool, ss *SimpleState) { +func (fs *fileStore) numFilteredPendingWithLast(filter string, last bool, ss *SimpleState) error { isAll := filter == _EMPTY_ || filter == fwcs // If isAll we do not need to do anything special to calculate the first and last and total. @@ -3331,7 +3497,7 @@ func (fs *fileStore) numFilteredPendingWithLast(filter string, last bool, ss *Si ss.First = fs.state.FirstSeq ss.Last = fs.state.LastSeq ss.Msgs = fs.state.Msgs - return + return nil } // Always reset. ss.First, ss.Last, ss.Msgs = 0, 0, 0 @@ -3358,13 +3524,16 @@ func (fs *fileStore) numFilteredPendingWithLast(filter string, last bool, ss *Si // Did not find anything. if stop == 0 { - return + return nil } // Do start mb := fs.bim[start] if mb != nil { - _, f, _ := mb.filteredPending(filter, wc, 0) + _, f, _, err := mb.filteredPending(filter, wc, 0) + if err != nil { + return err + } ss.First = f } @@ -3379,7 +3548,9 @@ func (fs *fileStore) numFilteredPendingWithLast(filter string, last bool, ss *Si if mb == nil { continue } - if _, f, _ := mb.filteredPending(filter, wc, 0); f > 0 { + if _, f, _, err := mb.filteredPending(filter, wc, 0); err != nil { + return err + } else if f > 0 { ss.First = f break } @@ -3408,10 +3579,14 @@ func (fs *fileStore) numFilteredPendingWithLast(filter string, last bool, ss *Si // Now gather last sequence if asked to do so. if last { if mb = fs.bim[stop]; mb != nil { - _, _, l := mb.filteredPending(filter, wc, 0) + _, _, l, err := mb.filteredPending(filter, wc, 0) + if err != nil { + return err + } ss.Last = l } } + return nil } // SubjectsState returns a map of SimpleState for all matching subjects. @@ -3466,10 +3641,16 @@ func (fs *fileStore) SubjectsState(subject string) map[string]SimpleState { } // Mark fss activity. mb.lsts = ats.AccessTime() + var ierr error mb.fss.Match(stringToBytes(subject), func(bsubj []byte, ss *SimpleState) { + if ierr != nil { + return + } subj := string(bsubj) if ss.firstNeedsUpdate || ss.lastNeedsUpdate { - mb.recalculateForSubj(subj, ss) + if ierr = mb.recalculateForSubj(subj, ss); ierr != nil { + return + } } oss := fss[subj] if oss.First == 0 { // New @@ -3487,7 +3668,9 @@ func (fs *fileStore) SubjectsState(subject string) map[string]SimpleState { mb.finishedWithCache() } mb.mu.Unlock() - + if ierr != nil { + return nil + } if mb == stop { break } @@ -3532,13 +3715,16 @@ func (fs *fileStore) allLastSeqsLocked() ([]uint64, error) { shouldExpire = true } + var ierr error mb.fss.IterFast(func(bsubj []byte, ss *SimpleState) bool { // Check if already been processed and accounted. if _, ok := subs[string(bsubj)]; !ok { // Check if we need to recalculate. We only care about the last sequence. if ss.lastNeedsUpdate { // mb is already loaded into the cache so should be fast-ish. - mb.recalculateForSubj(bytesToString(bsubj), ss) + if ierr = mb.recalculateForSubj(bytesToString(bsubj), ss); ierr != nil { + return false + } } seqs = append(seqs, ss.Last) subs[string(bsubj)] = struct{}{} @@ -3551,6 +3737,9 @@ func (fs *fileStore) allLastSeqsLocked() ([]uint64, error) { } mb.finishedWithCache() mb.mu.Unlock() + if ierr != nil { + return nil, ierr + } } slices.Sort(seqs) @@ -3646,11 +3835,14 @@ func (fs *fileStore) MultiLastSeqs(filters []string, maxSeq uint64, maxAllowed i } // We can start properly looking here. mb.mu.Lock() - mb.ensurePerSubjectInfoLoaded() + var ierr error + if ierr = mb.ensurePerSubjectInfoLoaded(); ierr != nil { + mb.mu.Unlock() + return nil, ierr + } // Iterate the fss and check against our subs. We will delete from subs as we add. // Once len(subs) == 0 we are done. - var ierr error mb.fss.IterFast(func(bsubj []byte, ss *SimpleState) bool { // Already been processed and accounted for was not matched in the first place. if subs[string(bsubj)] == nil { @@ -3659,7 +3851,9 @@ func (fs *fileStore) MultiLastSeqs(filters []string, maxSeq uint64, maxAllowed i // Check if we need to recalculate. We only care about the last sequence. if ss.lastNeedsUpdate { // mb is already loaded into the cache so should be fast-ish. - mb.recalculateForSubj(bytesToString(bsubj), ss) + if ierr = mb.recalculateForSubj(bytesToString(bsubj), ss); ierr != nil { + return false + } } // If we are equal or below just add to seqs slice. if ss.Last <= maxSeq { @@ -3886,15 +4080,21 @@ func (fs *fileStore) NumPending(sseq uint64, filter string, lastPerSubject bool) mb.lsts = ats.AccessTime() var t uint64 + var ierr error var havePartial bool mb.fss.Match(stringToBytes(filter), func(bsubj []byte, ss *SimpleState) { + if ierr != nil { + return + } if havePartial { // If we already found a partial then don't do anything else. return } subj := bytesToString(bsubj) if ss.firstNeedsUpdate || ss.lastNeedsUpdate { - mb.recalculateForSubj(subj, ss) + if ierr = mb.recalculateForSubj(subj, ss); ierr != nil { + return + } } if sseq <= ss.First { t += ss.Msgs @@ -3903,6 +4103,10 @@ func (fs *fileStore) NumPending(sseq uint64, filter string, lastPerSubject bool) havePartial = true } }) + if ierr != nil { + mb.mu.Unlock() + return 0, 0, ierr + } // See if we need to scan msgs here. if havePartial { @@ -4215,16 +4419,22 @@ func (fs *fileStore) NumPendingMulti(sseq uint64, sl *gsl.SimpleSublist, lastPer mb.lsts = ats.AccessTime() var t uint64 + var ierr error var havePartial bool var updateLLTS bool stree.IntersectGSL[SimpleState](mb.fss, sl, func(bsubj []byte, ss *SimpleState) { + if ierr != nil { + return + } subj := bytesToString(bsubj) if havePartial { // If we already found a partial then don't do anything else. return } if ss.firstNeedsUpdate || ss.lastNeedsUpdate { - mb.recalculateForSubj(subj, ss) + if ierr = mb.recalculateForSubj(subj, ss); ierr != nil { + return + } } if sseq <= ss.First { t += ss.Msgs @@ -4233,6 +4443,10 @@ func (fs *fileStore) NumPendingMulti(sseq uint64, sl *gsl.SimpleSublist, lastPer havePartial = true } }) + if ierr != nil { + mb.mu.Unlock() + return 0, 0, ierr + } // See if we need to scan msgs here. if havePartial { @@ -4500,8 +4714,15 @@ func (fs *fileStore) newMsgBlockForWrite() (*msgBlock, error) { close(lmb.qch) lmb.qch = nil } + // If we had a write error before, don't allow continuing into a new block. + if err := lmb.werr; err != nil { + return nil, err + } // Flush any pending messages. - lmb.flushPendingMsgsLocked() + if _, err := lmb.flushPendingMsgsLocked(); err != nil { + lmb.mu.Unlock() + return nil, err + } // Determine if we can reclaim any resources here. lmb.closeFDsLockedNoCheck() if lmb.cache != nil { @@ -4516,7 +4737,8 @@ func (fs *fileStore) newMsgBlockForWrite() (*msgBlock, error) { go func() { lmb.mu.Lock() defer lmb.mu.Unlock() - lmb.recompressOnDiskIfNeeded() + // Might error, but we can't handle it here anyway. + _ = lmb.recompressOnDiskIfNeeded() }() } } @@ -4553,7 +4775,7 @@ func (fs *fileStore) newMsgBlockForWrite() (*msgBlock, error) { if isPermissionError(err) { return nil, err } - mb.dirtyCloseWithRemove(true) + _ = mb.dirtyCloseWithRemove(true) return nil, fmt.Errorf("Error creating msg block file: %v", err) } mb.mfd = mfd @@ -4601,7 +4823,7 @@ func (fs *fileStore) genEncryptionKeysForBlock(mb *msgBlock) error { // Stores a raw message with expected sequence number and timestamp. // Lock should be held. -func (fs *fileStore) storeRawMsg(subj string, hdr, msg []byte, seq uint64, ts, ttl int64) (err error) { +func (fs *fileStore) storeRawMsg(subj string, hdr, msg []byte, seq uint64, ts, ttl int64, discardNewCheck bool) (err error) { if fs.isClosed() { return ErrStoreClosed } @@ -4618,11 +4840,15 @@ func (fs *fileStore) storeRawMsg(subj string, hdr, msg []byte, seq uint64, ts, t var fseq uint64 // Check if we are discarding new messages when we reach the limit. - if fs.cfg.Discard == DiscardNew { + // If we are clustered, we do the enforcement above and should not disqualify + // the message here since it could cause replicas to drift. + if discardNewCheck && fs.cfg.Discard == DiscardNew { var asl bool if psmax && psmc >= mmp { // If we are instructed to discard new per subject, this is an error. - if fs.cfg.DiscardNewPer { + // However, allow rollup messages through since they will purge old + // messages for the subject after storing, restoring the limit. + if fs.cfg.DiscardNewPer && len(sliceHeader(JSMsgRollup, hdr)) == 0 { return ErrMaxMsgsPerSubject } if fseq, err = fs.firstSeqForSubj(subj); err != nil { @@ -4630,16 +4856,12 @@ func (fs *fileStore) storeRawMsg(subj string, hdr, msg []byte, seq uint64, ts, t } asl = true } - // If we are discard new and limits policy and clustered, we do the enforcement - // above and should not disqualify the message here since it could cause replicas to drift. - if fs.cfg.Retention == LimitsPolicy || fs.cfg.Replicas == 1 { - if fs.cfg.MaxMsgs > 0 && fs.state.Msgs >= uint64(fs.cfg.MaxMsgs) && !asl { - return ErrMaxMsgs - } - if fs.cfg.MaxBytes > 0 && fs.state.Bytes+fileStoreMsgSize(subj, hdr, msg) >= uint64(fs.cfg.MaxBytes) { - if !asl || fs.sizeForSeq(fseq) <= int(fileStoreMsgSize(subj, hdr, msg)) { - return ErrMaxBytes - } + if fs.cfg.MaxMsgs > 0 && fs.state.Msgs >= uint64(fs.cfg.MaxMsgs) && !asl { + return ErrMaxMsgs + } + if fs.cfg.MaxBytes > 0 && fs.state.Bytes+fileStoreMsgSize(subj, hdr, msg) > uint64(fs.cfg.MaxBytes) { + if !asl || fs.sizeForSeq(fseq) < int(fileStoreMsgSize(subj, hdr, msg)) { + return ErrMaxBytes } } } @@ -4652,6 +4874,17 @@ func (fs *fileStore) storeRawMsg(subj string, hdr, msg []byte, seq uint64, ts, t seq = fs.state.LastSeq + 1 } + // Return previous write errors immediately. + if fs.werr != nil { + return fs.werr + } + // Persist any returned errors to be used in the future. + defer func() { + if err != nil { + fs.setWriteErr(err) + } + }() + // Write msg record. // Add expiry bit to sequence if needed. This is so that if we need to // rebuild, we know which messages to look at more quickly. @@ -4691,18 +4924,25 @@ func (fs *fileStore) storeRawMsg(subj string, hdr, msg []byte, seq uint64, ts, t if psmax && psmc >= mmp { // We may have done this above. if fseq == 0 { - fseq, _ = fs.firstSeqForSubj(subj) + fseq, err = fs.firstSeqForSubj(subj) + if err != nil { + return err + } } - if ok, _ := fs.removeMsgViaLimits(fseq); ok { + if ok, err := fs.removeMsgViaLimits(fseq); err != nil { + return err + } else if ok { // Make sure we are below the limit. if psmc--; psmc >= mmp { bsubj := stringToBytes(subj) for info, ok := fs.psim.Find(bsubj); ok && info.total > mmp; info, ok = fs.psim.Find(bsubj) { - if seq, _ := fs.firstSeqForSubj(subj); seq > 0 { - if ok, _ := fs.removeMsgViaLimits(seq); !ok { - break - } - } else { + if seq, err := fs.firstSeqForSubj(subj); err != nil { + return err + } else if seq == 0 { + break + } else if ok, err = fs.removeMsgViaLimits(seq); err != nil { + return err + } else if !ok { break } } @@ -4710,7 +4950,9 @@ func (fs *fileStore) storeRawMsg(subj string, hdr, msg []byte, seq uint64, ts, t } else if mb := fs.selectMsgBlock(fseq); mb != nil { // If we are here we could not remove fseq from above, so rebuild. var ld *LostStreamData - if ld, _, _ = mb.rebuildState(); ld != nil { + if ld, _, err = mb.rebuildState(); err != nil { + return err + } else if ld != nil { fs.rebuildStateLocked(ld) } } @@ -4719,8 +4961,12 @@ func (fs *fileStore) storeRawMsg(subj string, hdr, msg []byte, seq uint64, ts, t // Limits checks and enforcement. // If they do any deletions they will update the // byte count on their own, so no need to compensate. - fs.enforceMsgLimit() - fs.enforceBytesLimit() + if err = fs.enforceMsgLimit(); err != nil { + return err + } + if err = fs.enforceBytesLimit(); err != nil { + return err + } // Per-message TTL. if ttl > 0 { @@ -4743,21 +4989,83 @@ func (fs *fileStore) storeRawMsg(subj string, hdr, msg []byte, seq uint64, ts, t // Message scheduling. if fs.scheduling != nil { - if schedule, ok := getMessageSchedule(hdr); ok && !schedule.IsZero() { + if schedule, apiErr := nextMessageSchedule(hdr, ts); apiErr == nil && !schedule.IsZero() { fs.scheduling.add(seq, subj, schedule.UnixNano()) fs.lmb.schedules++ - } else { + } else if getMessageScheduler(hdr) == _EMPTY_ { fs.scheduling.removeSubject(subj) } + + // Check for a repeating schedule and update such that it triggers again. + if scheduleNext := bytesToString(sliceHeader(JSScheduleNext, hdr)); scheduleNext != _EMPTY_ && scheduleNext != JSScheduleNextPurge { + scheduler := getMessageScheduler(hdr) + if next, err := time.Parse(time.RFC3339Nano, scheduleNext); err == nil && scheduler != _EMPTY_ { + fs.scheduling.update(scheduler, next.UnixNano()) + } + } } return nil } +// isReadErr reports whether err originated from reading or interpreting +// existing on-disk data rather than from a failed write. These surface through +// cache/load paths and should not permanently disable writes. +func isReadErr(err error) bool { + var badMsg errBadMsg + return errors.Is(err, errNoCache) || + errors.Is(err, errDeletedMsg) || + errors.Is(err, errPartialCache) || + errors.Is(err, errCorruptState) || + errors.Is(err, errPriorState) || + errors.Is(err, io.ErrUnexpectedEOF) || + errors.Is(err, errMsgBlkTooBig) || + errors.As(err, &badMsg) +} + +// Lock should be held. +func (fs *fileStore) setWriteErr(err error) { + if fs.werr != nil { + return + } + // Ignore non-write errors. + if err == ErrStoreClosed { + return + } + // If this is a not found report but do not disable. + if os.IsNotExist(err) { + fs.warn("Resource not found: %v", err) + return + } + // Read/decode errors surfaced from existing on-disk data are not write failures. + // Log and continue instead of disabling writes. + if isReadErr(err) { + fs.rateLimitWarn("Ignoring non-write error: %v", err) + assert.Unreachable("Filestore encountered read error", map[string]any{ + "name": fs.cfg.Name, + "err": err, + "stack": string(debug.Stack()), + }) + return + } + fs.error("Critical write error: %v", err) + fs.werr = err + assert.Unreachable("Filestore encountered write error", map[string]any{ + "name": fs.cfg.Name, + "err": err, + "stack": string(debug.Stack()), + }) +} + // StoreRawMsg stores a raw message with expected sequence number and timestamp. -func (fs *fileStore) StoreRawMsg(subj string, hdr, msg []byte, seq uint64, ts, ttl int64) error { +func (fs *fileStore) StoreRawMsg(subj string, hdr, msg []byte, seq uint64, ts, ttl int64, discardNewCheck bool) error { fs.mu.Lock() - err := fs.storeRawMsg(subj, hdr, msg, seq, ts, ttl) + // Always return previous write errors. + if err := fs.werr; err != nil { + fs.mu.Unlock() + return err + } + err := fs.storeRawMsg(subj, hdr, msg, seq, ts, ttl, discardNewCheck) cb := fs.scb // Check if first message timestamp requires expiry // sooner than initial replica expiry timer set to MaxAge when initializing. @@ -4777,8 +5085,14 @@ func (fs *fileStore) StoreRawMsg(subj string, hdr, msg []byte, seq uint64, ts, t // Store stores a message. We hold the main filestore lock for any write operation. func (fs *fileStore) StoreMsg(subj string, hdr, msg []byte, ttl int64) (uint64, int64, error) { fs.mu.Lock() + // Always return previous write errors. + if err := fs.werr; err != nil { + fs.mu.Unlock() + return 0, 0, err + } seq, ts := fs.state.LastSeq+1, time.Now().UnixNano() - err := fs.storeRawMsg(subj, hdr, msg, seq, ts, ttl) + // This is called for a R1 with no expected sequence number, so perform DiscardNew checks on the store-level. + err := fs.storeRawMsg(subj, hdr, msg, seq, ts, ttl, true) cb := fs.scb fs.mu.Unlock() @@ -4796,13 +5110,17 @@ func (fs *fileStore) StoreMsg(subj string, hdr, msg []byte, ttl int64) (uint64, // we will place an empty record marking the sequence as used. The // sequence will be marked erased. // fs lock should be held. -func (mb *msgBlock) skipMsg(seq uint64, now int64) { +func (mb *msgBlock) skipMsg(seq uint64, now int64) error { if mb == nil { - return + return nil } var needsRecord bool mb.mu.Lock() + if err := mb.werr; err != nil { + mb.mu.Unlock() + return err + } // If we are empty can just do meta. if mb.msgs == 0 { atomic.StoreUint64(&mb.last.seq, seq) @@ -4815,12 +5133,16 @@ func (mb *msgBlock) skipMsg(seq uint64, now int64) { mb.dmap.Insert(seq) } if needsRecord { - mb.writeMsgRecordLocked(emptyRecordLen, seq|ebit, _EMPTY_, nil, nil, now, true, true) + if err := mb.writeMsgRecordLocked(emptyRecordLen, seq|ebit, _EMPTY_, nil, nil, now, true, true); err != nil { + mb.mu.Unlock() + return err + } } mb.mu.Unlock() if !needsRecord { mb.kickFlusher() } + return nil } // SkipMsg will use the next sequence number but not store anything. @@ -4831,6 +5153,11 @@ func (fs *fileStore) SkipMsg(seq uint64) (uint64, error) { fs.mu.Lock() defer fs.mu.Unlock() + // Always return previous write errors. + if err := fs.werr; err != nil { + return 0, err + } + // Check sequence matches our last sequence. if seq != fs.state.LastSeq+1 { if seq > 0 { @@ -4846,7 +5173,10 @@ func (fs *fileStore) SkipMsg(seq uint64) (uint64, error) { } // Write skip msg. - mb.skipMsg(seq, now) + if err = mb.skipMsg(seq, now); err != nil { + fs.setWriteErr(err) + return 0, err + } // Update fs state. fs.state.LastSeq, fs.state.LastTime = seq, time.Unix(0, now).UTC() @@ -4862,11 +5192,16 @@ func (fs *fileStore) SkipMsg(seq uint64) (uint64, error) { return seq, nil } -// Skip multiple msgs. We will determine if we can fit into current lmb or we need to create a new block. +// SkipMsgs skips multiple msgs. We will determine if we can fit into current lmb or we need to create a new block. func (fs *fileStore) SkipMsgs(seq uint64, num uint64) error { fs.mu.Lock() defer fs.mu.Unlock() + // Always return previous write errors. + if err := fs.werr; err != nil { + return err + } + // Check sequence matches our last sequence. if seq != fs.state.LastSeq+1 { if seq > 0 { @@ -4899,6 +5234,10 @@ func (fs *fileStore) SkipMsgs(seq uint64, num uint64) error { lseq := seq + num - 1 mb.mu.Lock() + if err := mb.werr; err != nil { + mb.mu.Unlock() + return err + } // If we are empty update meta directly. if mb.msgs == 0 { atomic.StoreUint64(&mb.last.seq, lseq) @@ -4911,8 +5250,12 @@ func (fs *fileStore) SkipMsgs(seq uint64, num uint64) error { } } // Write out our placeholder. - mb.writeMsgRecordLocked(emptyRecordLen, lseq|ebit, _EMPTY_, nil, nil, now, true, true) + err := mb.writeMsgRecordLocked(emptyRecordLen, lseq|ebit, _EMPTY_, nil, nil, now, true, true) mb.mu.Unlock() + if err != nil { + fs.setWriteErr(err) + return err + } // Now update FS accounting. // Update fs state. @@ -4928,20 +5271,24 @@ func (fs *fileStore) SkipMsgs(seq uint64, num uint64) error { } // FlushAllPending flushes all data that was still pending to be written. -func (fs *fileStore) FlushAllPending() { +func (fs *fileStore) FlushAllPending() error { fs.mu.Lock() defer fs.mu.Unlock() - fs.checkAndFlushLastBlock() + // Return previous write errors immediately. + if fs.werr != nil { + return fs.werr + } + return fs.checkAndFlushLastBlock() } // Lock should be held. -func (fs *fileStore) rebuildFirst() { +func (fs *fileStore) rebuildFirst() error { if len(fs.blks) == 0 { - return + return nil } fmb := fs.blks[0] if fmb == nil { - return + return nil } ld, _, _ := fmb.rebuildState() @@ -4950,11 +5297,17 @@ func (fs *fileStore) rebuildFirst() { fmb.mu.RUnlock() if isEmpty { fmb.mu.Lock() - fs.removeMsgBlock(fmb) + err := fs.forceRemoveMsgBlock(fmb) fmb.mu.Unlock() + if err != nil { + return err + } + } + if err := fs.selectNextFirst(); err != nil { + return err } - fs.selectNextFirst() fs.rebuildStateLocked(ld) + return nil } // Optimized helper function to return first sequence. @@ -4998,8 +5351,9 @@ func (fs *fileStore) firstSeqForSubj(subj string) (uint64, error) { bsubj := stringToBytes(subj) if ss, ok := mb.fss.Find(bsubj); ok && ss != nil { + var err error if ss.firstNeedsUpdate || ss.lastNeedsUpdate { - mb.recalculateForSubj(subj, ss) + err = mb.recalculateForSubj(subj, ss) } mb.mu.Unlock() // Re-acquire fs lock @@ -5010,6 +5364,9 @@ func (fs *fileStore) firstSeqForSubj(subj string) (uint64, error) { info.fblk = i } } + if err != nil { + return 0, err + } return ss.First, nil } // If we did not find it and we loaded this msgBlock try to expire as long as not the last. @@ -5028,12 +5385,12 @@ func (fs *fileStore) firstSeqForSubj(subj string) (uint64, error) { // Will check the msg limit and drop firstSeq msg if needed. // Lock should be held. -func (fs *fileStore) enforceMsgLimit() { +func (fs *fileStore) enforceMsgLimit() error { if fs.cfg.Discard != DiscardOld { - return + return nil } if fs.cfg.MaxMsgs <= 0 || fs.state.Msgs <= uint64(fs.cfg.MaxMsgs) { - return + return nil } for nmsgs := fs.state.Msgs; nmsgs > uint64(fs.cfg.MaxMsgs); nmsgs = fs.state.Msgs { // If the first block can be removed fully, purge it entirely without needing to walk sequences. @@ -5043,25 +5400,29 @@ func (fs *fileStore) enforceMsgLimit() { msgs := fmb.msgs fmb.mu.RUnlock() if nmsgs-msgs > uint64(fs.cfg.MaxMsgs) { - fs.purgeMsgBlock(fmb) + if err := fs.purgeMsgBlock(fmb); err != nil { + return err + } continue } } - if removed, err := fs.deleteFirstMsg(); err != nil || !removed { - fs.rebuildFirst() - return + if removed, err := fs.deleteFirstMsg(); err != nil { + return err + } else if !removed { + return fs.rebuildFirst() } } + return nil } // Will check the bytes limit and drop msgs if needed. // Lock should be held. -func (fs *fileStore) enforceBytesLimit() { +func (fs *fileStore) enforceBytesLimit() error { if fs.cfg.Discard != DiscardOld { - return + return nil } if fs.cfg.MaxBytes <= 0 || fs.state.Bytes <= uint64(fs.cfg.MaxBytes) { - return + return nil } for bs := fs.state.Bytes; bs > uint64(fs.cfg.MaxBytes); bs = fs.state.Bytes { // If the first block can be removed fully, purge it entirely without needing to walk sequences. @@ -5071,22 +5432,26 @@ func (fs *fileStore) enforceBytesLimit() { bytes := fmb.bytes fmb.mu.RUnlock() if bs-bytes > uint64(fs.cfg.MaxBytes) { - fs.purgeMsgBlock(fmb) + if err := fs.purgeMsgBlock(fmb); err != nil { + return err + } continue } } - if removed, err := fs.deleteFirstMsg(); err != nil || !removed { - fs.rebuildFirst() - return + if removed, err := fs.deleteFirstMsg(); err != nil { + return err + } else if !removed { + return fs.rebuildFirst() } } + return nil } // Will make sure we have limits honored for max msgs per subject on recovery or config update. // We will make sure to go through all msg blocks etc. but in practice this // will most likely only be the last one, so can take a more conservative approach. // Lock should be held. -func (fs *fileStore) enforceMsgPerSubjectLimit(fireCallback bool) { +func (fs *fileStore) enforceMsgPerSubjectLimit(fireCallback bool) error { start := time.Now() defer func() { if took := time.Since(start); took > time.Minute { @@ -5131,10 +5496,14 @@ func (fs *fileStore) enforceMsgPerSubjectLimit(fireCallback bool) { fs.psim, fs.tsl = fs.psim.Empty(), 0 for _, mb := range fs.blks { ld, _, err := mb.rebuildState() - if err != nil && ld != nil { + if err != nil { + return err + } else if ld != nil { fs.addLostData(ld) } - fs.populateGlobalPerSubjectInfo(mb) + if err = fs.populateGlobalPerSubjectInfo(mb); err != nil { + return err + } } // Rebuild fs state too. fs.rebuildStateLocked(nil) @@ -5157,7 +5526,7 @@ func (fs *fileStore) enforceMsgPerSubjectLimit(fireCallback bool) { // If nothing to do then stop. if fblk == math.MaxUint32 { - return + return nil } // Collect all the msgBlks we alter. @@ -5172,7 +5541,10 @@ func (fs *fileStore) enforceMsgPerSubjectLimit(fireCallback bool) { continue } mb.mu.Lock() - mb.ensurePerSubjectInfoLoaded() + if err := mb.ensurePerSubjectInfoLoaded(); err != nil { + mb.mu.Unlock() + return err + } // It isn't safe to intersect mb.fss directly, because removeMsgViaLimits modifies it // during the iteration, which can cause us to miss keys. We won't copy the entire // SimpleState structs though but rather just take pointers for speed. @@ -5182,15 +5554,19 @@ func (fs *fileStore) enforceMsgPerSubjectLimit(fireCallback bool) { return true }) mb.mu.Unlock() + var ierr error stree.LazyIntersect(needAttention, fss, func(subj []byte, total *uint64, ssptr **SimpleState) { - if ssptr == nil || total == nil { + if ssptr == nil || total == nil || ierr != nil { return } ss := *ssptr if ss.firstNeedsUpdate || ss.lastNeedsUpdate { mb.mu.Lock() - mb.recalculateForSubj(bytesToString(subj), ss) + ierr = mb.recalculateForSubj(bytesToString(subj), ss) mb.mu.Unlock() + if ierr != nil { + return + } } for first := ss.First; *total > maxMsgsPer && first <= ss.Last; { m, _, err := mb.firstMatching(bytesToString(subj), false, first, &sm) @@ -5204,6 +5580,9 @@ func (fs *fileStore) enforceMsgPerSubjectLimit(fireCallback bool) { } } }) + if ierr != nil { + return ierr + } } // Expire the cache if we can. @@ -5214,6 +5593,7 @@ func (fs *fileStore) enforceMsgPerSubjectLimit(fireCallback bool) { } mb.mu.Unlock() } + return nil } // Lock should be held. @@ -5248,9 +5628,7 @@ func (fs *fileStore) removePerSubject(subj string) uint64 { bsubj := stringToBytes(subj) if info, ok := fs.psim.Find(bsubj); ok { info.total-- - if info.total == 1 { - info.fblk = info.lblk - } else if info.total == 0 { + if info.total == 0 { if _, ok = fs.psim.Delete(bsubj); ok { fs.tsl -= len(subj) return 0 @@ -5278,11 +5656,15 @@ func (fs *fileStore) removeMsg(seq uint64, secure, viaLimits, needFSLock bool) ( } fsLock() + defer fsUnlock() if fs.isClosed() { - fsUnlock() return false, ErrStoreClosed } + // Always return previous write errors. + if err := fs.werr; err != nil { + return false, err + } // If in encrypted mode negate secure rewrite here. if secure && fs.prf != nil { secure = false @@ -5294,19 +5676,30 @@ func (fs *fileStore) removeMsg(seq uint64, secure, viaLimits, needFSLock bool) ( if seq <= fs.state.LastSeq { err = ErrStoreMsgNotFound } - fsUnlock() return false, err } + return fs.removeMsgFromBlock(mb, seq, secure, viaLimits) +} + +// Remove a message from the given block, optionally rewriting the mb file. +// fs lock should be held. +func (fs *fileStore) removeMsgFromBlock(mb *msgBlock, seq uint64, secure, viaLimits bool) (removed bool, rerr error) { mb.mu.Lock() // See if we are closed or the sequence number is still relevant or if we know its deleted. if mb.closed || seq < atomic.LoadUint64(&mb.first.seq) || mb.dmap.Exists(seq) { mb.mu.Unlock() - fsUnlock() return false, nil } + // Persist any write errors. + defer func() { + if rerr != nil { + fs.setWriteErr(rerr) + } + }() + fifo := seq == atomic.LoadUint64(&mb.first.seq) isLastBlock := mb == fs.lmb isEmpty := mb.msgs == 1 // ... about to be zero though. @@ -5318,7 +5711,6 @@ func (fs *fileStore) removeMsg(seq uint64, secure, viaLimits, needFSLock bool) ( if mb.cacheNotLoaded() { if err := mb.loadMsgsWithLock(); err != nil { mb.mu.Unlock() - fsUnlock() return false, err } didLoad = true @@ -5341,9 +5733,8 @@ func (fs *fileStore) removeMsg(seq uint64, secure, viaLimits, needFSLock bool) ( if err != nil { finishedWithCache() mb.mu.Unlock() - fsUnlock() // Mimic err behavior from above check to dmap. No error returned if already removed. - if err == errDeletedMsg { + if err == ErrStoreMsgNotFound || err == errDeletedMsg { err = nil } return false, err @@ -5365,13 +5756,15 @@ func (fs *fileStore) removeMsg(seq uint64, secure, viaLimits, needFSLock bool) ( mb.mu.Unlock() // Only safe way to checkLastBlock is to unlock here... lmb, err := fs.checkLastBlock(emptyRecordLen) if err != nil { + mb.mu.Lock() finishedWithCache() - fsUnlock() + mb.mu.Unlock() return false, err } if err := lmb.writeTombstone(seq, ts); err != nil { + mb.mu.Lock() finishedWithCache() - fsUnlock() + mb.mu.Unlock() return false, err } mb.mu.Lock() // We'll need the lock back to carry on safely. @@ -5390,7 +5783,6 @@ func (fs *fileStore) removeMsg(seq uint64, secure, viaLimits, needFSLock bool) ( if err != nil { finishedWithCache() mb.mu.Unlock() - fsUnlock() return false, err } // Need to copy the subject, as eraseMsg will overwrite the cache and we won't @@ -5399,7 +5791,6 @@ func (fs *fileStore) removeMsg(seq uint64, secure, viaLimits, needFSLock bool) ( if err := mb.eraseMsg(seq, int(ri), int(msz), isLastBlock); err != nil { finishedWithCache() mb.mu.Unlock() - fsUnlock() return false, err } } @@ -5431,10 +5822,18 @@ func (fs *fileStore) removeMsg(seq uint64, secure, viaLimits, needFSLock bool) ( fs.dirty++ // If we are tracking subjects here make sure we update that accounting. - mb.ensurePerSubjectInfoLoaded() + if err = mb.ensurePerSubjectInfoLoaded(); err != nil { + finishedWithCache() + mb.mu.Unlock() + return false, err + } // If we are tracking multiple subjects here make sure we update that accounting. - mb.removeSeqPerSubject(subj, seq) + if _, err = mb.removeSeqPerSubject(subj, seq); err != nil { + finishedWithCache() + mb.mu.Unlock() + return false, err + } fs.removePerSubject(subj) if fs.ttls != nil && ttl > 0 { expires := time.Duration(ts) + (time.Second * time.Duration(ttl)) @@ -5462,7 +5861,11 @@ func (fs *fileStore) removeMsg(seq uint64, secure, viaLimits, needFSLock bool) ( // Note that we do not have to store empty records for the deleted, so don't use to calculate. // TODO(dlc) - This should not be inline, should kick the sync routine. if !isLastBlock && mb.shouldCompactInline() { - mb.compact() + if err = mb.compact(); err != nil { + finishedWithCache() + mb.mu.Unlock() + return false, err + } } } @@ -5478,7 +5881,11 @@ func (fs *fileStore) removeMsg(seq uint64, secure, viaLimits, needFSLock bool) ( var firstSeqNeedsUpdate bool if isEmpty { // This writes tombstone iff mb == lmb, so no need to do above. - fs.removeMsgBlock(mb) + if err = fs.removeMsgBlock(mb); err != nil { + finishedWithCache() + mb.mu.Unlock() + return false, err + } firstSeqNeedsUpdate = seq == fs.state.FirstSeq } finishedWithCache() @@ -5488,7 +5895,9 @@ func (fs *fileStore) removeMsg(seq uint64, secure, viaLimits, needFSLock bool) ( // then we need to jump message blocks. We will also write the index so // we don't lose track of the first sequence. if firstSeqNeedsUpdate { - fs.selectNextFirst() + if err = fs.selectNextFirst(); err != nil { + return false, err + } } if cb := fs.scb; cb != nil { @@ -5498,17 +5907,58 @@ func (fs *fileStore) removeMsg(seq uint64, secure, viaLimits, needFSLock bool) ( delta := int64(msz) cb(-1, -delta, seq, subj) - if !needFSLock { - fs.mu.Lock() - } - } else if needFSLock { - // We acquired it so release it. - fs.mu.Unlock() + fs.mu.Lock() } return true, nil } +// Remove all messages in the range [first, last] +// Lock should be held. +func (fs *fileStore) removeMsgsInRange(first, last uint64, viaLimits bool) error { + last = min(last, fs.state.LastSeq) + if first > last { + return nil + } + + firstBlock := sort.Search(len(fs.blks), func(i int) bool { + return atomic.LoadUint64(&fs.blks[i].last.seq) >= first + }) + if firstBlock >= len(fs.blks) { + return nil + } + + for i := firstBlock; i < len(fs.blks); { + mb := fs.blks[i] + mbFirstSeq := atomic.LoadUint64(&mb.first.seq) + mbLastSeq := atomic.LoadUint64(&mb.last.seq) + if mbFirstSeq > last { + break + } + if mbFirstSeq >= first && mbLastSeq <= last && mb.numPriorTombs() == 0 { + // If this block stores no tombstones for previous blocks, + // and its sequences are within the range to be removed, + // we can get rid of the block entirely. To do that we use + // purgeMgsBlock, which also removes the block from fs.blks. + // After purgeMsgBlock, i will be the index of the following + // msgBlock, if any. Therefore, continue without incrementing i. + if err := fs.purgeMsgBlock(mb); err != nil { + return err + } + } else { + from := max(first, mbFirstSeq) + to := min(last, mbLastSeq) + for seq := from; seq <= to; seq++ { + if _, err := fs.removeMsgFromBlock(mb, seq, false, viaLimits); err != nil { + return err + } + } + i++ + } + } + return nil +} + // Tests whether we should try to compact this block while inline removing msgs. // We will want rbytes to be over the minimum and have a 2x potential savings. // If we compacted before but rbytes didn't improve much, guard against constantly compacting. @@ -5527,8 +5977,8 @@ func (mb *msgBlock) shouldCompactSync() bool { // This will compact and rewrite this block. This version will not process any tombstone cleanup. // Write lock needs to be held. -func (mb *msgBlock) compact() { - mb.compactWithFloor(0) +func (mb *msgBlock) compact() error { + return mb.compactWithFloor(0, nil) } // This will compact and rewrite this block. This should only be called when we know we want to rewrite this block. @@ -5536,7 +5986,7 @@ func (mb *msgBlock) compact() { // writing new messages. We will silently bail on any issues with the underlying block and let someone else detect. // if fseq > 0 we will attempt to cleanup stale tombstones. // Write lock needs to be held. -func (mb *msgBlock) compactWithFloor(floor uint64) error { +func (mb *msgBlock) compactWithFloor(floor uint64, fsDmap *avl.SequenceSet) error { wasLoaded := mb.cache != nil && mb.cacheAlreadyLoaded() if !wasLoaded { if err := mb.loadMsgsWithLock(); err != nil { @@ -5590,7 +6040,9 @@ func (mb *msgBlock) compactWithFloor(floor uint64) error { // If this entry is for a lower seq than ours then keep around. // We also check that it is greater than our floor. Floor is zero on normal // calls to compact. - if seq < fseq && seq >= floor { + // If the global delete map is set, check if a tombstone is still + // referencing a message in another block. If not, it can be removed. + if seq < fseq && seq >= floor && (fsDmap == nil || fsDmap.Exists(seq)) { nbuf = append(nbuf, buf[index:index+rl]...) } } else { @@ -5645,11 +6097,11 @@ func (mb *msgBlock) compactWithFloor(floor uint64) error { err := os.WriteFile(mfn, nbuf, defaultFilePerms) dios <- struct{}{} if err != nil { - os.Remove(mfn) + _ = os.Remove(mfn) return err } if err := os.Rename(mfn, mb.mfn); err != nil { - os.Remove(mfn) + _ = os.Remove(mfn) return err } @@ -5827,7 +6279,8 @@ func (mb *msgBlock) flushLoop(fch, qch chan struct{}) { ts *= 2 } - mb.flushPendingMsgs() + // Ignore error here, the error is persisted as mb.werr and will be bubbled up later. + _ = mb.flushPendingMsgs() } // Check if we are no longer the last message block. If we are @@ -5979,11 +6432,17 @@ func (mb *msgBlock) truncate(tseq uint64, ts int64) (nmsgs, nbytes uint64, err e return 0, 0, err } } else if mb.mfd != nil { - mb.mfd.Truncate(eof) - mb.mfd.Sync() + if err = mb.mfd.Truncate(eof); err != nil { + return 0, 0, err + } + if err = mb.mfd.Sync(); err != nil { + return 0, 0, err + } // Update our checksum. var lchk [8]byte - mb.mfd.ReadAt(lchk[:], eof-8) + if _, err = mb.mfd.ReadAt(lchk[:], eof-8); err != nil { + return 0, 0, err + } copy(mb.lchk[0:], lchk[:]) } else { return 0, 0, fmt.Errorf("failed to truncate msg block %d, file not open", mb.index) @@ -5997,7 +6456,9 @@ func (mb *msgBlock) truncate(tseq uint64, ts int64) (nmsgs, nbytes uint64, err e mb.clearCacheAndOffset() // Redo per subject info for this block. - mb.resetPerSubjectInfo() + if err = mb.resetPerSubjectInfo(); err != nil { + return purged, bytes, err + } // Load msgs again. return purged, bytes, mb.loadMsgsWithLock() @@ -6049,7 +6510,7 @@ func (mb *msgBlock) selectNextFirst() { // Select the next FirstSeq // Also cleans up empty blocks at the start only containing tombstones. // Lock should be held. -func (fs *fileStore) selectNextFirst() { +func (fs *fileStore) selectNextFirst() error { if len(fs.blks) > 0 { for len(fs.blks) > 1 { mb := fs.blks[0] @@ -6059,8 +6520,11 @@ func (fs *fileStore) selectNextFirst() { mb.mu.Unlock() break } - fs.forceRemoveMsgBlock(mb) + err := fs.forceRemoveMsgBlock(mb) mb.mu.Unlock() + if err != nil { + return err + } } mb := fs.blks[0] mb.mu.RLock() @@ -6078,6 +6542,7 @@ func (fs *fileStore) selectNextFirst() { } // Mark first as moved. Plays into tombstone cleanup for syncBlocks. fs.firstMoved = true + return nil } // Lock should be held. @@ -6086,7 +6551,7 @@ func (mb *msgBlock) resetCacheExpireTimer(td time.Duration) { td = mb.cexp + 100*time.Millisecond } if mb.ctmr == nil { - mb.ctmr = time.AfterFunc(td, mb.expireCache) + mb.ctmr = time.AfterFunc(td, mb.tryExpireCache) } else { mb.ctmr.Reset(td) } @@ -6134,10 +6599,10 @@ func (mb *msgBlock) clearCache() { } // Called to possibly expire a message block cache. -func (mb *msgBlock) expireCache() { +func (mb *msgBlock) tryExpireCache() { mb.mu.Lock() defer mb.mu.Unlock() - mb.expireCacheLocked() + mb.tryExpireCacheLocked() } func (mb *msgBlock) tryForceExpireCache() { @@ -6148,10 +6613,10 @@ func (mb *msgBlock) tryForceExpireCache() { // We will attempt to force expire this by temporarily clearing the last load time. func (mb *msgBlock) tryForceExpireCacheLocked() { - llts, lwts := mb.llts, mb.lwts - mb.llts, mb.lwts = 0, 0 - mb.expireCacheLocked() - mb.llts, mb.lwts = llts, lwts + llts := mb.llts + mb.llts = 0 + mb.tryExpireCacheLocked() + mb.llts = llts } // This is for expiration of the write cache, which will be partial with fip. @@ -6163,7 +6628,7 @@ func (mb *msgBlock) tryExpireWriteCache() []byte { } lwts, buf, llts, nra := mb.lwts, mb.cache.buf, mb.llts, mb.cache.nra mb.lwts, mb.cache.nra = 0, true - mb.expireCacheLocked() + mb.tryExpireCacheLocked() mb.lwts = lwts if mb.cache != nil { mb.cache.nra = nra @@ -6178,7 +6643,7 @@ func (mb *msgBlock) tryExpireWriteCache() []byte { } // Lock should be held. -func (mb *msgBlock) expireCacheLocked() { +func (mb *msgBlock) tryExpireCacheLocked() { var strengthened bool if mb.cache == nil { mb.cache = mb.ecache.Value() @@ -6516,10 +6981,16 @@ func (fs *fileStore) runMsgScheduling() { } fs.scheduling.running = true - scheduledMsgs := fs.scheduling.getScheduledMessages(func(seq uint64, smv *StoreMsg) *StoreMsg { - sm, _ := fs.msgForSeqLocked(seq, smv, false) - return sm - }) + scheduledMsgs := fs.scheduling.getScheduledMessages( + func(seq uint64, smv *StoreMsg) *StoreMsg { + sm, _ := fs.msgForSeqLocked(seq, smv, false) + return sm + }, + func(subj string, smv *StoreMsg) *StoreMsg { + sm, _ := fs.loadLastLocked(subj, smv) + return sm + }, + ) if len(scheduledMsgs) > 0 { fs.mu.Unlock() for _, msg := range scheduledMsgs { @@ -6533,44 +7004,77 @@ func (fs *fileStore) runMsgScheduling() { } // Lock should be held. -func (fs *fileStore) checkAndFlushLastBlock() { +func (fs *fileStore) checkAndFlushLastBlock() error { lmb := fs.lmb if lmb == nil { - return + return nil } - if lmb.pendingWriteSize() > 0 { - // Since fs lock is held need to pull this apart in case we need to rebuild state. - lmb.mu.Lock() - ld, _ := lmb.flushPendingMsgsLocked() + lmb.mu.Lock() + if err := lmb.werr; err != nil { lmb.mu.Unlock() - if ld != nil { - fs.rebuildStateLocked(ld) - } + return err } + + if lmb.pendingWriteSizeLocked() == 0 { + lmb.mu.Unlock() + return nil + } + ld, err := lmb.flushPendingMsgsLocked() + lmb.mu.Unlock() + if err != nil { + return err + } + // Since fs lock is held need to unlock the mb in case we need to rebuild state. + if ld != nil { + fs.rebuildStateLocked(ld) + } + return nil } // This will check all the checksums on messages and report back any sequence numbers with errors. -func (fs *fileStore) checkMsgs() *LostStreamData { +func (fs *fileStore) checkMsgs() (*LostStreamData, error) { fs.mu.Lock() defer fs.mu.Unlock() - fs.checkAndFlushLastBlock() + var firstErr error + storeErr := func(err error) error { + fs.warn("checkMsgs: %v", err) + if firstErr == nil { + firstErr = err + } + return err + } + + if err := fs.checkAndFlushLastBlock(); err != nil { + return nil, storeErr(fmt.Errorf("flush of last block failed: %w", err)) + } // Clear any global subject state. fs.psim, fs.tsl = fs.psim.Empty(), 0 for _, mb := range fs.blks { // Make sure encryption loaded if needed for the block. - fs.loadEncryptionForMsgBlock(mb) + if err := fs.loadEncryptionForMsgBlock(mb); err != nil { + _ = storeErr(fmt.Errorf("loading encryption for block %d failed: %w", mb.index, err)) + continue + } // FIXME(dlc) - check tombstones here too? - if ld, _, err := mb.rebuildState(); err != nil && ld != nil { + ld, _, err := mb.rebuildState() + if err != nil { + _ = storeErr(fmt.Errorf("rebuildState for block %d failed: %w", mb.index, err)) + continue + } + if ld != nil { // Rebuild fs state too. fs.rebuildStateLocked(ld) } - fs.populateGlobalPerSubjectInfo(mb) + if err = fs.populateGlobalPerSubjectInfo(mb); err != nil { + _ = storeErr(fmt.Errorf("populating per-subject info for block %d failed: %w", mb.index, err)) + continue + } } - return fs.ld + return fs.ld, firstErr } // Lock should be held. @@ -6621,7 +7125,36 @@ func (mb *msgBlock) writeMsgRecord(rl, seq uint64, subj string, mhdr, msg []byte // Will write the message record to the underlying message block. // filestore lock will be held. // mb lock should be held. -func (mb *msgBlock) writeMsgRecordLocked(rl, seq uint64, subj string, mhdr, msg []byte, ts int64, flush, kick bool) error { +func (mb *msgBlock) writeMsgRecordLocked(rl, seq uint64, subj string, mhdr, msg []byte, ts int64, flush, kick bool) (rerr error) { + // Return previous write errors immediately. + if mb.werr != nil { + return mb.werr + } + // Persist any returned errors to be used in the future. + defer func() { + if rerr != nil && mb.werr == nil { + // Read/decode errors surfaced from existing on-disk data are not write failures. + // Log and continue instead of disabling writes. + if isReadErr(rerr) { + mb.fs.rateLimitWarn("Ignoring non-write error: %v", rerr) + assert.Unreachable("Filestore msg block encountered read error", map[string]any{ + "name": mb.fs.cfg.Name, + "mb.index": mb.index, + "err": rerr, + "stack": string(debug.Stack()), + }) + return + } + mb.werr = rerr + assert.Unreachable("Filestore msg block encountered write error", map[string]any{ + "name": mb.fs.cfg.Name, + "mb.index": mb.index, + "err": rerr, + "stack": string(debug.Stack()), + }) + } + }() + // Enable for writing if our mfd is not open. if mb.mfd == nil { if err := mb.enableForWriting(flush && kick); err != nil { @@ -6754,9 +7287,12 @@ func (mb *msgBlock) writeMsgRecordLocked(rl, seq uint64, subj string, mhdr, msg } fch, werr := mb.fch, mb.werr + if werr != nil { + return werr + } // If we should be flushing, or had a write error, do so here. - if (flush && mb.fs.fip) || werr != nil { + if flush && mb.fs.fip { ld, err := mb.flushPendingMsgsLocked() if ld != nil { // We have the mb lock here, this needs the mb locks so do in its own go routine. @@ -6811,7 +7347,7 @@ func (mb *msgBlock) closeFDsLocked() error { func (mb *msgBlock) closeFDsLockedNoCheck() { if mb.mfd != nil { - mb.mfd.Close() + _ = mb.mfd.Close() mb.mfd = nil } } @@ -7004,8 +7540,8 @@ func (mb *msgBlock) atomicOverwriteFile(buf []byte, allowCompress bool) error { } errorCleanup := func(err error) error { - tmpFD.Close() - os.Remove(tmpFN) + _ = tmpFD.Close() + _ = os.Remove(tmpFN) return err } @@ -7123,12 +7659,25 @@ func (fs *fileStore) syncBlocks() { return } fs.mu.Lock() + if err := fs.werr; err != nil { + fs.mu.Unlock() + return + } blks := append([]*msgBlock(nil), fs.blks...) lmb, firstMoved, firstSeq := fs.lmb, fs.firstMoved, fs.state.FirstSeq // Clear first moved. fs.firstMoved = false fs.mu.Unlock() + storeFsWerr := func(err error) { + fs.mu.Lock() + defer fs.mu.Unlock() + fs.setWriteErr(err) + } + + var fsDmapLoaded bool + var fsDmap avl.SequenceSet + var markDirty bool for _, mb := range blks { // Do actual sync. Hold lock for consistency. @@ -7137,9 +7686,19 @@ func (fs *fileStore) syncBlocks() { mb.mu.Unlock() continue } + // Bubble up an individual block error into the broader filestore. + if err := mb.werr; err != nil { + mb.mu.Unlock() + storeFsWerr(err) + continue + } // See if we can close FDs due to being idle. if mb.mfd != nil && mb.sinceLastWriteActivity() > closeFDsIdle && mb.pendingWriteSizeLocked() == 0 { - mb.dirtyCloseWithRemove(false) + if err := mb.dirtyCloseWithRemove(false); err != nil { + mb.mu.Unlock() + storeFsWerr(err) + continue + } } // If our first has moved and we are set to noCompact (which is from tombstones), // clear so that we might cleanup tombstones. @@ -7155,31 +7714,60 @@ func (fs *fileStore) syncBlocks() { } // Flush anything that may be pending. - mb.flushPendingMsgsLocked() + if _, err := mb.flushPendingMsgsLocked(); err != nil { + mb.mu.Unlock() + storeFsWerr(err) + continue + } // Check if we need to sync. We will not hold lock during actual sync. needSync := mb.needSync + + // Reset. Because we let go of the lock, we could write new data to this mb which might or + // might not be synced later if we would've reset after letting go of the lock. + mb.needSync = false mb.mu.Unlock() // Check if we should compact here. // Need to hold fs lock in case we reference psim when loading in the mb and we may remove this block if truly empty. if needsCompact { + // Load a delete map containing only interior deletes. + // This is used when compacting to know if tombstones are still relevant, + // and if not they can be compacted. + if !fsDmapLoaded { + fsDmapLoaded = true + fsDmap = fs.deleteMap() + } fs.mu.RLock() mb.mu.Lock() - mb.compactWithFloor(firstSeq) + // If the block has already been removed in the meantime, we can simply skip. + if _, ok := fs.bim[mb.index]; !ok { + mb.mu.Unlock() + fs.mu.RUnlock() + continue + } + err := mb.compactWithFloor(firstSeq, &fsDmap) // If this compact removed all raw bytes due to tombstone cleanup, schedule to remove. shouldRemove := mb.rbytes == 0 mb.mu.Unlock() fs.mu.RUnlock() + if err != nil { + storeFsWerr(err) + continue + } // Check if we should remove. This will not be common, so we will re-take fs write lock here vs changing // it above which we would prefer to be a readlock such that other lookups can occur while compacting this block. if shouldRemove { fs.mu.Lock() mb.mu.Lock() - fs.removeMsgBlock(mb) + err = fs.removeMsgBlock(mb) mb.mu.Unlock() fs.mu.Unlock() needSync = false + if err != nil { + storeFsWerr(err) + continue + } } } @@ -7187,25 +7775,39 @@ func (fs *fileStore) syncBlocks() { if needSync { mb.mu.Lock() var fd *os.File + var err error var didOpen bool if mb.mfd != nil { fd = mb.mfd } else { <-dios - fd, _ = os.OpenFile(mb.mfn, os.O_RDWR, defaultFilePerms) + fd, err = os.OpenFile(mb.mfn, os.O_RDWR, defaultFilePerms) dios <- struct{}{} didOpen = true + if err != nil && !os.IsNotExist(err) { + mb.mu.Unlock() + storeFsWerr(err) + continue + } } // If we have an fd. if fd != nil { - canClear := fd.Sync() == nil + if err = fd.Sync(); err != nil { + // Close fd if we opened it, but ignore its error since sync takes precedence. + if didOpen { + _ = fd.Close() + } + mb.mu.Unlock() + storeFsWerr(err) + continue + } // If we opened the file close the fd. if didOpen { - fd.Close() - } - // Only clear sync flag on success. - if canClear { - mb.needSync = false + if err = fd.Close(); err != nil { + mb.mu.Unlock() + storeFsWerr(err) + continue + } } } mb.mu.Unlock() @@ -7216,6 +7818,7 @@ func (fs *fileStore) syncBlocks() { return } fs.mu.Lock() + defer fs.mu.Unlock() fs.setSyncTimer() if markDirty { fs.dirty++ @@ -7224,15 +7827,28 @@ func (fs *fileStore) syncBlocks() { // Sync state file if we are not running with sync always. if !fs.fcfg.SyncAlways { fn := filepath.Join(fs.fcfg.StoreDir, msgDir, streamStreamStateFile) + var fd *os.File + var err error <-dios - fd, _ := os.OpenFile(fn, os.O_RDWR, defaultFilePerms) + fd, err = os.OpenFile(fn, os.O_RDWR, defaultFilePerms) dios <- struct{}{} + if err != nil && !os.IsNotExist(err) { + fs.setWriteErr(err) + return + } if fd != nil { - fd.Sync() - fd.Close() + if err = fd.Sync(); err != nil { + // Close fd, but ignore its error since sync takes precedence. + _ = fd.Close() + fs.setWriteErr(err) + return + } + if err = fd.Close(); err != nil { + fs.setWriteErr(err) + return + } } } - fs.mu.Unlock() } // Select the message block where this message should be found. @@ -7535,16 +8151,13 @@ func (mb *msgBlock) writeAt(buf []byte, woff int64) (int, error) { // flushPendingMsgsLocked writes out any messages for this message block. // Lock should be held. func (mb *msgBlock) flushPendingMsgsLocked() (*LostStreamData, error) { - // Signals us that we need to rebuild filestore state. - var fsLostData *LostStreamData - var weakenCache bool if mb.cache == nil { mb.cache = mb.ecache.Value() weakenCache = mb.cache != nil } - if mb.cache == nil || mb.mfd == nil { - return nil, errNoCache + if mb.cache == nil || mb.mfd == nil || mb.werr != nil { + return nil, mb.werr } buf, err := mb.bytesPending() @@ -7585,9 +8198,16 @@ func (mb *msgBlock) flushPendingMsgsLocked() (*LostStreamData, error) { for lbb := lob; lbb > 0; lbb = len(buf) { n, err := mb.writeAt(buf, wp) if err != nil { - mb.dirtyCloseWithRemove(false) + // Ignore the errors here, we'll try reloading just to figure out and return the lost data if we can. + _ = mb.dirtyCloseWithRemove(false) ld, _, _ := mb.rebuildStateLocked() mb.werr = err + assert.Unreachable("Filestore msg block encountered flush error", map[string]any{ + "name": mb.fs.cfg.Name, + "mb.index": mb.index, + "err": err, + "stack": string(debug.Stack()), + }) return ld, err } // Update our write offset. @@ -7595,12 +8215,9 @@ func (mb *msgBlock) flushPendingMsgsLocked() (*LostStreamData, error) { buf = buf[n:] } - // Clear any error. - mb.werr = nil - // Cache may be gone. if mb.cache == nil || mb.mfd == nil { - return fsLostData, mb.werr + return nil, mb.werr } // Update write pointer. @@ -7608,7 +8225,16 @@ func (mb *msgBlock) flushPendingMsgsLocked() (*LostStreamData, error) { // Check if we are in sync always mode. if mb.syncAlways { - mb.mfd.Sync() + if err = mb.mfd.Sync(); err != nil { + mb.werr = err + assert.Unreachable("Filestore msg block encountered sync error", map[string]any{ + "name": mb.fs.cfg.Name, + "mb.index": mb.index, + "err": err, + "stack": string(debug.Stack()), + }) + return nil, err + } } else { mb.needSync = true } @@ -7618,7 +8244,7 @@ func (mb *msgBlock) flushPendingMsgsLocked() (*LostStreamData, error) { // not releasing the lock during I/O operation. Therefore this will always // return zero. if mb.pendingWriteSizeLocked() > 0 { - return fsLostData, mb.werr + return nil, mb.werr } // Check last access time. If we think the block still has read interest @@ -7629,13 +8255,13 @@ func (mb *msgBlock) flushPendingMsgsLocked() (*LostStreamData, error) { mb.ecache.Weaken() } mb.resetCacheExpireTimer(0) - return fsLostData, mb.werr + return nil, mb.werr } // If not, we'll just drop the cache altogether & recycle the buffer. mb.cache.nra = false - mb.expireCacheLocked() - return fsLostData, mb.werr + mb.tryExpireCacheLocked() + return nil, mb.werr } // Lock should be held. @@ -7785,7 +8411,7 @@ checkCache: if err != nil { mb.fs.warn("loadBlock error: %v", err) if err == errNoBlkData { - if ld, _, err := mb.rebuildStateLocked(); err != nil && ld != nil { + if ld, _, _ := mb.rebuildStateLocked(); ld != nil { // Rebuild fs state too. go mb.fs.rebuildState(ld) } @@ -8028,7 +8654,7 @@ func (mb *msgBlock) cacheLookupEx(seq uint64, sm *StoreMsg, doCopy bool) (*Store } if seq != fsm.seq { // See TestFileStoreInvalidIndexesRebuilt. - mb.tryForceExpireCacheLocked() + mb.clearCacheAndOffset() return nil, fmt.Errorf("sequence numbers for cache load did not match, %d vs %d", seq, fsm.seq) } @@ -8262,8 +8888,12 @@ func (fs *fileStore) loadLast(subj string, sm *StoreMsg) (lsm *StoreMsg, err err fs.mu.RLock() defer fs.mu.RUnlock() + return fs.loadLastLocked(subj, sm) +} - if fs.lmb == nil { +// Lock should be held. +func (fs *fileStore) loadLastLocked(subj string, sm *StoreMsg) (lsm *StoreMsg, err error) { + if fs.isClosed() || fs.lmb == nil { return nil, ErrStoreClosed } @@ -8305,7 +8935,7 @@ func (fs *fileStore) loadLast(subj string, sm *StoreMsg) (lsm *StoreMsg, err err continue } mb.mu.Lock() - if err := mb.ensurePerSubjectInfoLoaded(); err != nil { + if err = mb.ensurePerSubjectInfoLoaded(); err != nil { mb.mu.Unlock() return nil, err } @@ -8319,13 +8949,22 @@ func (fs *fileStore) loadLast(subj string, sm *StoreMsg) (lsm *StoreMsg, err err // Check if we need to recalculate. We only care about the last sequence. if ss.lastNeedsUpdate { // mb is already loaded into the cache so should be fast-ish. - mb.recalculateForSubj(subj, ss) + if err = mb.recalculateForSubj(subj, ss); err != nil { + if err != nil { + mb.mu.Unlock() + return nil, err + } + } } l = ss.Last } } if l == 0 { - _, _, l = mb.filteredPendingLocked(subj, wc, atomic.LoadUint64(&mb.first.seq)) + _, _, l, err = mb.filteredPendingLocked(subj, wc, atomic.LoadUint64(&mb.first.seq)) + if err != nil { + mb.mu.Unlock() + return nil, err + } } var didLoad bool if l > 0 { @@ -8368,9 +9007,12 @@ func (fs *fileStore) LoadNextMsgMulti(sl *gsl.SimpleSublist, start uint64, smp * if fs.isClosed() { return nil, 0, ErrStoreClosed } - if sl == nil { + if sl == nil || sl.MatchesFullWildcard() { return fs.LoadNextMsg(_EMPTY_, false, start, smp) } + if filter, ok := sl.MatchesSingleFilter(); ok { + return fs.LoadNextMsg(filter, subjectHasWildcard(filter), start, smp) + } fs.mu.RLock() defer fs.mu.RUnlock() @@ -8465,7 +9107,9 @@ func (fs *fileStore) LoadNextMsg(filter string, wc bool, start uint64, sm *Store // let's check the psim to see if we can skip ahead. if start <= fs.state.FirstSeq { var ss SimpleState - fs.numFilteredPendingNoLast(filter, &ss) + if err := fs.numFilteredPendingNoLast(filter, &ss); err != nil { + return nil, 0, err + } // Nothing available. if ss.Msgs == 0 { return nil, fs.state.LastSeq, ErrStoreEOF @@ -8517,58 +9161,186 @@ func (fs *fileStore) LoadNextMsg(filter string, wc bool, start uint64, sm *Store return nil, fs.state.LastSeq, ErrStoreEOF } -// Will load the next non-deleted msg starting at the start sequence and walking backwards. -func (fs *fileStore) LoadPrevMsg(start uint64, smp *StoreMsg) (sm *StoreMsg, err error) { +// Find the previous matching message. +// fs lock should be held. +func (mb *msgBlock) prevMatching(filter string, wc bool, start uint64, sm *StoreMsg) (*StoreMsg, bool, error) { + mb.mu.Lock() + var updateLLTS bool + defer func() { + if updateLLTS { + mb.llts = ats.AccessTime() + } + mb.finishedWithCache() + mb.mu.Unlock() + }() + + end, isAll := start, filter == _EMPTY_ || filter == fwcs + + var didLoad bool + if mb.fssNotLoaded() { + if err := mb.loadMsgsWithLock(); err != nil { + return nil, false, err + } + didLoad = true + } + mb.lsts = ats.AccessTime() + + if filter == _EMPTY_ { + filter = fwcs + wc = true + } + + if !isAll && mb.fss.Size() == 1 { + if !wc { + _, isAll = mb.fss.Find(stringToBytes(filter)) + } else { + mb.fss.Match(stringToBytes(filter), func(subject []byte, _ *SimpleState) { + isAll = true + }) + } + if !isAll { + return nil, didLoad, ErrStoreMsgNotFound + } + } + + lseq := atomic.LoadUint64(&mb.first.seq) + end = min(end, atomic.LoadUint64(&mb.last.seq)) + + var isMatch func(subj string) bool + if wc { + _tsa, _fsa := [32]string{}, [32]string{} + tsa, fsa := _tsa[:0], tokenizeSubjectIntoSlice(_fsa[:0], filter) + isMatch = func(subj string) bool { + tsa = tokenizeSubjectIntoSlice(tsa[:0], subj) + return isSubsetMatchTokenized(tsa, fsa) + } + } + + subjs := mb.fs.cfg.Subjects + doLinearScan := isAll || (wc && len(subjs) == 1 && subjs[0] == filter) + if !doLinearScan && wc && mb.cacheAlreadyLoaded() { + doLinearScan = mb.fss.Size()*4 > int(end-lseq) + } + + if !doLinearScan { + var found bool + var first, last uint64 + if bfilter := stringToBytes(filter); wc { + var ierr error + mb.fss.Match(bfilter, func(bsubj []byte, ss *SimpleState) { + if ierr != nil { + return + } + if ss.firstNeedsUpdate || ss.lastNeedsUpdate { + if ierr = mb.recalculateForSubj(bytesToString(bsubj), ss); ierr != nil { + return + } + } + if end < ss.First { + return + } + if !found { + found = true + first, last = ss.First, min(end, ss.Last) + return + } + first = min(first, ss.First) + last = max(last, min(end, ss.Last)) + }) + if ierr != nil { + return nil, false, ierr + } + } else if ss, _ := mb.fss.Find(bfilter); ss != nil { + if ss.firstNeedsUpdate || ss.lastNeedsUpdate { + if err := mb.recalculateForSubj(filter, ss); err != nil { + return nil, false, err + } + } + if end >= ss.First { + found = true + first, last = ss.First, min(end, ss.Last) + } + } + if !found || first > last { + return nil, didLoad, ErrStoreMsgNotFound + } + lseq, end = max(lseq, first), last + } + + if mb.cacheNotLoaded() { + if err := mb.loadMsgsWithLock(); err != nil { + return nil, false, err + } + didLoad = true + } + + if sm == nil { + sm = new(StoreMsg) + } + + for seq := end; seq >= lseq; seq-- { + if mb.dmap.Exists(seq) { + updateLLTS = true + continue + } + llseq := mb.llseq + fsm, err := mb.cacheLookup(seq, sm) + if err != nil { + if err == errPartialCache || err == errNoCache { + return nil, false, err + } + continue + } + updateLLTS = false + expireOk := seq == lseq && mb.llseq != llseq && mb.llseq == seq + if isAll { + return fsm, expireOk, nil + } + if wc && isMatch(sm.subj) { + return fsm, expireOk, nil + } else if !wc && fsm.subj == filter { + return fsm, expireOk, nil + } + mb.llseq = llseq + } + + return nil, didLoad, ErrStoreMsgNotFound +} + +// Will load the previous message matching the filter subject, starting at the start sequence and walking backwards. +func (fs *fileStore) LoadPrevMsg(filter string, wc bool, start uint64, smp *StoreMsg) (sm *StoreMsg, skip uint64, err error) { if fs.isClosed() { - return nil, ErrStoreClosed + return nil, 0, ErrStoreClosed } fs.mu.RLock() defer fs.mu.RUnlock() if fs.state.Msgs == 0 || start < fs.state.FirstSeq { - return nil, ErrStoreEOF + return nil, fs.state.FirstSeq, ErrStoreEOF } if start > fs.state.LastSeq { start = fs.state.LastSeq } - if smp == nil { - smp = new(StoreMsg) - } if bi, _ := fs.selectMsgBlockWithIndex(start); bi >= 0 { for i := bi; i >= 0; i-- { mb := fs.blks[i] - mb.mu.Lock() - // Need messages loaded from here on out. - if mb.cacheNotLoaded() { - if err := mb.loadMsgsWithLock(); err != nil { - mb.mu.Unlock() - return nil, err + if sm, expireOk, err := mb.prevMatching(filter, wc, start, smp); err == nil { + if expireOk { + mb.tryForceExpireCache() } + return sm, sm.seq, nil + } else if err != ErrStoreMsgNotFound { + return nil, 0, err + } else if expireOk { + mb.tryForceExpireCache() } - - lseq, fseq := atomic.LoadUint64(&mb.last.seq), atomic.LoadUint64(&mb.first.seq) - if start > lseq { - start = lseq - } - for seq := start; seq >= fseq; seq-- { - if mb.dmap.Exists(seq) { - continue - } - if sm, err := mb.cacheLookup(seq, smp); err == nil { - mb.finishedWithCache() - mb.mu.Unlock() - return sm, nil - } - } - mb.finishedWithCache() - mb.mu.Unlock() } } - return nil, ErrStoreEOF + return nil, fs.state.FirstSeq, ErrStoreEOF } // LoadPrevMsgMulti will find the previous message matching any entry in the sublist. @@ -8577,9 +9349,11 @@ func (fs *fileStore) LoadPrevMsgMulti(sl *gsl.SimpleSublist, start uint64, smp * return nil, 0, ErrStoreClosed } - if sl == nil { - sm, err = fs.LoadPrevMsg(start, smp) - return + if sl == nil || sl.MatchesFullWildcard() { + return fs.LoadPrevMsg(_EMPTY_, false, start, smp) + } + if filter, ok := sl.MatchesSingleFilter(); ok { + return fs.LoadPrevMsg(filter, subjectHasWildcard(filter), start, smp) } fs.mu.RLock() defer fs.mu.RUnlock() @@ -8953,6 +9727,15 @@ func (fs *fileStore) PurgeEx(subject string, sequence, keep uint64) (purged uint } } + // Persist any write errors. + defer func() { + if err != nil { + fs.mu.Lock() + fs.setWriteErr(err) + fs.mu.Unlock() + } + }() + // Make sure to not leave subject if empty and we reach this spot. if subject == _EMPTY_ { subject = fwcs @@ -8965,9 +9748,9 @@ func (fs *fileStore) PurgeEx(subject string, sequence, keep uint64) (purged uint // If we have a "keep" designation need to get full filtered state so we know how many to purge. var maxp uint64 if keep > 0 { - ss := fs.FilteredState(1, subject) - if keep >= ss.Msgs { - return 0, nil + ss, err := fs.FilteredState(1, subject) + if err != nil || keep >= ss.Msgs { + return 0, err } maxp = ss.Msgs - keep } @@ -8976,17 +9759,65 @@ func (fs *fileStore) PurgeEx(subject string, sequence, keep uint64) (purged uint var tombs []msgId var lowSeq uint64 + if fs.isClosed() { + return purged, ErrStoreClosed + } fs.mu.Lock() + // Always return previous write errors. + if err := fs.werr; err != nil { + fs.mu.Unlock() + return purged, err + } + if len(fs.blks) == 0 || fs.lmb == nil { + fs.mu.Unlock() + return purged, nil + } + + var start, stop uint32 + + // If literal subject check for presence. + if wc { + start = fs.lmb.index + fs.psim.Match(stringToBytes(subject), func(_ []byte, psi *psi) { + // Keep track of start and stop indexes for this subject. + if psi.fblk < start { + start = psi.fblk + } + if psi.lblk > stop { + stop = psi.lblk + } + }) + // None matched. + if stop == 0 { + fs.mu.Unlock() + return purged, nil + } + } else if info, ok := fs.psim.Find(stringToBytes(subject)); ok { + start, stop = info.fblk, info.lblk + } else { + fs.mu.Unlock() + return purged, nil + } + // We may remove blocks as we purge, so don't range directly on fs.blks // otherwise we may jump over some (see https://github.com/nats-io/nats-server/issues/3528) for i := 0; i < len(fs.blks); i++ { mb := fs.blks[i] + // Skip if not within our range for the purge subject. + if mb.index < start || mb.index > stop { + continue + } mb.mu.Lock() // If we do not have our fss, try to expire the cache if we have no items in this block. shouldExpire := mb.fssNotLoaded() - t, f, l := mb.filteredPendingLocked(subject, wc, atomic.LoadUint64(&mb.first.seq)) + t, f, l, err := mb.filteredPendingLocked(subject, wc, atomic.LoadUint64(&mb.first.seq)) + if err != nil { + mb.mu.Unlock() + fs.mu.Unlock() + return purged, err + } if t == 0 { // Expire if we were responsible for loading. if shouldExpire { @@ -9035,7 +9866,12 @@ func (fs *fileStore) PurgeEx(subject string, sequence, keep uint64) (purged uint bytes += rl } // PSIM and FSS updates. - nr := mb.removeSeqPerSubject(sm.subj, seq) + nr, err := mb.removeSeqPerSubject(sm.subj, seq) + if err != nil { + mb.mu.Unlock() + fs.mu.Unlock() + return purged, err + } nrg = fs.removePerSubject(sm.subj) // Track tombstones we need to write. @@ -9050,7 +9886,11 @@ func (fs *fileStore) PurgeEx(subject string, sequence, keep uint64) (purged uint if mb.isEmpty() { // Since we are removing this block don't need to write tombstones. tombs = tombs[:te] - fs.removeMsgBlock(mb) + if err = fs.removeMsgBlock(mb); err != nil { + mb.mu.Unlock() + fs.mu.Unlock() + return 0, err + } i-- // keep flag set, if set previously firstSeqNeedsUpdate = firstSeqNeedsUpdate || seq == fs.state.FirstSeq @@ -9097,7 +9937,10 @@ func (fs *fileStore) PurgeEx(subject string, sequence, keep uint64) (purged uint } } if firstSeqNeedsUpdate { - fs.selectNextFirst() + if err = fs.selectNextFirst(); err != nil { + fs.mu.Unlock() + return purged, err + } } // Update the last purgeEx call time. @@ -9107,14 +9950,17 @@ func (fs *fileStore) PurgeEx(subject string, sequence, keep uint64) (purged uint // When writing multiple tombstones we will flush at the end. if len(tombs) > 0 { for _, tomb := range tombs { - if err := fs.writeTombstoneNoFlush(tomb.seq, tomb.ts); err != nil { + if err = fs.writeTombstoneNoFlush(tomb.seq, tomb.ts); err != nil { fs.mu.Unlock() return purged, err } } // Flush any pending. If we change blocks the newMsgBlockForWrite() will flush any pending for us. if lmb := fs.lmb; lmb != nil { - lmb.flushPendingMsgs() + if err = lmb.flushPendingMsgs(); err != nil { + fs.mu.Unlock() + return purged, err + } } } @@ -9140,14 +9986,29 @@ func (fs *fileStore) Purge() (uint64, error) { return fs.purge(0) } -func (fs *fileStore) purge(fseq uint64) (uint64, error) { +func (fs *fileStore) purge(fseq uint64) (purged uint64, rerr error) { if fs.isClosed() { return 0, ErrStoreClosed } + // Persist any write errors. + defer func() { + if rerr != nil { + fs.mu.Lock() + fs.setWriteErr(rerr) + fs.mu.Unlock() + } + }() + fs.mu.Lock() - purged := fs.state.Msgs + // Always return previous write errors. + if err := fs.werr; err != nil { + fs.mu.Unlock() + return 0, err + } + + purged = fs.state.Msgs rbytes := int64(fs.state.Bytes) fs.state.FirstSeq = fs.state.LastSeq + 1 @@ -9160,54 +10021,18 @@ func (fs *fileStore) purge(fseq uint64) (uint64, error) { mb.dirtyClose() } - fs.blks = nil - fs.lmb = nil - fs.bim = make(map[uint32]*msgBlock) - // Clear any per subject tracking. - fs.psim, fs.tsl = fs.psim.Empty(), 0 - fs.sdm.empty() - // Mark dirty. - fs.dirty++ - - // Move the msgs directory out of the way, will delete out of band. - // FIXME(dlc) - These can error and we need to change api above to propagate? - mdir := filepath.Join(fs.fcfg.StoreDir, msgDir) - pdir := filepath.Join(fs.fcfg.StoreDir, purgeDir) - // If purge directory still exists then we need to wait - // in place and remove since rename would fail. - if _, err := os.Stat(pdir); err == nil { - <-dios - os.RemoveAll(pdir) - dios <- struct{}{} + // Check if we need to set the first seq to a new number. + if fseq > fs.state.FirstSeq { + fs.state.FirstSeq = fseq + fs.state.LastSeq = fseq - 1 } - <-dios - os.Rename(mdir, pdir) - dios <- struct{}{} - - go func() { - <-dios - os.RemoveAll(pdir) - dios <- struct{}{} - }() - - // Create new one. - <-dios - os.MkdirAll(mdir, defaultDirPerms) - dios <- struct{}{} - // Make sure we have a lmb to write to. if _, err := fs.newMsgBlockForWrite(); err != nil { fs.mu.Unlock() return purged, err } - // Check if we need to set the first seq to a new number. - if fseq > fs.state.FirstSeq { - fs.state.FirstSeq = fseq - fs.state.LastSeq = fseq - 1 - } - lmb := fs.lmb atomic.StoreUint64(&lmb.first.seq, fs.state.FirstSeq) atomic.StoreUint64(&lmb.last.seq, fs.state.LastSeq) @@ -9216,7 +10041,107 @@ func (fs *fileStore) purge(fseq uint64) (uint64, error) { if lseq := atomic.LoadUint64(&lmb.last.seq); lseq > 0 { // Leave a tombstone so we can remember our starting sequence in case // full state becomes corrupted. - fs.writeTombstone(lseq, lmb.last.ts) + if err := fs.writeTombstone(lseq, lmb.last.ts); err != nil { + fs.mu.Unlock() + return purged, err + } + } + // Close FDs since we'll move the file. We re-enable the FD after the purge is complete. + if err := lmb.flushPendingMsgs(); err != nil { + fs.mu.Unlock() + return purged, err + } + if err := lmb.closeFDs(); err != nil { + fs.mu.Unlock() + return purged, err + } + + fs.blks = nil + fs.lmb = nil + fs.bim = make(map[uint32]*msgBlock) + // Clear any per subject tracking. + fs.psim, fs.tsl = fs.psim.Empty(), 0 + fs.sdm.empty() + // Mark dirty. + fs.dirty++ + fs.addMsgBlock(lmb) + + // Move the msgs directory out of the way, will delete out of band. + mdir := filepath.Join(fs.fcfg.StoreDir, msgDir) + ndir := filepath.Join(fs.fcfg.StoreDir, newMsgDir) + pdir := filepath.Join(fs.fcfg.StoreDir, purgeDir) + <-dios + // If purge directory still exists then we need to wait + // in place and remove since rename would fail. + if _, err := os.Stat(ndir); err == nil { + if err = os.RemoveAll(ndir); err != nil { + dios <- struct{}{} + fs.mu.Unlock() + return purged, err + } + } else if !os.IsNotExist(err) { + dios <- struct{}{} + fs.mu.Unlock() + return purged, err + } + if _, err := os.Stat(pdir); err == nil { + if err = os.RemoveAll(pdir); err != nil { + dios <- struct{}{} + fs.mu.Unlock() + return purged, err + } + } else if !os.IsNotExist(err) { + dios <- struct{}{} + fs.mu.Unlock() + return purged, err + } + + // Create directory to move the new tombstone to. + if err := os.MkdirAll(ndir, defaultDirPerms); err != nil { + dios <- struct{}{} + fs.mu.Unlock() + return purged, err + } + // Move out the block containing the tombstone. Also move the key file if encrypted. + // The block file itself MUST be moved last to ensure we can assume the prior renames + // were successful during recovery. + for _, mbf := range []string{fmt.Sprintf(keyScan, lmb.index), fmt.Sprintf(blkScan, lmb.index)} { + b := filepath.Join(mdir, mbf) + a := filepath.Join(ndir, mbf) + if err := os.Rename(b, a); err != nil && !os.IsNotExist(err) { + dios <- struct{}{} + fs.mu.Unlock() + return purged, err + } + } + // Purge all remaining messages. + if err := os.Rename(mdir, pdir); err != nil { + dios <- struct{}{} + fs.mu.Unlock() + return purged, err + } + // Rename the directory back to be left only with the tombstone. + if err := os.Rename(ndir, mdir); err != nil { + dios <- struct{}{} + fs.mu.Unlock() + return purged, err + } + dios <- struct{}{} + + // Remove the purged messages directory asynchronously. + go func() { + <-dios + _ = os.RemoveAll(pdir) + dios <- struct{}{} + }() + + // Re-enable writing for the lmb. + lmb.mu.Lock() + err := lmb.enableForWriting(fs.fip) + lmb.mu.Unlock() + if err != nil { + fs.mu.Unlock() + return purged, err } cb := fs.scb @@ -9234,6 +10159,51 @@ func (fs *fileStore) purge(fseq uint64) (uint64, error) { return purged, nil } +// Lock and dios should be held. +func (fs *fileStore) recoverPartialPurge() error { + mdir := filepath.Join(fs.fcfg.StoreDir, msgDir) + ndir := filepath.Join(fs.fcfg.StoreDir, newMsgDir) + if entries, err := os.ReadDir(ndir); err != nil && !os.IsNotExist(err) { + return err + } else if err == nil { + hasBlk := slices.ContainsFunc(entries, func(e os.DirEntry) bool { + return strings.HasSuffix(e.Name(), blkSuffix) + }) + if hasBlk { + // We have a tombstone, we can purge the old messages. + if err = os.RemoveAll(mdir); err != nil { + return err + } + if err = os.Rename(ndir, mdir); err != nil { + return err + } + } else { + // No .blk means the purge did not complete, so clear + // any progress made by the partial purge. + for _, entry := range entries { + var index uint32 + if n, err := fmt.Sscanf(entry.Name(), keyScan, &index); err != nil || n != 1 { + continue + } + // Found a key file, remove the corresponding .blk, if any. + // Recovery may otherwise wrongly conclude that the .blk is + // is plaintext, and consider it corrupt when trying to open it. + err := os.Remove(filepath.Join(mdir, fmt.Sprintf(blkScan, index))) + if err != nil && !os.IsNotExist(err) { + return err + } + } + _ = os.RemoveAll(ndir) + return nil + } + } + pdir := filepath.Join(fs.fcfg.StoreDir, purgeDir) + if _, err := os.Stat(pdir); err == nil { + _ = os.RemoveAll(pdir) + } + return nil +} + // Compact will remove all messages from this store up to // but not including the seq parameter. // Will return the number of purged messages. @@ -9241,14 +10211,20 @@ func (fs *fileStore) Compact(seq uint64) (uint64, error) { return fs.compact(seq) } -func (fs *fileStore) compact(seq uint64) (uint64, error) { +func (fs *fileStore) compact(seq uint64) (purged uint64, rerr error) { + if fs.isClosed() { + return 0, ErrStoreClosed + } if seq == 0 { return fs.purge(seq) } - var purged, bytes uint64 - fs.mu.Lock() + // Always return previous write errors. + if err := fs.werr; err != nil { + fs.mu.Unlock() + return 0, err + } // Same as purge all. if lseq := fs.state.LastSeq; seq > lseq { fs.mu.Unlock() @@ -9266,6 +10242,17 @@ func (fs *fileStore) compact(seq uint64) (uint64, error) { return 0, nil } + // Persist any write errors. + defer func() { + if rerr != nil { + fs.mu.Lock() + fs.setWriteErr(rerr) + fs.mu.Unlock() + } + }() + + var bytes uint64 + // All msgblocks up to this one can be thrown away. var deleted int for _, mb := range fs.blks { @@ -9276,7 +10263,11 @@ func (fs *fileStore) compact(seq uint64) (uint64, error) { purged += mb.msgs bytes += mb.bytes // Make sure we do subject cleanup as well. - mb.ensurePerSubjectInfoLoaded() + if err := mb.ensurePerSubjectInfoLoaded(); err != nil { + mb.mu.Unlock() + fs.mu.Unlock() + return 0, err + } mb.fss.IterOrdered(func(bsubj []byte, ss *SimpleState) bool { subj := bytesToString(bsubj) for i := uint64(0); i < ss.Msgs; i++ { @@ -9285,8 +10276,12 @@ func (fs *fileStore) compact(seq uint64) (uint64, error) { return true }) // Now close. - mb.dirtyCloseWithRemove(true) + err := mb.dirtyCloseWithRemove(true) mb.mu.Unlock() + if err != nil { + fs.mu.Unlock() + return purged, err + } deleted++ } @@ -9304,7 +10299,9 @@ func (fs *fileStore) compact(seq uint64) (uint64, error) { // Make sure we have the messages loaded. if smb.cacheNotLoaded() { if err = smb.loadMsgsWithLock(); err != nil { - goto SKIP + smb.mu.Unlock() + fs.mu.Unlock() + return purged, err } defer func() { // The lock is released once we get here, so need to re-acquire. @@ -9332,7 +10329,11 @@ func (fs *fileStore) compact(seq uint64) (uint64, error) { purged++ } // Update fss - smb.removeSeqPerSubject(sm.subj, mseq) + if _, err := smb.removeSeqPerSubject(sm.subj, mseq); err != nil { + smb.mu.Unlock() + fs.mu.Unlock() + return purged, err + } fs.removePerSubject(sm.subj) tombs = append(tombs, msgId{sm.seq, sm.ts}) } @@ -9342,7 +10343,11 @@ func (fs *fileStore) compact(seq uint64) (uint64, error) { if isEmpty := smb.msgs == 0; isEmpty { // Only remove if not the last block. if smb != fs.lmb { - smb.dirtyCloseWithRemove(true) + if err = smb.dirtyCloseWithRemove(true); err != nil { + smb.mu.Unlock() + fs.mu.Unlock() + return purged, err + } deleted++ } else { // Make sure to sync changes. @@ -9372,7 +10377,11 @@ func (fs *fileStore) compact(seq uint64) (uint64, error) { if smb.rbytes > compactMinimum && smb.bytes*2 < smb.rbytes { var moff uint32 moff, _, _, err = smb.slotInfo(int(atomic.LoadUint64(&smb.first.seq) - smb.cache.fseq)) - if err != nil || moff >= uint32(len(smb.cache.buf)) { + if err != nil { + smb.mu.Unlock() + fs.mu.Unlock() + return purged, err + } else if moff >= uint32(len(smb.cache.buf)) { goto SKIP } buf := smb.cache.buf[moff:] @@ -9385,7 +10394,9 @@ func (fs *fileStore) compact(seq uint64) (uint64, error) { // Recreate to reset counter. bek, err := genBlockEncryptionKey(smb.fs.fcfg.Cipher, smb.seed, smb.nonce) if err != nil { - goto SKIP + smb.mu.Unlock() + fs.mu.Unlock() + return purged, err } // For future writes make sure to set smb.bek to keep counter correct. smb.bek = bek @@ -9394,21 +10405,27 @@ func (fs *fileStore) compact(seq uint64) (uint64, error) { // Recompress if necessary (smb.cmp contains the algorithm used when // the block was loaded from disk, or defaults to NoCompression if not) if nbuf, err = smb.cmp.Compress(nbuf); err != nil { - goto SKIP + smb.mu.Unlock() + fs.mu.Unlock() + return purged, err } // We will write to a new file and mv/rename it in case of failure. mfn := filepath.Join(smb.fs.fcfg.StoreDir, msgDir, fmt.Sprintf(newScan, smb.index)) <-dios - err := os.WriteFile(mfn, nbuf, defaultFilePerms) + err = os.WriteFile(mfn, nbuf, defaultFilePerms) dios <- struct{}{} if err != nil { - os.Remove(mfn) - goto SKIP + _ = os.Remove(mfn) + smb.mu.Unlock() + fs.mu.Unlock() + return purged, err } - if err := os.Rename(mfn, smb.mfn); err != nil { - os.Remove(mfn) - goto SKIP + if err = os.Rename(mfn, smb.mfn); err != nil { + _ = os.Remove(mfn) + smb.mu.Unlock() + fs.mu.Unlock() + return purged, err } // Make sure to remove fss state. @@ -9427,14 +10444,17 @@ SKIP: // When writing multiple tombstones we will flush at the end. if len(tombs) > 0 { for _, tomb := range tombs { - if err := fs.writeTombstoneNoFlush(tomb.seq, tomb.ts); err != nil { + if err = fs.writeTombstoneNoFlush(tomb.seq, tomb.ts); err != nil { fs.mu.Unlock() return purged, err } } // Flush any pending. If we change blocks the newMsgBlockForWrite() will flush any pending for us. if lmb := fs.lmb; lmb != nil { - lmb.flushPendingMsgs() + if err = lmb.flushPendingMsgs(); err != nil { + fs.mu.Unlock() + return purged, err + } } } @@ -9503,8 +10523,12 @@ func (fs *fileStore) reset() error { mb.mu.Lock() purged += mb.msgs bytes += mb.bytes - mb.dirtyCloseWithRemove(true) + err := mb.dirtyCloseWithRemove(true) mb.mu.Unlock() + if err != nil { + fs.mu.Unlock() + return err + } } // Reset @@ -9579,8 +10603,64 @@ func (mb *msgBlock) tombsLocked() []msgId { return tombs } +// fs lock should be held. +func (mb *msgBlock) numPriorTombs() int { + mb.mu.Lock() + defer mb.mu.Unlock() + return mb.numPriorTombsLocked() +} + +// Return number of tombstones for messages prior to this msgBlock. +// Both locks should be held. +// Write lock should be held for block. +func (mb *msgBlock) numPriorTombsLocked() int { + if mb.cacheNotLoaded() { + if err := mb.loadMsgsWithLock(); err != nil { + return 0 + } + } + defer mb.finishedWithCache() + + var fseq uint64 + var tombs int + var le = binary.LittleEndian + buf := mb.cache.buf + + for index, lbuf := uint32(0), uint32(len(buf)); index < lbuf; { + if index+msgHdrSize > lbuf { + return tombs + } + hdr := buf[index : index+msgHdrSize] + rl, seq := le.Uint32(hdr[0:]), le.Uint64(hdr[4:]) + // Clear any headers bit that could be set. + rl &^= hbit + // Check for tombstones. + if seq&tbit != 0 { + seq = seq &^ tbit + // Tombstones below the global first seq are irrelevant. + // And we only count tombstones below this block's first seq. + if seq >= mb.fs.state.FirstSeq && (fseq == 0 || seq < fseq) { + tombs++ + } + index += rl + continue + } + if seq == 0 || seq&ebit != 0 { + index += rl + continue + } + // Advance to next record. + index += rl + if fseq == 0 { + fseq = seq + } + } + + return tombs +} + // Truncate will truncate a stream store up to seq. Sequence needs to be valid. -func (fs *fileStore) Truncate(seq uint64) error { +func (fs *fileStore) Truncate(seq uint64) (rerr error) { if fs.isClosed() { return ErrStoreClosed } @@ -9591,15 +10671,34 @@ func (fs *fileStore) Truncate(seq uint64) error { } fs.mu.Lock() + // Always return previous write errors. + if err := fs.werr; err != nil { + fs.mu.Unlock() + return err + } + + // Persist any write errors. + defer func() { + if rerr != nil { + fs.mu.Lock() + fs.setWriteErr(rerr) + fs.mu.Unlock() + } + }() // Any existing state file will no longer be applicable. We will force write a new one // at the end, after we release the lock. os.Remove(filepath.Join(fs.fcfg.StoreDir, msgDir, streamStreamStateFile)) + var err error var lsm *StoreMsg smb := fs.selectMsgBlock(seq) if smb != nil { - lsm, _, _ = smb.fetchMsgNoCopy(seq, nil) + lsm, _, err = smb.fetchMsgNoCopy(seq, nil) + if err != nil && err != ErrStoreMsgNotFound && err != errDeletedMsg { + fs.mu.Unlock() + return err + } } // Reset last so new block doesn't contain truncated sequences/timestamps. @@ -9632,7 +10731,10 @@ func (fs *fileStore) Truncate(seq uint64) error { // If the selected block is not found or the message was deleted, we'll need to write a tombstone // at the truncated sequence so we don't roll backward on our last sequence and timestamp. if lsm == nil || removeSmb { - fs.writeTombstone(seq, lastTime) + if err = fs.writeTombstone(seq, lastTime); err != nil { + fs.mu.Unlock() + return err + } } var purged, bytes uint64 @@ -9660,13 +10762,20 @@ func (fs *fileStore) Truncate(seq uint64) error { mb.mu.Unlock() for _, tomb := range tombs { if tomb.seq < seq { - fs.writeTombstone(tomb.seq, tomb.ts) + if err = fs.writeTombstone(tomb.seq, tomb.ts); err != nil { + fs.mu.Unlock() + return err + } } } mb.mu.Lock() } - fs.forceRemoveMsgBlock(mb) + err = fs.forceRemoveMsgBlock(mb) mb.mu.Unlock() + if err != nil { + fs.mu.Unlock() + return err + } } hasWrittenTombstones := len(tmb.tombs()) > 0 @@ -9682,13 +10791,20 @@ func (fs *fileStore) Truncate(seq uint64) error { smb.mu.Unlock() for _, tomb := range tombs { if tomb.seq < seq { - fs.writeTombstone(tomb.seq, tomb.ts) + if err = fs.writeTombstone(tomb.seq, tomb.ts); err != nil { + fs.mu.Unlock() + return err + } } } smb.mu.Lock() } - fs.forceRemoveMsgBlock(smb) + err = fs.forceRemoveMsgBlock(smb) smb.mu.Unlock() + if err != nil { + fs.mu.Unlock() + return err + } goto SKIP } @@ -9729,8 +10845,12 @@ SKIP: if !hasWrittenTombstones { fs.lmb = smb tmb.mu.Lock() - fs.forceRemoveMsgBlock(tmb) + err = fs.forceRemoveMsgBlock(tmb) tmb.mu.Unlock() + if err != nil { + fs.mu.Unlock() + return err + } } // Reset last. @@ -9747,7 +10867,10 @@ SKIP: fs.state.Bytes -= bytes // Reset our subject lookup info. - fs.resetGlobalPerSubjectInfo() + if err = fs.resetGlobalPerSubjectInfo(); err != nil { + fs.mu.Unlock() + return err + } fs.dirty++ @@ -9807,38 +10930,59 @@ func (fs *fileStore) removeMsgBlockFromList(mb *msgBlock) { // Removes the msgBlock // Both locks should be held. -func (fs *fileStore) removeMsgBlock(mb *msgBlock) { +func (fs *fileStore) removeMsgBlock(mb *msgBlock) error { // Check for us being last message block lseq, lts := atomic.LoadUint64(&mb.last.seq), mb.last.ts if mb == fs.lmb { // Creating a new message write block requires that the lmb lock is not held. mb.mu.Unlock() // Write the tombstone to remember since this was last block. - if lmb, _ := fs.newMsgBlockForWrite(); lmb != nil { - fs.writeTombstone(lseq, lts) + if lmb, err := fs.newMsgBlockForWrite(); err != nil || lmb == nil { + if err != nil { + err = errors.New("lmb missing") + } + // Re-acquire mb lock + mb.mu.Lock() + return err + } else if err = fs.writeTombstone(lseq, lts); err != nil { + // Re-acquire mb lock + mb.mu.Lock() + return err } mb.mu.Lock() } else if lseq == fs.state.LastSeq { // Need to write a tombstone for the last sequence if we're removing the block containing it. - fs.writeTombstone(lseq, lts) + if err := fs.writeTombstone(lseq, lts); err != nil { + return err + } } // Only delete message block after (potentially) writing a tombstone. - fs.forceRemoveMsgBlock(mb) + // But only if it doesn't contain any tombstones for prior blocks. + if mb.numPriorTombsLocked() > 0 { + return nil + } + return fs.forceRemoveMsgBlock(mb) } // Removes the msgBlock, without writing tombstones to ensure the last sequence is preserved. // Both locks should be held. -func (fs *fileStore) forceRemoveMsgBlock(mb *msgBlock) { - mb.dirtyCloseWithRemove(true) +func (fs *fileStore) forceRemoveMsgBlock(mb *msgBlock) error { + if err := mb.dirtyCloseWithRemove(true); err != nil { + return err + } fs.removeMsgBlockFromList(mb) + return nil } // Purges and removes the msgBlock from the store. // Lock should be held. -func (fs *fileStore) purgeMsgBlock(mb *msgBlock) { +func (fs *fileStore) purgeMsgBlock(mb *msgBlock) error { mb.mu.Lock() // Adjust per-subject tracking if present. - if err := mb.ensurePerSubjectInfoLoaded(); err == nil && mb.fss != nil { + if err := mb.ensurePerSubjectInfoLoaded(); err != nil { + mb.mu.Unlock() + return err + } else if mb.fss != nil { mb.fss.IterFast(func(bsubj []byte, ss *SimpleState) bool { subj := bytesToString(bsubj) for range ss.Msgs { @@ -9849,21 +10993,25 @@ func (fs *fileStore) purgeMsgBlock(mb *msgBlock) { } // Clean up scheduled message metadata if we know this block contained any. if fs.scheduling != nil && mb.schedules > 0 { - cacheLoaded := !mb.cacheNotLoaded() - if !cacheLoaded { - cacheLoaded = mb.loadMsgsWithLock() == nil + if mb.cacheNotLoaded() { + if err := mb.loadMsgsWithLock(); err != nil { + mb.mu.Unlock() + return err + } } - if cacheLoaded { - var smv StoreMsg - fseq, lseq := atomic.LoadUint64(&mb.first.seq), atomic.LoadUint64(&mb.last.seq) - for seq := fseq; seq <= lseq; seq++ { - sm, err := mb.cacheLookupNoCopy(seq, &smv) - if err != nil || sm == nil { - continue - } - if schedule, ok := getMessageSchedule(sm.hdr); ok && !schedule.IsZero() { - fs.scheduling.remove(seq) - } + var smv StoreMsg + fseq, lseq := atomic.LoadUint64(&mb.first.seq), atomic.LoadUint64(&mb.last.seq) + for seq := fseq; seq <= lseq; seq++ { + sm, err := mb.cacheLookupNoCopy(seq, &smv) + if err != nil && err != errDeletedMsg { + mb.mu.Unlock() + return err + } + if sm == nil { + continue + } + if schedule, apiErr := getMessageSchedule(sm.hdr); apiErr == nil && !schedule.IsZero() { + fs.scheduling.remove(seq) } } } @@ -9877,11 +11025,16 @@ func (fs *fileStore) purgeMsgBlock(mb *msgBlock) { } fs.state.Msgs -= msgs fs.state.Bytes -= bytes - fs.removeMsgBlock(mb) + if err := fs.removeMsgBlock(mb); err != nil { + mb.mu.Unlock() + return err + } mb.tryForceExpireCacheLocked() mb.finishedWithCache() mb.mu.Unlock() - fs.selectNextFirst() + if err := fs.selectNextFirst(); err != nil { + return err + } if cb := fs.scb; cb != nil { // If we have a callback registered, we need to release lock regardless since consumers will recalculate pending. @@ -9890,6 +11043,7 @@ func (fs *fileStore) purgeMsgBlock(mb *msgBlock) { cb(-int64(msgs), -int64(bytes), 0, _EMPTY_) fs.mu.Lock() } + return nil } // Called by purge to simply get rid of the cache and close our fds. @@ -9917,23 +11071,23 @@ func (mb *msgBlock) dirtyCloseWithRemove(remove bool) error { close(mb.qch) mb.qch = nil } - if mb.mfd != nil { - mb.mfd.Close() + if fd := mb.mfd; fd != nil { mb.mfd = nil + if err := fd.Close(); err != nil && !os.IsNotExist(err) { + return err + } } if remove { // Clear any tracking by subject if we are removing. mb.fss = nil if mb.mfn != _EMPTY_ { - err := os.Remove(mb.mfn) - if isPermissionError(err) { + if err := os.Remove(mb.mfn); err != nil && !os.IsNotExist(err) { return err } mb.mfn = _EMPTY_ } if mb.kfn != _EMPTY_ { - err := os.Remove(mb.kfn) - if isPermissionError(err) { + if err := os.Remove(mb.kfn); err != nil && !os.IsNotExist(err) { return err } } @@ -9943,21 +11097,23 @@ func (mb *msgBlock) dirtyCloseWithRemove(remove bool) error { // Remove a seq from the fss and select new first. // Lock should be held. -func (mb *msgBlock) removeSeqPerSubject(subj string, seq uint64) uint64 { - mb.ensurePerSubjectInfoLoaded() +func (mb *msgBlock) removeSeqPerSubject(subj string, seq uint64) (uint64, error) { + if err := mb.ensurePerSubjectInfoLoaded(); err != nil { + return 0, err + } if mb.fss == nil { - return 0 + return 0, nil } bsubj := stringToBytes(subj) ss, ok := mb.fss.Find(bsubj) if !ok || ss == nil { - return 0 + return 0, nil } mb.fs.sdm.removeSeqAndSubject(seq, subj) if ss.Msgs == 1 { mb.fss.Delete(bsubj) - return 0 + return 0, nil } ss.Msgs-- @@ -9967,12 +11123,12 @@ func (mb *msgBlock) removeSeqPerSubject(subj string, seq uint64) uint64 { if !ss.lastNeedsUpdate && seq != ss.Last { ss.First = ss.Last ss.firstNeedsUpdate = false - return 1 + return 1, nil } if !ss.firstNeedsUpdate && seq != ss.First { ss.Last = ss.First ss.lastNeedsUpdate = false - return 1 + return 1, nil } } @@ -9980,16 +11136,16 @@ func (mb *msgBlock) removeSeqPerSubject(subj string, seq uint64) uint64 { ss.firstNeedsUpdate = seq == ss.First || ss.firstNeedsUpdate ss.lastNeedsUpdate = seq == ss.Last || ss.lastNeedsUpdate - return ss.Msgs + return ss.Msgs, nil } // Will recalculate the first and/or last sequence for this subject in this block. // Will avoid slower path message lookups and scan the cache directly instead. -func (mb *msgBlock) recalculateForSubj(subj string, ss *SimpleState) { +func (mb *msgBlock) recalculateForSubj(subj string, ss *SimpleState) error { // Need to make sure messages are loaded. if mb.cacheNotLoaded() { if err := mb.loadMsgsWithLock(); err != nil { - return + return err } defer mb.finishedWithCache() } @@ -10002,7 +11158,7 @@ func (mb *msgBlock) recalculateForSubj(subj string, ss *SimpleState) { ss.First = ss.Last ss.firstNeedsUpdate = false ss.lastNeedsUpdate = false - return + return nil } endSlot := int(ss.Last - mb.cache.fseq) @@ -10010,7 +11166,7 @@ func (mb *msgBlock) recalculateForSubj(subj string, ss *SimpleState) { endSlot = 0 } if endSlot >= len(mb.cache.idx) || startSlot > endSlot { - return + return nil } var le = binary.LittleEndian @@ -10033,7 +11189,7 @@ func (mb *msgBlock) recalculateForSubj(subj string, ss *SimpleState) { ss.First = ss.Last // Only need to reset ss.lastNeedsUpdate, ss.firstNeedsUpdate is already reset above. ss.lastNeedsUpdate = false - return + return nil } buf := mb.cache.buf[li:] hdr := buf[:msgHdrSize] @@ -10047,7 +11203,7 @@ func (mb *msgBlock) recalculateForSubj(subj string, ss *SimpleState) { if ss.Msgs == 1 { ss.Last = seq ss.lastNeedsUpdate = false - return + return nil } // Skip the start slot ahead, if we need to recalculate last we can stop early. startSlot = slot @@ -10072,7 +11228,7 @@ func (mb *msgBlock) recalculateForSubj(subj string, ss *SimpleState) { li := int(bi) if li >= len(mb.cache.buf) { // Can't overwrite ss.Last, just skip. - return + return nil } buf := mb.cache.buf[li:] hdr := buf[:msgHdrSize] @@ -10091,22 +11247,26 @@ func (mb *msgBlock) recalculateForSubj(subj string, ss *SimpleState) { ss.First = seq ss.firstNeedsUpdate = false } - return + return nil } } } + return nil } // Lock should be held. -func (fs *fileStore) resetGlobalPerSubjectInfo() { +func (fs *fileStore) resetGlobalPerSubjectInfo() error { // Clear any global subject state. fs.psim, fs.tsl = fs.psim.Empty(), 0 if fs.noTrackSubjects() { - return + return nil } for _, mb := range fs.blks { - fs.populateGlobalPerSubjectInfo(mb) + if err := fs.populateGlobalPerSubjectInfo(mb); err != nil { + return err + } } + return nil } // Lock should be held. @@ -10154,6 +11314,9 @@ func (mb *msgBlock) generatePerSubjectInfo() error { if err == errNoCache { return nil } + // Clear partially built fss so callers don't operate on incomplete state. + mb.fss = nil + mb.clearCacheAndOffset() return err } if sm != nil && len(sm.subj) > 0 { @@ -10196,12 +11359,12 @@ func (mb *msgBlock) ensurePerSubjectInfoLoaded() error { // Called on recovery to populate the global psim state. // Lock should be held. -func (fs *fileStore) populateGlobalPerSubjectInfo(mb *msgBlock) { +func (fs *fileStore) populateGlobalPerSubjectInfo(mb *msgBlock) error { mb.mu.Lock() defer mb.mu.Unlock() if err := mb.ensurePerSubjectInfoLoaded(); err != nil { - return + return err } // Now populate psim. @@ -10219,6 +11382,7 @@ func (fs *fileStore) populateGlobalPerSubjectInfo(mb *msgBlock) { } return true }) + return nil } // Calls os.RemoveAll on the given `dir` directory, but if an error occurs, @@ -10309,10 +11473,8 @@ func (fs *fileStore) Delete(inline bool) error { } pdir := filepath.Join(fs.fcfg.StoreDir, purgeDir) - // If purge directory still exists then we need to wait - // in place and remove since rename would fail. if _, err := os.Stat(pdir); err == nil { - os.RemoveAll(pdir) + _ = os.RemoveAll(pdir) } // Quickly close all blocks and simulate a purge w/o overhead an new write block. @@ -10383,7 +11545,7 @@ func (fs *fileStore) cancelSyncTimer() { const ( fullStateMagic = uint8(11) fullStateMinVersion = uint8(1) // What is the minimum version we know how to parse? - fullStateVersion = uint8(3) // What is the current version written out to index.db? + fullStateVersion = uint8(4) // What is the current version written out to index.db? ) // This go routine periodically writes out our full stream state index. @@ -10427,17 +11589,12 @@ func timestampNormalized(t time.Time) int64 { // writeFullState will proceed to write the full meta state iff not complex and time consuming. // Since this is for quick recovery it is optional and should not block/stall normal operations. func (fs *fileStore) writeFullState() error { - return fs._writeFullState(false, true) + return fs._writeFullState(false) } // forceWriteFullState will proceed to write the full meta state. func (fs *fileStore) forceWriteFullState() error { - return fs._writeFullState(true, true) -} - -// forceWriteFullStateLocked will proceed to write the full meta state. This should only be called by stop() -func (fs *fileStore) forceWriteFullStateLocked() error { - return fs._writeFullState(true, false) + return fs._writeFullState(true) } // This will write the full binary state for the stream. @@ -10447,29 +11604,46 @@ func (fs *fileStore) forceWriteFullStateLocked() error { // 2. PSIM - Per Subject Index Map - Tracks first and last blocks with subjects present. // 3. MBs - Index, Bytes, First and Last Sequence and Timestamps, and the deleted map (avl.seqset). // 4. Last block index and hash of record inclusive to this stream state. -func (fs *fileStore) _writeFullState(force, needLock bool) error { +func (fs *fileStore) _writeFullState(force bool) error { if fs.isClosed() { return nil } - fsLock := func() { - if needLock { - fs.mu.Lock() - } - } - fsUnlock := func() { - if needLock { - fs.mu.Unlock() - } + // If we aren't forcing an update then only queue this up if we aren't already + // running. This means we can keep waiting on shutdown if needed but not build up + // lots of waiting goroutines in a bad timer case. + if fs.wfsrun.Add(1) > 1 && !force { + fs.wfsrun.Add(-1) + return nil } + defer fs.wfsrun.Add(-1) + + // Only allow one _writeFullState to take place at a time, otherwise we can + // have multiple goroutines trying to write the same file after we've released + // the store lock. + fs.wfsmu.Lock() + defer fs.wfsmu.Unlock() start := time.Now() - fsLock() + fs.mu.RLock() if fs.dirty == 0 { - fsUnlock() + fs.mu.RUnlock() return nil } + // Configure encryption if needed. + if fs.prf != nil { + // Re-acquire temporarily as write lock to set up AEK. + fs.mu.RUnlock() + fs.mu.Lock() + err := fs.setupAEK() + fs.mu.Unlock() + if err != nil { + return err + } + fs.mu.RLock() + } + // For calculating size and checking time costs for non forced calls. numSubjects := fs.numSubjects() @@ -10485,13 +11659,13 @@ func (fs *fileStore) _writeFullState(force, needLock bool) error { numDeleted = int((fs.state.LastSeq - fs.state.FirstSeq + 1) - fs.state.Msgs) } if numSubjects > numThreshold || numDeleted > numThreshold { - fsUnlock() + fs.mu.RUnlock() return errStateTooBig } } // We track this through subsequent runs to get an avg per blk used for subsequent runs. - avgDmapLen := fs.adml + avgDmapLen := fs.wfsadml // If first time through could be 0 if avgDmapLen == 0 && ((fs.state.LastSeq-fs.state.FirstSeq+1)-fs.state.Msgs) > 0 { avgDmapLen = 1024 @@ -10533,9 +11707,7 @@ func (fs *fileStore) _writeFullState(force, needLock bool) error { buf = append(buf, subj...) buf = binary.AppendUvarint(buf, psi.total) buf = binary.AppendUvarint(buf, uint64(psi.fblk)) - if psi.total > 1 { - buf = binary.AppendUvarint(buf, uint64(psi.lblk)) - } + buf = binary.AppendUvarint(buf, uint64(psi.lblk)) }) } @@ -10568,7 +11740,7 @@ func (fs *fileStore) _writeFullState(force, needLock bool) error { buf = binary.AppendUvarint(buf, mb.ttls) // Field is new in version 2 buf = binary.AppendUvarint(buf, mb.schedules) // Field is new in version 3 if numDeleted > 0 { - dmap, _ := mb.dmap.Encode(scratch[:0]) + dmap := mb.dmap.Encode(scratch[:0]) dmapTotalLen += len(dmap) buf = append(buf, dmap...) } @@ -10583,7 +11755,7 @@ func (fs *fileStore) _writeFullState(force, needLock bool) error { mb.mu.RUnlock() } if dmapTotalLen > 0 { - fs.adml = dmapTotalLen / len(fs.blks) + fs.wfsadml = dmapTotalLen / len(fs.blks) } // Place block index and hash onto the end. @@ -10592,16 +11764,12 @@ func (fs *fileStore) _writeFullState(force, needLock bool) error { // Encrypt if needed. if fs.prf != nil { - if err := fs.setupAEK(); err != nil { - fsUnlock() - return err - } nonce := make([]byte, fs.aek.NonceSize(), fs.aek.NonceSize()+len(buf)+fs.aek.Overhead()) if n, err := rand.Read(nonce); err != nil { - fsUnlock() + fs.mu.RUnlock() return err } else if n != len(nonce) { - fsUnlock() + fs.mu.RUnlock() return fmt.Errorf("not enough nonce bytes read (%d != %d)", n, len(nonce)) } buf = fs.aek.Seal(nonce, nonce, buf, nil) @@ -10609,26 +11777,25 @@ func (fs *fileStore) _writeFullState(force, needLock bool) error { fn := filepath.Join(fs.fcfg.StoreDir, msgDir, streamStreamStateFile) - fs.hh.Reset() - fs.hh.Write(buf) - buf = fs.hh.Sum(buf) + // Need to have our own hasher here, as under a read lock we can't mutate the + // fs.hh safely. + key := sha256.Sum256([]byte(fs.cfg.Name)) + hh, _ := highwayhash.NewDigest64(key[:]) + hh.Write(buf) + buf = hh.Sum(buf) // Snapshot prior dirty count. priorDirty := fs.dirty statesEqual := trackingStatesEqual(&fs.state, &mstate) // Release lock. - fsUnlock() + fs.mu.RUnlock() // Check consistency here. if !statesEqual { fs.warn("Stream state encountered internal inconsistency on write") // Rebuild our fs state from the mb state. - if needLock { - fs.rebuildState(nil) - } else { - fs.rebuildStateLocked(nil) - } + fs.rebuildState(nil) return errCorruptState } @@ -10647,20 +11814,18 @@ func (fs *fileStore) _writeFullState(force, needLock bool) error { err := os.WriteFile(fn, buf, defaultFilePerms) // if file system is not writable isPermissionError is set to true dios <- struct{}{} - if isPermissionError(err) { + if err != nil { return err } // Update dirty if successful. - if err == nil { - fsLock() - fs.dirty -= priorDirty - fsUnlock() - } + fs.mu.Lock() + fs.dirty -= priorDirty + fs.mu.Unlock() // Attempt to write both files, an error in one should not prevent the other from being written. - ttlErr := fs.writeTTLState(needLock) - schedErr := fs.writeMsgSchedulingState(needLock) + ttlErr := fs.writeTTLState() + schedErr := fs.writeMsgSchedulingState() if ttlErr != nil { return ttlErr } else if schedErr != nil { @@ -10669,42 +11834,30 @@ func (fs *fileStore) _writeFullState(force, needLock bool) error { return nil } -func (fs *fileStore) writeTTLState(needLock bool) error { - if needLock { - fs.mu.RLock() - } +func (fs *fileStore) writeTTLState() error { + fs.mu.RLock() if fs.ttls == nil { - if needLock { - fs.mu.RUnlock() - } + fs.mu.RUnlock() return nil } fn := filepath.Join(fs.fcfg.StoreDir, msgDir, ttlStreamStateFile) // Must be lseq+1 to identify up to which sequence the TTLs are valid. buf := fs.ttls.Encode(fs.state.LastSeq + 1) - if needLock { - fs.mu.RUnlock() - } + fs.mu.RUnlock() return fs.writeFileWithOptionalSync(fn, buf, defaultFilePerms) } -func (fs *fileStore) writeMsgSchedulingState(needLock bool) error { - if needLock { - fs.mu.RLock() - } +func (fs *fileStore) writeMsgSchedulingState() error { + fs.mu.RLock() if fs.scheduling == nil { - if needLock { - fs.mu.RUnlock() - } + fs.mu.RUnlock() return nil } fn := filepath.Join(fs.fcfg.StoreDir, msgDir, msgSchedulingStreamStateFile) // Must be lseq+1 to identify up to which sequence the schedules are valid. buf := fs.scheduling.encode(fs.state.LastSeq + 1) - if needLock { - fs.mu.RUnlock() - } + fs.mu.RUnlock() return fs.writeFileWithOptionalSync(fn, buf, defaultFilePerms) } @@ -10752,7 +11905,9 @@ func (fs *fileStore) stop(delete, writeState bool) error { if writeState { // Write full state if needed. If not dirty this is a no-op. - fs.forceWriteFullStateLocked() + fs.mu.Unlock() + fs.forceWriteFullState() + fs.mu.Lock() } // Mark as closed. Last message block needs to be cleared after @@ -10992,8 +12147,18 @@ func (fs *fileStore) Snapshot(deadline time.Duration, checkMsgs, includeConsumer fs.mu.Unlock() if checkMsgs { - ld := fs.checkMsgs() + ld, err := fs.checkMsgs() + clearSips := func() { + fs.mu.Lock() + fs.sips-- + fs.mu.Unlock() + } + if err != nil { + clearSips() + return nil, fmt.Errorf("snapshot check failed: %w", err) + } if ld != nil && len(ld.Msgs) > 0 { + clearSips() return nil, fmt.Errorf("snapshot check detected %d bad messages", len(ld.Msgs)) } } @@ -11082,10 +12247,7 @@ func (fs *fileStore) EncodedStreamState(failed uint64) ([]byte, error) { i += binary.PutUvarint(scratch[i:], num) b = append(b, scratch[0:i]...) case *avl.SequenceSet: - buf, err := db.Encode(scratch[:0]) - if err != nil { - return nil, err - } + buf := db.Encode(scratch[:0]) b = append(b, buf...) default: return nil, errors.New("no impl") @@ -11096,64 +12258,148 @@ func (fs *fileStore) EncodedStreamState(failed uint64) ([]byte, error) { return b, nil } -// We used to be more sophisticated to save memory, but speed is more important. +// deleteBlocks returns DeleteBlocks representing interior deletes +// and gaps between blocks. // All blocks should be at least read locked. func (fs *fileStore) deleteBlocks() DeleteBlocks { var dbs DeleteBlocks var prevLast uint64 + var prevRange *DeleteRange + var msgsSinceGap bool for _, mb := range fs.blks { // Detect if we have a gap between these blocks. fseq := atomic.LoadUint64(&mb.first.seq) if prevLast > 0 && prevLast+1 != fseq { - dbs = append(dbs, &DeleteRange{First: prevLast + 1, Num: fseq - prevLast - 1}) + gapSize := fseq - prevLast - 1 + // The previous DeleteRange can be extended + // to include this gap, if there are no + // blocks containing messages between the + // two gaps. + if prevRange != nil && !msgsSinceGap { + prevRange.Num += gapSize + } else { + prevRange = &DeleteRange{ + First: prevLast + 1, + Num: gapSize, + } + msgsSinceGap = false + dbs = append(dbs, prevRange) + } } if mb.dmap.Size() > 0 { dbs = append(dbs, &mb.dmap) + prevRange = nil } prevLast = atomic.LoadUint64(&mb.last.seq) + msgsSinceGap = msgsSinceGap || mb.msgs > 0 } return dbs } +// deleteMap returns all interior deletes for each block based on the mb.dmap. +// Specifically, this will not contain any deletes for blocks that have been removed. +// This is useful to know whether a tombstone is still relevant and marked as deleted by an active block. +// No locks should be held. +func (fs *fileStore) deleteMap() (dmap avl.SequenceSet) { + fs.mu.RLock() + defer fs.mu.RUnlock() + + fs.readLockAllMsgBlocks() + defer fs.readUnlockAllMsgBlocks() + + for _, mb := range fs.blks { + if mb.dmap.Size() > 0 { + mb.dmap.Range(func(seq uint64) bool { + dmap.Insert(seq) + return true + }) + } + } + return dmap +} + // SyncDeleted will make sure this stream has same deleted state as dbs. // This will only process deleted state within our current state. -func (fs *fileStore) SyncDeleted(dbs DeleteBlocks) { +func (fs *fileStore) SyncDeleted(dbs DeleteBlocks) error { + if fs.isClosed() { + return ErrStoreClosed + } + if len(dbs) == 0 { - return + return nil } fs.mu.Lock() defer fs.mu.Unlock() - lseq := fs.state.LastSeq - var needsCheck DeleteBlocks + // Always return previous write errors. + if err := fs.werr; err != nil { + return err + } + lseq := fs.state.LastSeq fs.readLockAllMsgBlocks() mdbs := fs.deleteBlocks() - for i, db := range dbs { - first, last, num := db.State() - // If the block is same as what we have we can skip. - if i < len(mdbs) { - eFirst, eLast, eNum := mdbs[i].State() - if first == eFirst && last == eLast && num == eNum { - continue - } - } else if first > lseq { - // Skip blocks not applicable to our current state. - continue - } - // Need to insert these. - needsCheck = append(needsCheck, db) - } fs.readUnlockAllMsgBlocks() - for _, db := range needsCheck { - db.Range(func(dseq uint64) bool { - fs.removeMsg(dseq, false, true, false) - return true - }) + for _, db := range dbs { + first, last, _ := db.State() + if first > lseq { + break + } + + var prune bool + if prune, mdbs = pruneDeleteBlock(db, mdbs); prune { + continue + } + + var err error + if _, ok := db.(*DeleteRange); ok { + err = fs.removeMsgsInRange(first, last, true) + } else { + db.Range(func(dseq uint64) bool { + _, err = fs.removeMsg(dseq, false, true, false) + // Can continue safely if the message doesn't exist. + if err == ErrStoreEOF || err == ErrStoreMsgNotFound { + err = nil + } + return err == nil + }) + } + if err != nil { + return err + } } + return nil +} + +// pruneDeleteBlock tries to find a delete block in the ordered blocks slice +// that matches db. It skips blocks that are already behind db and returns +// whether the next candidate matches exactly, along with the remaining +// suffix to use for the next comparison. +func pruneDeleteBlock(db DeleteBlock, blocks DeleteBlocks) (bool, DeleteBlocks) { + if len(blocks) == 0 { + return false, blocks + } + + aFirst, aLast, aNum := db.State() + bFirst, bLast, bNum := blocks[0].State() + + // Drop blocks that end before db starts. + for bLast < aFirst { + blocks = blocks[1:] + if len(blocks) == 0 { + return false, blocks + } + bFirst, bLast, bNum = blocks[0].State() + } + + if aFirst == bFirst && aLast == bLast && aNum == bNum { + return true, blocks[1:] + } + + return false, blocks } //////////////////////////////////////////////////////////////////////////////// @@ -11194,7 +12440,9 @@ func (fs *fileStore) ConsumerStore(name string, created time.Time, cfg *Consumer if cfg.MemoryStorage { // Create directly here. o := &consumerMemStore{ms: fs, cfg: *cfg} - fs.AddConsumer(o) + if err := fs.AddConsumer(o); err != nil { + return nil, err + } return o, nil } @@ -11260,7 +12508,7 @@ func (fs *fileStore) ConsumerStore(name string, created time.Time, cfg *Consumer if _, err := os.Stat(meta); err != nil && os.IsNotExist(err) { didCreate = true if err := o.writeConsumerMeta(); err != nil { - os.RemoveAll(odir) + _ = os.RemoveAll(odir) return nil, err } } @@ -11272,7 +12520,7 @@ func (fs *fileStore) ConsumerStore(name string, created time.Time, cfg *Consumer if _, err := os.Stat(keyFile); err != nil && os.IsNotExist(err) { if err := o.writeConsumerMeta(); err != nil { if didCreate { - os.RemoveAll(odir) + _ = os.RemoveAll(odir) } return nil, err } @@ -11286,7 +12534,7 @@ func (fs *fileStore) ConsumerStore(name string, created time.Time, cfg *Consumer err = fs.writeFileWithOptionalSync(o.ifn, state, defaultFilePerms) if err != nil { if didCreate { - os.RemoveAll(odir) + _ = os.RemoveAll(odir) } return nil, err } @@ -11298,7 +12546,6 @@ func (fs *fileStore) ConsumerStore(name string, created time.Time, cfg *Consumer // Create channels to control our flush go routine. o.fch = make(chan struct{}, 1) o.qch = make(chan struct{}) - go o.flushLoop(o.fch, o.qch) // Make sure to load in our state from disk if needed. if err = o.loadState(); err != nil { @@ -11306,8 +12553,11 @@ func (fs *fileStore) ConsumerStore(name string, created time.Time, cfg *Consumer } // Assign to filestore. - fs.AddConsumer(o) + if err = fs.AddConsumer(o); err != nil { + return nil, err + } + go o.flushLoop(o.fch, o.qch) return o, nil } @@ -11461,11 +12711,9 @@ func (o *consumerFileStore) flushLoop(fch, qch chan struct{}) { func (o *consumerFileStore) SetStarting(sseq uint64) error { o.mu.Lock() o.state.Delivered.Stream = sseq - buf, err := o.encodeState() + o.state.AckFloor.Stream = sseq + buf := encodeConsumerState(&o.state) o.mu.Unlock() - if err != nil { - return err - } return o.writeState(buf) } @@ -11485,6 +12733,14 @@ func (o *consumerFileStore) UpdateStarting(sseq uint64) { o.kickFlusher() } +// Reset all values in the store, and reset the starting sequence. +func (o *consumerFileStore) Reset(sseq uint64) error { + o.mu.Lock() + o.state = ConsumerState{} + o.mu.Unlock() + return o.SetStarting(sseq) +} + // HasState returns if this store has a recorded state. func (o *consumerFileStore) HasState() bool { o.mu.Lock() @@ -11586,8 +12842,8 @@ func (o *consumerFileStore) UpdateAcks(dseq, sseq uint64) error { return ErrStoreMsgNotFound } - // Check for AckAll here. - if o.cfg.AckPolicy == AckAll { + // Check for AckAll here (or AckFlowControl which functions like AckAll). + if o.cfg.AckPolicy == AckAll || o.cfg.AckPolicy == AckFlowControl { sgap := sseq - o.state.AckFloor.Stream o.state.AckFloor.Consumer = dseq o.state.AckFloor.Stream = sseq @@ -11721,6 +12977,50 @@ func (o *consumerFileStore) Update(state *ConsumerState) error { return nil } +// ForceUpdate updates the consumer state without the backwards check. +// This is used during recovery when we need to reset the consumer to an earlier sequence. +func (o *consumerFileStore) ForceUpdate(state *ConsumerState) error { + // Sanity checks. + if state.AckFloor.Consumer > state.Delivered.Consumer { + return fmt.Errorf("bad ack floor for consumer") + } + if state.AckFloor.Stream > state.Delivered.Stream { + return fmt.Errorf("bad ack floor for stream") + } + + // Copy to our state. + var pending map[uint64]*Pending + var redelivered map[uint64]uint64 + if len(state.Pending) > 0 { + pending = make(map[uint64]*Pending, len(state.Pending)) + for seq, p := range state.Pending { + pending[seq] = &Pending{p.Sequence, p.Timestamp} + if seq <= state.AckFloor.Stream || seq > state.Delivered.Stream { + return fmt.Errorf("bad pending entry, sequence [%d] out of range", seq) + } + } + } + if len(state.Redelivered) > 0 { + redelivered = make(map[uint64]uint64, len(state.Redelivered)) + for seq, dc := range state.Redelivered { + redelivered[seq] = dc + } + } + + // Replace our state. + o.mu.Lock() + o.state.Delivered = state.Delivered + o.state.AckFloor = state.AckFloor + o.state.Pending = pending + o.state.Redelivered = redelivered + buf, err := o.encodeState() + o.mu.Unlock() + if err != nil { + return err + } + return o.writeState(buf) +} + // Will encrypt the state with our asset key. Will be a no-op if encryption not enabled. // Lock should be held. func (o *consumerFileStore) encryptState(buf []byte) ([]byte, error) { @@ -12150,7 +13450,9 @@ func (o *consumerFileStore) Stop() error { ifn, fs := o.ifn, o.fs o.mu.Unlock() - fs.RemoveConsumer(o) + if err = fs.RemoveConsumer(o); err != nil { + return err + } if len(buf) > 0 { o.waitOnFlusher() @@ -12234,63 +13536,6 @@ func (fs *fileStore) RemoveConsumer(o ConsumerStore) error { return nil } -//////////////////////////////////////////////////////////////////////////////// -// Templates -//////////////////////////////////////////////////////////////////////////////// - -// Deprecated: stream templates are deprecated and will be removed in a future version. -type templateFileStore struct { - dir string - hh *highwayhash.Digest64 -} - -// Deprecated: stream templates are deprecated and will be removed in a future version. -func newTemplateFileStore(storeDir string) *templateFileStore { - tdir := filepath.Join(storeDir, tmplsDir) - key := sha256.Sum256([]byte("templates")) - hh, err := highwayhash.NewDigest64(key[:]) - if err != nil { - return nil - } - return &templateFileStore{dir: tdir, hh: hh} -} - -// Deprecated: stream templates are deprecated and will be removed in a future version. -func (ts *templateFileStore) Store(t *streamTemplate) error { - dir := filepath.Join(ts.dir, t.Name) - if err := os.MkdirAll(dir, defaultDirPerms); err != nil { - return fmt.Errorf("could not create templates storage directory for %q- %v", t.Name, err) - } - meta := filepath.Join(dir, JetStreamMetaFile) - if _, err := os.Stat(meta); (err != nil && !os.IsNotExist(err)) || err == nil { - return err - } - t.mu.Lock() - b, err := json.Marshal(t) - t.mu.Unlock() - if err != nil { - return err - } - if err := os.WriteFile(meta, b, defaultFilePerms); err != nil { - return err - } - // FIXME(dlc) - Do checksum - ts.hh.Reset() - ts.hh.Write(b) - var hb [highwayhash.Size64]byte - checksum := hex.EncodeToString(ts.hh.Sum(hb[:0])) - sum := filepath.Join(dir, JetStreamMetaFileSum) - if err := os.WriteFile(sum, []byte(checksum), defaultFilePerms); err != nil { - return err - } - return nil -} - -// Deprecated: stream templates are deprecated and will be removed in a future version. -func (ts *templateFileStore) Delete(t *streamTemplate) error { - return os.RemoveAll(filepath.Join(ts.dir, t.Name)) -} - //////////////////////////////////////////////////////////////////////////////// // Compression //////////////////////////////////////////////////////////////////////////////// @@ -12406,6 +13651,10 @@ func writeFileWithSync(name string, data []byte, perm fs.FileMode) error { return writeAtomically(name, data, perm, true) } +// Windows does not support fsyncing directory metadata, it results in a panic, so +// we need to skip doing this there. +const canFsyncDirectories = runtime.GOOS != "windows" + func writeAtomically(name string, data []byte, perm fs.FileMode, sync bool) error { tmp := name + ".tmp" flags := os.O_CREATE | os.O_WRONLY | os.O_TRUNC @@ -12421,6 +13670,7 @@ func writeAtomically(name string, data []byte, perm fs.FileMode, sync bool) erro return err } if _, err := f.Write(data); err != nil { + // Close fd, but ignore its error since write takes precedence. _ = f.Close() _ = os.Remove(tmp) return err @@ -12433,12 +13683,20 @@ func writeAtomically(name string, data []byte, perm fs.FileMode, sync bool) erro _ = os.Remove(tmp) return err } - if sync { + if sync && canFsyncDirectories { // To ensure that the file rename was persisted on all filesystems, // also try to flush the directory metadata. - if d, err := os.Open(filepath.Dir(name)); err == nil { - _ = d.Sync() + var d *os.File + if d, err = os.Open(filepath.Dir(name)); err != nil { + return err + } + if err = d.Sync(); err != nil { + // Close fd, but ignore its error since sync takes precedence. _ = d.Close() + return err + } + if err = d.Close(); err != nil { + return err } } return nil diff --git a/vendor/github.com/nats-io/nats-server/v2/server/gateway.go b/vendor/github.com/nats-io/nats-server/v2/server/gateway.go index f4982cc2c..52cb65c19 100644 --- a/vendor/github.com/nats-io/nats-server/v2/server/gateway.go +++ b/vendor/github.com/nats-io/nats-server/v2/server/gateway.go @@ -1156,9 +1156,7 @@ func (c *client) processGatewayInfo(info *Info) { // defensive code above that if we did not register this connection // because we already have an outbound for this name, then // close this connection (and make sure it does not try to reconnect) - c.mu.Lock() - c.flags.set(noReconnect) - c.mu.Unlock() + c.setNoReconnect() c.closeConnection(WrongGateway) return } @@ -1981,7 +1979,7 @@ func (c *client) processGatewayRUnsub(arg []byte) error { return nil } else { // Plain sub, assume optimistic sends, create entry. - e = &outsie{ni: make(map[string]struct{}), sl: NewSublistWithCache()} + e = &outsie{ni: make(map[string]struct{}), sl: NewSublistForServer(c.srv)} newe = true } // This is when a sub or queue sub is supposed to be in @@ -2090,7 +2088,7 @@ func (c *client) processGatewayRSub(arg []byte) error { } else if queue == nil { return nil } else { - e = &outsie{ni: make(map[string]struct{}), sl: NewSublistWithCache()} + e = &outsie{ni: make(map[string]struct{}), sl: NewSublistForServer(c.srv)} newe = true useSl = true } @@ -2952,6 +2950,16 @@ func getSubjectFromGWRoutedReply(reply []byte, isOldPrefix bool) []byte { return reply[gwSubjectOffset:] } +// Returns the subject embedded in the given routed +// reply subject and whether the prefix was stripped. +// If the subject is not routed, returns it unchanged. +func getGWRoutedSubjectOrSelf(subject []byte) ([]byte, bool) { + if isGWPrefix, oldPrefix := isGWRoutedSubjectAndIsOldPrefix(subject); isGWPrefix { + return getSubjectFromGWRoutedReply(subject, oldPrefix), true + } + return subject, false +} + // This should be invoked only from processInboundGatewayMsg() or // processInboundRoutedMsg() and is checking if the subject // (c.pa.subject) has the _GR_ prefix. If so, this is processed @@ -3201,7 +3209,7 @@ func (c *client) gatewayAllSubsReceiveStart(info *Info) { e.mode = Transitioning e.Unlock() } else { - e := &outsie{sl: NewSublistWithCache()} + e := &outsie{sl: NewSublistForServer(c.srv)} e.mode = Transitioning c.mu.Lock() c.gw.outsim.Store(account, e) diff --git a/vendor/github.com/nats-io/nats-server/v2/server/gsl/gsl.go b/vendor/github.com/nats-io/nats-server/v2/server/gsl/gsl.go index c16f6bac6..235f144c5 100644 --- a/vendor/github.com/nats-io/nats-server/v2/server/gsl/gsl.go +++ b/vendor/github.com/nats-io/nats-server/v2/server/gsl/gsl.go @@ -170,6 +170,66 @@ func (s *GenericSublist[T]) NumInterest(subject string) (np int) { return } +// MatchesFullWildcard returns true if there is top-level ">" interest. +func (s *GenericSublist[T]) MatchesFullWildcard() bool { + if s == nil { + return false + } + s.RLock() + defer s.RUnlock() + return s.root.fwc != nil +} + +// MatchesSingleFilter returns the filter when the sublist contains exactly one unique subject. +func (s *GenericSublist[T]) MatchesSingleFilter() (string, bool) { + if s == nil { + return _EMPTY_, false + } + s.RLock() + defer s.RUnlock() + return singleFilter(s.root, _EMPTY_) +} + +func singleFilter[T comparable](l *level[T], filter string) (string, bool) { + if l == nil { + return filter, filter != _EMPTY_ + } + if len(l.nodes) > 1 { + return _EMPTY_, false + } + var next *node[T] + branches := 0 + if l.pwc != nil { + next = l.pwc + branches++ + } + if l.fwc != nil { + next = l.fwc + branches++ + } + for _, n := range l.nodes { + next = n + branches++ + } + if branches != 1 { + return _EMPTY_, false + } + for _, subj := range next.subs { + filter = subj + break + } + if next.next == nil { + return filter, filter != _EMPTY_ + } + if filter != _EMPTY_ { + if next.next.numNodes() > 0 { + return _EMPTY_, false + } + return filter, true + } + return singleFilter(next.next, filter) +} + func (s *GenericSublist[T]) match(subject string, cb func(T), doLock bool) { tsa := [32]string{} tokens := tsa[:0] diff --git a/vendor/github.com/nats-io/nats-server/v2/server/jetstream.go b/vendor/github.com/nats-io/nats-server/v2/server/jetstream.go index 3ec6942b9..010b170b8 100644 --- a/vendor/github.com/nats-io/nats-server/v2/server/jetstream.go +++ b/vendor/github.com/nats-io/nats-server/v2/server/jetstream.go @@ -25,13 +25,13 @@ import ( "os" "path/filepath" "runtime/debug" - "strconv" "strings" "sync" "sync/atomic" "time" "github.com/minio/highwayhash" + "github.com/nats-io/nats-server/v2/server/gsl" "github.com/nats-io/nats-server/v2/server/sysmem" "github.com/nats-io/nats-server/v2/server/tpm" "github.com/nats-io/nkeys" @@ -103,22 +103,26 @@ type JetStreamAPIStats struct { // This is for internal accounting for JetStream for this server. type jetStream struct { // These are here first because of atomics on 32bit systems. - apiInflight int64 - apiTotal int64 - apiErrors int64 - memReserved int64 - storeReserved int64 - memUsed int64 - storeUsed int64 - queueLimit int64 - clustered int32 - mu sync.RWMutex - srv *Server - config JetStreamConfig - cluster *jetStreamCluster - accounts map[string]*jsAccount - apiSubs *Sublist - started time.Time + apiInflight int64 + apiTotal int64 + apiErrors int64 + memMax int64 + memReserved int64 // Requires JS lock to be held. + memUsed int64 + storeMax int64 + storeReserved int64 // Requires JS lock to be held. + storeUsed int64 + queueLimit int64 + infoQueueLimit int64 + clustered int32 + mu sync.RWMutex + srv *Server + config JetStreamConfig + cluster *jetStreamCluster + accounts map[string]*jsAccount + apiSubs *Sublist + infoSubs *gsl.SimpleSublist // Subjects for info-specific queue. + started time.Time // System level request to purge a stream move accountPurge *subscription @@ -150,14 +154,12 @@ type jsaStorage struct { // an internal sub for a stream, so we will direct link to the stream // and walk backwards as needed vs multiple hash lookups and locks, etc. type jsAccount struct { - mu sync.RWMutex - js *jetStream - account *Account - storeDir string - inflight sync.Map - streams map[string]*stream - templates map[string]*streamTemplate // Deprecated: stream templates are deprecated and will be removed in a future version. - store TemplateStore // Deprecated: stream templates are deprecated and will be removed in a future version. + mu sync.RWMutex + js *jetStream + account *Account + storeDir string + inflight sync.Map + streams map[string]*stream // From server sendq *ipQueue[*pubMsg] @@ -415,15 +417,19 @@ func (s *Server) initJetStreamEncryption() (err error) { // enableJetStream will start up the JetStream subsystem. func (s *Server) enableJetStream(cfg JetStreamConfig) error { - js := &jetStream{srv: s, config: cfg, accounts: make(map[string]*jsAccount), apiSubs: NewSublistNoCache()} + js := &jetStream{srv: s, config: cfg, accounts: make(map[string]*jsAccount), apiSubs: NewSublistNoCache(), infoSubs: gsl.NewSimpleSublist()} s.gcbMu.Lock() if s.gcbOutMax = s.getOpts().JetStreamMaxCatchup; s.gcbOutMax == 0 { s.gcbOutMax = defaultMaxTotalCatchupOutBytes } s.gcbMu.Unlock() + atomic.StoreInt64(&js.memMax, cfg.MaxMemory) + atomic.StoreInt64(&js.storeMax, cfg.MaxStore) + // TODO: Not currently reloadable. atomic.StoreInt64(&js.queueLimit, s.getOpts().JetStreamRequestQueueLimit) + atomic.StoreInt64(&js.infoQueueLimit, s.getOpts().JetStreamInfoQueueLimit) s.js.Store(js) @@ -1058,8 +1064,10 @@ func (s *Server) shutdownJetStream() { func (s *Server) JetStreamConfig() *JetStreamConfig { var c *JetStreamConfig if js := s.getJetStream(); js != nil { + js.mu.RLock() copy := js.config c = &(copy) + js.mu.RUnlock() } return c } @@ -1219,54 +1227,6 @@ func (a *Account) EnableJetStream(limits map[string]JetStreamAccountLimits, tq c s.Debugf("Recovering JetStream state for account %q", a.Name) } - // Check templates first since messsage sets will need proper ownership. - // FIXME(dlc) - Make this consistent. - tdir := filepath.Join(jsa.storeDir, tmplsDir) - if stat, err := os.Stat(tdir); err == nil && stat.IsDir() { - key := sha256.Sum256([]byte("templates")) - hh, err := highwayhash.NewDigest64(key[:]) - if err != nil { - return err - } - fis, _ := os.ReadDir(tdir) - for _, fi := range fis { - metafile := filepath.Join(tdir, fi.Name(), JetStreamMetaFile) - metasum := filepath.Join(tdir, fi.Name(), JetStreamMetaFileSum) - buf, err := os.ReadFile(metafile) - if err != nil { - s.Warnf(" Error reading StreamTemplate metafile %q: %v", metasum, err) - continue - } - if _, err := os.Stat(metasum); os.IsNotExist(err) { - s.Warnf(" Missing StreamTemplate checksum for %q", metasum) - continue - } - sum, err := os.ReadFile(metasum) - if err != nil { - s.Warnf(" Error reading StreamTemplate checksum %q: %v", metasum, err) - continue - } - hh.Reset() - hh.Write(buf) - var hb [highwayhash.Size64]byte - checksum := hex.EncodeToString(hh.Sum(hb[:0])) - if checksum != string(sum) { - s.Warnf(" StreamTemplate checksums do not match %q vs %q", sum, checksum) - continue - } - var cfg StreamTemplateConfig - if err := json.Unmarshal(buf, &cfg); err != nil { - s.Warnf(" Error unmarshalling StreamTemplate metafile: %v", err) - continue - } - cfg.Config.Name = _EMPTY_ - if _, err := a.addStreamTemplate(&cfg); err != nil { - s.Warnf(" Error recreating StreamTemplate %q: %v", cfg.Name, err) - continue - } - } - } - // Remember if we should be encrypted and what cipher we think we should use. encrypted := s.getOpts().JetStreamKey != _EMPTY_ sc := s.getOpts().JetStreamCipher @@ -1510,15 +1470,6 @@ func (a *Account) EnableJetStream(limits map[string]JetStreamAccountLimits, tq c return nil } - if cfg.Template != _EMPTY_ { - jsa.mu.Lock() - err := jsa.addStreamNameToTemplate(cfg.Template, cfg.Name) - jsa.mu.Unlock() - if err != nil { - s.Warnf(" Error adding stream %q to template %q: %v", cfg.Name, cfg.Template, err) - } - } - // We had a bug that set a default de dupe window on mirror, despite that being not a valid config fixCfgMirrorWithDedupWindow(&cfg.StreamConfig) @@ -1587,6 +1538,7 @@ func (a *Account) EnableJetStream(limits map[string]JetStreamAccountLimits, tq c batchId string batchSeq uint64 commit bool + commitEob bool batchStoreDir string store StreamStore state StreamState @@ -1604,19 +1556,30 @@ func (a *Account) EnableJetStream(limits map[string]JetStreamAccountLimits, tq c } // We've observed a partial batch write. Write the remainder of the batch. batchSeq++ - _, batchStoreDir = getBatchStoreDir(mset, batchId) + _, batchStoreDir = getBatchStoreDir(jsa.storeDir, cfg.Name, batchId) if _, err = os.Stat(batchStoreDir); err != nil { s.Errorf(" Failed restoring partial batch write for stream '%s > %s' at sequence %d: %v", mset.accName(), mset.name(), batchSeq, err) goto SKIP } - store, err = newBatchStore(mset, batchId) + store, err = newBatchStore(mset, batchId, cfg.Replicas, cfg.Storage, jsa.storeDir, cfg.Name) if err != nil { s.Errorf(" Failed restoring partial batch write for stream '%s > %s' at sequence %d: %v", mset.accName(), mset.name(), batchSeq, err) goto SKIP } store.FastState(&state) + sm, err = store.LoadMsg(state.LastSeq, &smv) + if err != nil || sm == nil { + s.Errorf(" Failed restoring partial batch write for stream '%s > %s' at sequence %d: last msg not found %d", + mset.accName(), mset.name(), batchSeq, state.LastSeq) + goto SKIP + } + commitEob = bytes.Equal(sliceHeader(JSBatchCommit, sm.hdr), []byte("eob")) + // If the commit ends with an "End Of Batch" message, we don't store this. + if commitEob { + state.LastSeq-- + } s.Noticef(" Restoring partial batch write for stream '%s > %s' (seq %d to %d)", mset.accName(), mset.name(), batchSeq, state.LastSeq) // Loop through items that weren't persisted yet. @@ -1627,7 +1590,12 @@ func (a *Account) EnableJetStream(limits map[string]JetStreamAccountLimits, tq c mset.accName(), mset.name(), seq, err) break } - mset.processJetStreamMsg(sm.subj, _EMPTY_, sm.hdr, sm.msg, 0, 0, nil, false, true) + hdr := sm.hdr + // If committed by EOB, the last message must get the normal commit header. + if commitEob && seq == state.LastSeq { + hdr = genHeader(hdr, JSBatchCommit, "1") + } + mset.processJetStreamMsg(sm.subj, _EMPTY_, hdr, sm.msg, 0, 0, nil, false, true) } store.Delete(true) SKIP: @@ -2342,14 +2310,14 @@ func (jsa *jsAccount) sendClusterUsageUpdate() { func (js *jetStream) wouldExceedLimits(storeType StorageType, sz int) bool { var ( total *int64 - max int64 + max *int64 ) if storeType == MemoryStorage { - total, max = &js.memUsed, js.config.MaxMemory + total, max = &js.memUsed, &js.memMax } else { - total, max = &js.storeUsed, js.config.MaxStore + total, max = &js.storeUsed, &js.storeMax } - return (atomic.LoadInt64(total) + int64(sz)) > max + return (atomic.LoadInt64(total) + int64(sz)) > atomic.LoadInt64(max) } func (js *jetStream) limitsExceeded(storeType StorageType) bool { @@ -2519,7 +2487,6 @@ func (jsa *jsAccount) acc() *Account { // Delete the JetStream resources. func (jsa *jsAccount) delete() { var streams []*stream - var ts []string jsa.mu.Lock() // The update timer and subs need to be protected by usageMu lock @@ -2538,20 +2505,11 @@ func (jsa *jsAccount) delete() { for _, ms := range jsa.streams { streams = append(streams, ms) } - acc := jsa.account - for _, t := range jsa.templates { - ts = append(ts, t.Name) - } - jsa.templates = nil jsa.mu.Unlock() for _, mset := range streams { mset.stop(false, false) } - - for _, t := range ts { - acc.deleteStreamTemplate(t) - } } // Lookup the jetstream account for a given account. @@ -2763,325 +2721,6 @@ func (a *Account) checkForJetStream() (*Server, *jsAccount, error) { return s, jsa, nil } -// StreamTemplateConfig allows a configuration to auto-create streams based on this template when a message -// is received that matches. Each new stream will use the config as the template config to create them. -// Deprecated: stream templates are deprecated and will be removed in a future version. -type StreamTemplateConfig struct { - Name string `json:"name"` - Config *StreamConfig `json:"config"` - MaxStreams uint32 `json:"max_streams"` -} - -// StreamTemplateInfo -// Deprecated: stream templates are deprecated and will be removed in a future version. -type StreamTemplateInfo struct { - Config *StreamTemplateConfig `json:"config"` - Streams []string `json:"streams"` -} - -// streamTemplate -// Deprecated: stream templates are deprecated and will be removed in a future version. -type streamTemplate struct { - mu sync.Mutex - tc *client - jsa *jsAccount - *StreamTemplateConfig - streams []string -} - -// Deprecated: stream templates are deprecated and will be removed in a future version. -func (t *StreamTemplateConfig) deepCopy() *StreamTemplateConfig { - copy := *t - cfg := *t.Config - copy.Config = &cfg - return © -} - -// addStreamTemplate will add a stream template to this account that allows auto-creation of streams. -// Deprecated: stream templates are deprecated and will be removed in a future version. -func (a *Account) addStreamTemplate(tc *StreamTemplateConfig) (*streamTemplate, error) { - s, jsa, err := a.checkForJetStream() - if err != nil { - return nil, err - } - if tc.Config.Name != "" { - return nil, fmt.Errorf("template config name should be empty") - } - if len(tc.Name) > JSMaxNameLen { - return nil, fmt.Errorf("template name is too long, maximum allowed is %d", JSMaxNameLen) - } - - // FIXME(dlc) - Hacky - tcopy := tc.deepCopy() - tcopy.Config.Name = "_" - cfg, apiErr := s.checkStreamCfg(tcopy.Config, a, false) - if apiErr != nil { - return nil, apiErr - } - tcopy.Config = &cfg - t := &streamTemplate{ - StreamTemplateConfig: tcopy, - tc: s.createInternalJetStreamClient(), - jsa: jsa, - } - t.tc.registerWithAccount(a) - - jsa.mu.Lock() - if jsa.templates == nil { - jsa.templates = make(map[string]*streamTemplate) - // Create the appropriate store - if cfg.Storage == FileStorage { - jsa.store = newTemplateFileStore(jsa.storeDir) - } else { - jsa.store = newTemplateMemStore() - } - } else if _, ok := jsa.templates[tcopy.Name]; ok { - jsa.mu.Unlock() - return nil, fmt.Errorf("template with name %q already exists", tcopy.Name) - } - jsa.templates[tcopy.Name] = t - jsa.mu.Unlock() - - // FIXME(dlc) - we can not overlap subjects between templates. Need to have test. - - // Setup the internal subscriptions to trap the messages. - if err := t.createTemplateSubscriptions(); err != nil { - return nil, err - } - if err := jsa.store.Store(t); err != nil { - t.delete() - return nil, err - } - return t, nil -} - -// Deprecated: stream templates are deprecated and will be removed in a future version. -func (t *streamTemplate) createTemplateSubscriptions() error { - if t == nil { - return fmt.Errorf("no template") - } - if t.tc == nil { - return fmt.Errorf("template not enabled") - } - c := t.tc - if !c.srv.EventsEnabled() { - return ErrNoSysAccount - } - sid := 1 - for _, subject := range t.Config.Subjects { - // Now create the subscription - if _, err := c.processSub([]byte(subject), nil, []byte(strconv.Itoa(sid)), t.processInboundTemplateMsg, false); err != nil { - c.acc.deleteStreamTemplate(t.Name) - return err - } - sid++ - } - return nil -} - -// Deprecated: stream templates are deprecated and will be removed in a future version. -func (t *streamTemplate) processInboundTemplateMsg(_ *subscription, pc *client, acc *Account, subject, reply string, msg []byte) { - if t == nil || t.jsa == nil { - return - } - jsa := t.jsa - cn := canonicalName(subject) - - jsa.mu.Lock() - // If we already are registered then we can just return here. - if _, ok := jsa.streams[cn]; ok { - jsa.mu.Unlock() - return - } - jsa.mu.Unlock() - - // Check if we are at the maximum and grab some variables. - t.mu.Lock() - c := t.tc - cfg := *t.Config - cfg.Template = t.Name - atLimit := len(t.streams) >= int(t.MaxStreams) - if !atLimit { - t.streams = append(t.streams, cn) - } - t.mu.Unlock() - - if atLimit { - c.RateLimitWarnf("JetStream could not create stream for account %q on subject %q, at limit", acc.Name, subject) - return - } - - // We need to create the stream here. - // Change the config from the template and only use literal subject. - cfg.Name = cn - cfg.Subjects = []string{subject} - mset, err := acc.addStream(&cfg) - if err != nil { - acc.validateStreams(t) - c.RateLimitWarnf("JetStream could not create stream for account %q on subject %q: %v", acc.Name, subject, err) - return - } - - // Process this message directly by invoking mset. - mset.processInboundJetStreamMsg(nil, pc, acc, subject, reply, msg) -} - -// lookupStreamTemplate looks up the names stream template. -// Deprecated: stream templates are deprecated and will be removed in a future version. -func (a *Account) lookupStreamTemplate(name string) (*streamTemplate, error) { - _, jsa, err := a.checkForJetStream() - if err != nil { - return nil, err - } - jsa.mu.Lock() - defer jsa.mu.Unlock() - if jsa.templates == nil { - return nil, fmt.Errorf("template not found") - } - t, ok := jsa.templates[name] - if !ok { - return nil, fmt.Errorf("template not found") - } - return t, nil -} - -// This function will check all named streams and make sure they are valid. -// Deprecated: stream templates are deprecated and will be removed in a future version. -func (a *Account) validateStreams(t *streamTemplate) { - t.mu.Lock() - var vstreams []string - for _, sname := range t.streams { - if _, err := a.lookupStream(sname); err == nil { - vstreams = append(vstreams, sname) - } - } - t.streams = vstreams - t.mu.Unlock() -} - -// Deprecated: stream templates are deprecated and will be removed in a future version. -func (t *streamTemplate) delete() error { - if t == nil { - return fmt.Errorf("nil stream template") - } - - t.mu.Lock() - jsa := t.jsa - c := t.tc - t.tc = nil - defer func() { - if c != nil { - c.closeConnection(ClientClosed) - } - }() - t.mu.Unlock() - - if jsa == nil { - return NewJSNotEnabledForAccountError() - } - - jsa.mu.Lock() - if jsa.templates == nil { - jsa.mu.Unlock() - return fmt.Errorf("template not found") - } - if _, ok := jsa.templates[t.Name]; !ok { - jsa.mu.Unlock() - return fmt.Errorf("template not found") - } - delete(jsa.templates, t.Name) - acc := jsa.account - jsa.mu.Unlock() - - // Remove streams associated with this template. - var streams []*stream - t.mu.Lock() - for _, name := range t.streams { - if mset, err := acc.lookupStream(name); err == nil { - streams = append(streams, mset) - } - } - t.mu.Unlock() - - if jsa.store != nil { - if err := jsa.store.Delete(t); err != nil { - return fmt.Errorf("error deleting template from store: %v", err) - } - } - - var lastErr error - for _, mset := range streams { - if err := mset.delete(); err != nil { - lastErr = err - } - } - return lastErr -} - -// Deprecated: stream templates are deprecated and will be removed in a future version. -func (a *Account) deleteStreamTemplate(name string) error { - t, err := a.lookupStreamTemplate(name) - if err != nil { - return NewJSStreamTemplateNotFoundError() - } - return t.delete() -} - -// Deprecated: stream templates are deprecated and will be removed in a future version. -func (a *Account) templates() []*streamTemplate { - var ts []*streamTemplate - _, jsa, err := a.checkForJetStream() - if err != nil { - return nil - } - - jsa.mu.Lock() - for _, t := range jsa.templates { - // FIXME(dlc) - Copy? - ts = append(ts, t) - } - jsa.mu.Unlock() - - return ts -} - -// Will add a stream to a template, this is for recovery. -// Deprecated: stream templates are deprecated and will be removed in a future version. -func (jsa *jsAccount) addStreamNameToTemplate(tname, mname string) error { - if jsa.templates == nil { - return fmt.Errorf("template not found") - } - t, ok := jsa.templates[tname] - if !ok { - return fmt.Errorf("template not found") - } - // We found template. - t.mu.Lock() - t.streams = append(t.streams, mname) - t.mu.Unlock() - return nil -} - -// This will check if a template owns this stream. -// jsAccount lock should be held -// Deprecated: stream templates are deprecated and will be removed in a future version. -func (jsa *jsAccount) checkTemplateOwnership(tname, sname string) bool { - if jsa.templates == nil { - return false - } - t, ok := jsa.templates[tname] - if !ok { - return false - } - // We found template, make sure we are in streams. - for _, streamName := range t.streams { - if sname == streamName { - return true - } - } - return false -} - type Number interface { int | int8 | int16 | int32 | int64 | uint | uint8 | uint16 | uint32 | uint64 | float32 | float64 } @@ -3107,10 +2746,11 @@ func isValidName(name string) bool { return !strings.ContainsAny(name, " \t\r\n\f.*>") } -// CanonicalName will replace all token separators '.' with '_'. -// This can be used when naming streams or consumers with multi-token subjects. -func canonicalName(name string) string { - return strings.ReplaceAll(name, ".", "_") +func isValidAssetName(name string) bool { + if name == _EMPTY_ { + return false + } + return !strings.ContainsAny(name, " \t\r\n\f.*>\\/") } // To throttle the out of resources errors. diff --git a/vendor/github.com/nats-io/nats-server/v2/server/jetstream_api.go b/vendor/github.com/nats-io/nats-server/v2/server/jetstream_api.go index e8600e14f..53525a8bc 100644 --- a/vendor/github.com/nats-io/nats-server/v2/server/jetstream_api.go +++ b/vendor/github.com/nats-io/nats-server/v2/server/jetstream_api.go @@ -20,6 +20,7 @@ import ( "errors" "fmt" "io" + "maps" "os" "path/filepath" "runtime" @@ -46,29 +47,6 @@ const ( // Will return JSON response. JSApiAccountInfo = "$JS.API.INFO" - // JSApiTemplateCreate is the endpoint to create new stream templates. - // Will return JSON response. - // Deprecated: stream templates are deprecated and will be removed in a future version. - JSApiTemplateCreate = "$JS.API.STREAM.TEMPLATE.CREATE.*" - JSApiTemplateCreateT = "$JS.API.STREAM.TEMPLATE.CREATE.%s" - - // JSApiTemplates is the endpoint to list all stream template names for this account. - // Will return JSON response. - // Deprecated: stream templates are deprecated and will be removed in a future version. - JSApiTemplates = "$JS.API.STREAM.TEMPLATE.NAMES" - - // JSApiTemplateInfo is for obtaining general information about a named stream template. - // Will return JSON response. - // Deprecated: stream templates are deprecated and will be removed in a future version. - JSApiTemplateInfo = "$JS.API.STREAM.TEMPLATE.INFO.*" - JSApiTemplateInfoT = "$JS.API.STREAM.TEMPLATE.INFO.%s" - - // JSApiTemplateDelete is the endpoint to delete stream templates. - // Will return JSON response. - // Deprecated: stream templates are deprecated and will be removed in a future version. - JSApiTemplateDelete = "$JS.API.STREAM.TEMPLATE.DELETE.*" - JSApiTemplateDeleteT = "$JS.API.STREAM.TEMPLATE.DELETE.%s" - // JSApiStreamCreate is the endpoint to create new streams. // Will return JSON response. JSApiStreamCreate = "$JS.API.STREAM.CREATE.*" @@ -177,6 +155,9 @@ const ( // JSApiRequestNextT is the prefix for the request next message(s) for a consumer in worker/pull mode. JSApiRequestNextT = "$JS.API.CONSUMER.MSG.NEXT.%s.%s" + // JSApiConsumerResetT is the prefix for resetting a given consumer to a new starting sequence. + JSApiConsumerResetT = "$JS.API.CONSUMER.RESET.%s.%s" + // JSApiConsumerUnpinT is the prefix for unpinning subscription for a given consumer. JSApiConsumerUnpin = "$JS.API.CONSUMER.UNPIN.*.*" JSApiConsumerUnpinT = "$JS.API.CONSUMER.UNPIN.%s.%s" @@ -237,13 +218,15 @@ const ( // jsAckT is the template for the ack message stream coming back from a consumer // when they ACK/NAK, etc a message. jsAckT = "$JS.ACK.%s.%s" + jsAckTv2 = "$JS.ACK.%s.%s.%s.%s" jsAckPre = "$JS.ACK." jsAckPreLen = len(jsAckPre) // jsFlowControl is for flow control subjects. jsFlowControlPre = "$JS.FC." // jsFlowControl is for FC responses. - jsFlowControl = "$JS.FC.%s.%s.*" + jsFlowControl = "$JS.FC.%s.%s.*" + jsFlowControlV2 = "$JS.FC.%s.%s.%s.%s.*" // JSAdvisoryPrefix is a prefix for all JetStream advisories. JSAdvisoryPrefix = "$JS.EVENT.ADVISORY" @@ -787,50 +770,19 @@ type JSApiConsumerGetNextRequest struct { PriorityGroup } -// JSApiStreamTemplateCreateResponse for creating templates. -// Deprecated: stream templates are deprecated and will be removed in a future version. -type JSApiStreamTemplateCreateResponse struct { +// JSApiConsumerResetRequest is for resetting a consumer to a specific sequence. +type JSApiConsumerResetRequest struct { + Seq uint64 `json:"seq,omitempty"` +} + +// JSApiConsumerResetResponse is a superset of JSApiConsumerCreateResponse, but including an explicit ResetSeq. +type JSApiConsumerResetResponse struct { ApiResponse - *StreamTemplateInfo + *ConsumerInfo + ResetSeq uint64 `json:"reset_seq"` } -// Deprecated: stream templates are deprecated and will be removed in a future version. -const JSApiStreamTemplateCreateResponseType = "io.nats.jetstream.api.v1.stream_template_create_response" - -// Deprecated: stream templates are deprecated and will be removed in a future version. -type JSApiStreamTemplateDeleteResponse struct { - ApiResponse - Success bool `json:"success,omitempty"` -} - -// Deprecated: stream templates are deprecated and will be removed in a future version. -const JSApiStreamTemplateDeleteResponseType = "io.nats.jetstream.api.v1.stream_template_delete_response" - -// JSApiStreamTemplateInfoResponse for information about stream templates. -// Deprecated: stream templates are deprecated and will be removed in a future version. -type JSApiStreamTemplateInfoResponse struct { - ApiResponse - *StreamTemplateInfo -} - -// Deprecated: stream templates are deprecated and will be removed in a future version. -const JSApiStreamTemplateInfoResponseType = "io.nats.jetstream.api.v1.stream_template_info_response" - -// Deprecated: stream templates are deprecated and will be removed in a future version. -type JSApiStreamTemplatesRequest struct { - ApiPagedRequest -} - -// JSApiStreamTemplateNamesResponse list of templates -// Deprecated: stream templates are deprecated and will be removed in a future version. -type JSApiStreamTemplateNamesResponse struct { - ApiResponse - ApiPaged - Templates []string `json:"streams"` -} - -// Deprecated: stream templates are deprecated and will be removed in a future version. -const JSApiStreamTemplateNamesResponseType = "io.nats.jetstream.api.v1.stream_template_names_response" +const JSApiConsumerResetResponseType = "io.nats.jetstream.api.v1.consumer_reset_response" // Structure that holds state for a JetStream API request that is processed // in a separate long-lived go routine. This is to avoid blocking connections. @@ -911,11 +863,19 @@ func (js *jetStream) apiDispatch(sub *subscription, c *client, acc *Account, sub // Copy the state. Note the JSAPI only uses the hdr index to piece apart the // header from the msg body. No other references are needed. // Check pending and warn if getting backed up. - pending, _ := s.jsAPIRoutedReqs.push(&jsAPIRoutedReq{jsub, sub, acc, subject, reply, copyBytes(rmsg), c.pa}) - limit := atomic.LoadInt64(&js.queueLimit) + var queue *ipQueue[*jsAPIRoutedReq] + var limit int64 + if js.infoSubs.HasInterest(subject) { + queue = s.jsAPIRoutedInfoReqs + limit = atomic.LoadInt64(&js.infoQueueLimit) + } else { + queue = s.jsAPIRoutedReqs + limit = atomic.LoadInt64(&js.queueLimit) + } + pending, _ := queue.push(&jsAPIRoutedReq{jsub, sub, acc, subject, reply, copyBytes(rmsg), c.pa}) if pending >= int(limit) { - s.rateLimitFormatWarnf("JetStream API queue limit reached, dropping %d requests", pending) - drained := int64(s.jsAPIRoutedReqs.drain()) + s.rateLimitFormatWarnf("%s limit reached, dropping %d requests", queue.name, pending) + drained := int64(queue.drain()) atomic.AddInt64(&js.apiInflight, -drained) s.publishAdvisory(nil, JSAdvisoryAPILimitReached, JSAPILimitReachedAdvisory{ @@ -935,29 +895,45 @@ func (s *Server) processJSAPIRoutedRequests() { defer s.grWG.Done() s.mu.RLock() - queue := s.jsAPIRoutedReqs + queue, infoqueue := s.jsAPIRoutedReqs, s.jsAPIRoutedInfoReqs client := &client{srv: s, kind: JETSTREAM} s.mu.RUnlock() js := s.getJetStream() + processFromQueue := func(ipq *ipQueue[*jsAPIRoutedReq]) { + // Only pop one item at a time here, otherwise if the system is recovering + // from queue buildup, then one worker will pull off all the tasks and the + // others will be starved of work. + if r, ok := ipq.popOne(); ok && r != nil { + client.pa = r.pa + start := time.Now() + r.jsub.icb(r.sub, client, r.acc, r.subject, r.reply, r.msg) + if dur := time.Since(start); dur >= readLoopReportThreshold { + s.Warnf("Internal subscription on %q took too long: %v", r.subject, dur) + } + atomic.AddInt64(&js.apiInflight, -1) + } + } + for { + // First select case is prioritizing queue, we will only fall through + // to the second select case that considers infoqueue if queue is empty. + // This effectively means infos are deprioritized. select { case <-queue.ch: - // Only pop one item at a time here, otherwise if the system is recovering - // from queue buildup, then one worker will pull off all the tasks and the - // others will be starved of work. - for r, ok := queue.popOne(); ok && r != nil; r, ok = queue.popOne() { - client.pa = r.pa - start := time.Now() - r.jsub.icb(r.sub, client, r.acc, r.subject, r.reply, r.msg) - if dur := time.Since(start); dur >= readLoopReportThreshold { - s.Warnf("Internal subscription on %q took too long: %v", r.subject, dur) - } - atomic.AddInt64(&js.apiInflight, -1) - } + processFromQueue(queue) case <-s.quitCh: return + default: + select { + case <-infoqueue.ch: + processFromQueue(infoqueue) + case <-queue.ch: + processFromQueue(queue) + case <-s.quitCh: + return + } } } } @@ -976,7 +952,8 @@ func (s *Server) setJetStreamExportSubs() error { if mp > maxProcs { mp = maxProcs } - s.jsAPIRoutedReqs = newIPQueue[*jsAPIRoutedReq](s, "Routed JS API Requests") + s.jsAPIRoutedReqs = newIPQueue[*jsAPIRoutedReq](s, "JetStream API queue") + s.jsAPIRoutedInfoReqs = newIPQueue[*jsAPIRoutedReq](s, "JetStream API info queue") for i := 0; i < mp; i++ { s.startGoRoutine(s.processJSAPIRoutedRequests) } @@ -992,20 +969,13 @@ func (s *Server) setJetStreamExportSubs() error { } // API handles themselves. + // infopairs are deprioritized compared to pairs in processJSAPIRoutedRequests. pairs := []struct { subject string handler msgHandler }{ - {JSApiAccountInfo, s.jsAccountInfoRequest}, - {JSApiTemplateCreate, s.jsTemplateCreateRequest}, - {JSApiTemplates, s.jsTemplateNamesRequest}, - {JSApiTemplateInfo, s.jsTemplateInfoRequest}, - {JSApiTemplateDelete, s.jsTemplateDeleteRequest}, {JSApiStreamCreate, s.jsStreamCreateRequest}, {JSApiStreamUpdate, s.jsStreamUpdateRequest}, - {JSApiStreams, s.jsStreamNamesRequest}, - {JSApiStreamList, s.jsStreamListRequest}, - {JSApiStreamInfo, s.jsStreamInfoRequest}, {JSApiStreamDelete, s.jsStreamDeleteRequest}, {JSApiStreamPurge, s.jsStreamPurgeRequest}, {JSApiStreamSnapshot, s.jsStreamSnapshotRequest}, @@ -1018,23 +988,40 @@ func (s *Server) setJetStreamExportSubs() error { {JSApiConsumerCreateEx, s.jsConsumerCreateRequest}, {JSApiConsumerCreate, s.jsConsumerCreateRequest}, {JSApiDurableCreate, s.jsConsumerCreateRequest}, - {JSApiConsumers, s.jsConsumerNamesRequest}, - {JSApiConsumerList, s.jsConsumerListRequest}, - {JSApiConsumerInfo, s.jsConsumerInfoRequest}, {JSApiConsumerDelete, s.jsConsumerDeleteRequest}, {JSApiConsumerPause, s.jsConsumerPauseRequest}, {JSApiConsumerUnpin, s.jsConsumerUnpinRequest}, } + infopairs := []struct { + subject string + handler msgHandler + }{ + {JSApiAccountInfo, s.jsAccountInfoRequest}, + {JSApiStreams, s.jsStreamNamesRequest}, + {JSApiStreamList, s.jsStreamListRequest}, + {JSApiStreamInfo, s.jsStreamInfoRequest}, + {JSApiConsumers, s.jsConsumerNamesRequest}, + {JSApiConsumerList, s.jsConsumerListRequest}, + {JSApiConsumerInfo, s.jsConsumerInfoRequest}, + } js.mu.Lock() defer js.mu.Unlock() - for _, p := range pairs { + // As well as populating js.apiSubs for the dispatch function to use, we + // will also populate js.infoSubs, so that the dispatch function can + // decide quickly whether or not the request is an info request or not. + for _, p := range append(infopairs, pairs...) { sub := &subscription{subject: []byte(p.subject), icb: p.handler} if err := js.apiSubs.Insert(sub); err != nil { return err } } + for _, p := range infopairs { + if err := js.infoSubs.Insert(p.subject, struct{}{}); err != nil { + return err + } + } return nil } @@ -1239,7 +1226,7 @@ func (s *Server) unmarshalRequest(c *client, acc *Account, subject string, msg [ c.RateLimitWarnf("Invalid JetStream request '%s > %s': %s", acc, subject, err) - if s.JetStreamConfig().Strict { + if js := s.getJetStream(); js != nil && js.config.Strict { return err } @@ -1345,10 +1332,6 @@ func (s *Server) jsAccountInfoRequest(sub *subscription, c *client, _ *Account, } // Helpers for token extraction. -func templateNameFromSubject(subject string) string { - return tokenAt(subject, 6) -} - func streamNameFromSubject(subject string) string { return tokenAt(subject, 5) } @@ -1357,223 +1340,6 @@ func consumerNameFromSubject(subject string) string { return tokenAt(subject, 6) } -// Request to create a new template. -// Deprecated: stream templates are deprecated and will be removed in a future version. -func (s *Server) jsTemplateCreateRequest(sub *subscription, c *client, _ *Account, subject, reply string, rmsg []byte) { - if c == nil { - return - } - ci, acc, hdr, msg, err := s.getRequestInfo(c, rmsg) - if err != nil { - s.Warnf(badAPIRequestT, msg) - return - } - - var resp = JSApiStreamTemplateCreateResponse{ApiResponse: ApiResponse{Type: JSApiStreamTemplateCreateResponseType}} - if errorOnRequiredApiLevel(hdr) { - resp.Error = NewJSRequiredApiLevelError() - s.sendAPIErrResponse(ci, acc, subject, reply, string(msg), s.jsonResponse(&resp)) - return - } - if !acc.JetStreamEnabled() { - resp.Error = NewJSNotEnabledForAccountError() - s.sendAPIErrResponse(ci, acc, subject, reply, string(msg), s.jsonResponse(&resp)) - return - } - - // Not supported for now. - if s.JetStreamIsClustered() { - resp.Error = NewJSClusterUnSupportFeatureError() - s.sendAPIErrResponse(ci, acc, subject, reply, string(msg), s.jsonResponse(&resp)) - return - } - - var cfg StreamTemplateConfig - if err := s.unmarshalRequest(c, acc, subject, msg, &cfg); err != nil { - resp.Error = NewJSInvalidJSONError(err) - s.sendAPIErrResponse(ci, acc, subject, reply, string(msg), s.jsonResponse(&resp)) - return - } - templateName := templateNameFromSubject(subject) - if templateName != cfg.Name { - resp.Error = NewJSTemplateNameNotMatchSubjectError() - s.sendAPIErrResponse(ci, acc, subject, reply, string(msg), s.jsonResponse(&resp)) - return - } - - t, err := acc.addStreamTemplate(&cfg) - if err != nil { - resp.Error = NewJSStreamTemplateCreateError(err, Unless(err)) - s.sendAPIErrResponse(ci, acc, subject, reply, string(msg), s.jsonResponse(&resp)) - return - } - t.mu.Lock() - tcfg := t.StreamTemplateConfig.deepCopy() - streams := t.streams - if streams == nil { - streams = []string{} - } - t.mu.Unlock() - resp.StreamTemplateInfo = &StreamTemplateInfo{Config: tcfg, Streams: streams} - s.sendAPIResponse(ci, acc, subject, reply, string(msg), s.jsonResponse(resp)) -} - -// Request for the list of all template names. -// Deprecated: stream templates are deprecated and will be removed in a future version. -func (s *Server) jsTemplateNamesRequest(sub *subscription, c *client, _ *Account, subject, reply string, rmsg []byte) { - if c == nil { - return - } - ci, acc, hdr, msg, err := s.getRequestInfo(c, rmsg) - if err != nil { - s.Warnf(badAPIRequestT, msg) - return - } - - var resp = JSApiStreamTemplateNamesResponse{ApiResponse: ApiResponse{Type: JSApiStreamTemplateNamesResponseType}} - if errorOnRequiredApiLevel(hdr) { - resp.Error = NewJSRequiredApiLevelError() - s.sendAPIErrResponse(ci, acc, subject, reply, string(msg), s.jsonResponse(&resp)) - return - } - if !acc.JetStreamEnabled() { - resp.Error = NewJSNotEnabledForAccountError() - s.sendAPIErrResponse(ci, acc, subject, reply, string(msg), s.jsonResponse(&resp)) - return - } - - // Not supported for now. - if s.JetStreamIsClustered() { - resp.Error = NewJSClusterUnSupportFeatureError() - s.sendAPIErrResponse(ci, acc, subject, reply, string(msg), s.jsonResponse(&resp)) - return - } - - var offset int - if isJSONObjectOrArray(msg) { - var req JSApiStreamTemplatesRequest - if err := s.unmarshalRequest(c, acc, subject, msg, &req); err != nil { - resp.Error = NewJSInvalidJSONError(err) - s.sendAPIErrResponse(ci, acc, subject, reply, string(msg), s.jsonResponse(&resp)) - return - } - offset = req.Offset - } - - ts := acc.templates() - slices.SortFunc(ts, func(i, j *streamTemplate) int { - return cmp.Compare(i.StreamTemplateConfig.Name, j.StreamTemplateConfig.Name) - }) - - tcnt := len(ts) - if offset > tcnt { - offset = tcnt - } - - for _, t := range ts[offset:] { - t.mu.Lock() - name := t.Name - t.mu.Unlock() - resp.Templates = append(resp.Templates, name) - if len(resp.Templates) >= JSApiNamesLimit { - break - } - } - resp.Total = tcnt - resp.Limit = JSApiNamesLimit - resp.Offset = offset - if resp.Templates == nil { - resp.Templates = []string{} - } - s.sendAPIResponse(ci, acc, subject, reply, string(msg), s.jsonResponse(resp)) -} - -// Request for information about a stream template. -// Deprecated: stream templates are deprecated and will be removed in a future version. -func (s *Server) jsTemplateInfoRequest(sub *subscription, c *client, _ *Account, subject, reply string, rmsg []byte) { - if c == nil { - return - } - ci, acc, hdr, msg, err := s.getRequestInfo(c, rmsg) - if err != nil { - s.Warnf(badAPIRequestT, msg) - return - } - - var resp = JSApiStreamTemplateInfoResponse{ApiResponse: ApiResponse{Type: JSApiStreamTemplateInfoResponseType}} - if errorOnRequiredApiLevel(hdr) { - resp.Error = NewJSRequiredApiLevelError() - s.sendAPIErrResponse(ci, acc, subject, reply, string(msg), s.jsonResponse(&resp)) - return - } - if !acc.JetStreamEnabled() { - resp.Error = NewJSNotEnabledForAccountError() - s.sendAPIErrResponse(ci, acc, subject, reply, string(msg), s.jsonResponse(&resp)) - return - } - if !isEmptyRequest(msg) { - resp.Error = NewJSNotEmptyRequestError() - s.sendAPIErrResponse(ci, acc, subject, reply, string(msg), s.jsonResponse(&resp)) - return - } - name := templateNameFromSubject(subject) - t, err := acc.lookupStreamTemplate(name) - if err != nil { - resp.Error = NewJSStreamTemplateNotFoundError() - s.sendAPIErrResponse(ci, acc, subject, reply, string(msg), s.jsonResponse(&resp)) - return - } - t.mu.Lock() - cfg := t.StreamTemplateConfig.deepCopy() - streams := t.streams - if streams == nil { - streams = []string{} - } - t.mu.Unlock() - - resp.StreamTemplateInfo = &StreamTemplateInfo{Config: cfg, Streams: streams} - s.sendAPIResponse(ci, acc, subject, reply, string(msg), s.jsonResponse(resp)) -} - -// Request to delete a stream template. -// Deprecated: stream templates are deprecated and will be removed in a future version. -func (s *Server) jsTemplateDeleteRequest(sub *subscription, c *client, _ *Account, subject, reply string, rmsg []byte) { - if c == nil { - return - } - ci, acc, hdr, msg, err := s.getRequestInfo(c, rmsg) - if err != nil { - s.Warnf(badAPIRequestT, msg) - return - } - - var resp = JSApiStreamTemplateDeleteResponse{ApiResponse: ApiResponse{Type: JSApiStreamTemplateDeleteResponseType}} - if errorOnRequiredApiLevel(hdr) { - resp.Error = NewJSRequiredApiLevelError() - s.sendAPIErrResponse(ci, acc, subject, reply, string(msg), s.jsonResponse(&resp)) - return - } - if !acc.JetStreamEnabled() { - resp.Error = NewJSNotEnabledForAccountError() - s.sendAPIErrResponse(ci, acc, subject, reply, string(msg), s.jsonResponse(&resp)) - return - } - if !isEmptyRequest(msg) { - resp.Error = NewJSNotEmptyRequestError() - s.sendAPIErrResponse(ci, acc, subject, reply, string(msg), s.jsonResponse(&resp)) - return - } - name := templateNameFromSubject(subject) - err = acc.deleteStreamTemplate(name) - if err != nil { - resp.Error = NewJSStreamTemplateDeleteError(err, Unless(err)) - s.sendAPIErrResponse(ci, acc, subject, reply, string(msg), s.jsonResponse(&resp)) - return - } - resp.Success = true - s.sendAPIResponse(ci, acc, subject, reply, string(msg), s.jsonResponse(resp)) -} - func (s *Server) jsonResponse(v any) string { b, err := json.Marshal(v) if err != nil { @@ -2109,7 +1875,7 @@ func (s *Server) jsStreamInfoRequest(sub *subscription, c *client, a *Account, s if cc != nil { // Check to make sure the stream is assigned. js.mu.RLock() - isLeader, sa := cc.isLeader(), js.streamAssignment(acc.Name, streamName) + isLeader, sa := cc.isLeader(), js.streamAssignmentOrInflight(acc.Name, streamName) var offline bool if sa != nil { clusterWideConsCount = len(sa.consumers) @@ -2338,7 +2104,7 @@ func (s *Server) jsStreamLeaderStepDownRequest(sub *subscription, c *client, _ * } js.mu.RLock() - isLeader, sa := cc.isLeader(), js.streamAssignment(acc.Name, name) + isLeader, sa := cc.isLeader(), js.streamAssignmentOrInflight(acc.Name, name) js.mu.RUnlock() if isLeader && sa == nil { @@ -2455,7 +2221,7 @@ func (s *Server) jsConsumerLeaderStepDownRequest(sub *subscription, c *client, _ consumer := tokenAt(subject, 7) js.mu.RLock() - isLeader, sa := cc.isLeader(), js.streamAssignment(acc.Name, stream) + isLeader, sa := cc.isLeader(), js.streamAssignmentOrInflight(acc.Name, stream) js.mu.RUnlock() if isLeader && sa == nil { @@ -3456,7 +3222,7 @@ func (s *Server) jsMsgDeleteRequest(sub *subscription, c *client, _ *Account, su } js.mu.RLock() - isLeader, sa := cc.isLeader(), js.streamAssignment(acc.Name, stream) + isLeader, sa := cc.isLeader(), js.streamAssignmentOrInflight(acc.Name, stream) js.mu.RUnlock() if isLeader && sa == nil { @@ -3581,7 +3347,7 @@ func (s *Server) jsMsgGetRequest(sub *subscription, c *client, _ *Account, subje } js.mu.RLock() - isLeader, sa := cc.isLeader(), js.streamAssignment(acc.Name, stream) + isLeader, sa := cc.isLeader(), js.streamAssignmentOrInflight(acc.Name, stream) js.mu.RUnlock() if isLeader && sa == nil { @@ -3876,7 +3642,7 @@ func (s *Server) jsStreamPurgeRequest(sub *subscription, c *client, _ *Account, } js.mu.RLock() - isLeader, sa := cc.isLeader(), js.streamAssignment(acc.Name, stream) + isLeader, sa := cc.isLeader(), js.streamAssignmentOrInflight(acc.Name, stream) js.mu.RUnlock() if isLeader && sa == nil { @@ -4048,6 +3814,13 @@ func (s *Server) jsStreamRestoreRequest(sub *subscription, c *client, _ *Account return } + // Check for path like separators in the name. + if strings.ContainsAny(stream, `\/`) { + resp.Error = NewJSStreamNameContainsPathSeparatorsError() + s.sendAPIErrResponse(ci, acc, subject, reply, string(msg), s.jsonResponse(&resp)) + return + } + if s.JetStreamIsClustered() { s.jsClusteredStreamRestoreRequest(ci, acc, &req, subject, reply, rmsg) return @@ -4597,11 +4370,49 @@ func (s *Server) jsConsumerCreateRequest(sub *subscription, c *client, a *Accoun isClustered := s.JetStreamIsClustered() // Determine if we should proceed here when we are in clustered mode. + direct := req.Config.Direct if isClustered { - if req.Config.Direct { - // Check to see if we have this stream and are the stream leader. - if !acc.JetStreamIsStreamLeader(streamNameFromSubject(subject)) { - return + if direct { + // If it's just a direct consumer, check for stream leader. + if !req.Config.Sourcing { + // Check to see if we have this stream and are the stream leader. + if !acc.JetStreamIsStreamLeader(streamNameFromSubject(subject)) { + return + } + } else { + // Otherwise, we either need this to be answered by the stream or meta leader. + var cc *jetStreamCluster + js, cc = s.getJetStreamCluster() + if js == nil || cc == nil { + return + } + js.mu.RLock() + sa := js.streamAssignmentOrInflight(acc.Name, streamNameFromSubject(subject)) + if sa == nil { + js.mu.RUnlock() + return + } + // If the stream is WQ or Interest, we need the meta leader to answer. + if sa.Config.Retention != LimitsPolicy { + direct = false + } + js.mu.RUnlock() + if direct { + // Check to see if we have this stream and are the stream leader. + if !acc.JetStreamIsStreamLeader(streamNameFromSubject(subject)) { + return + } + } else { + if js.isLeaderless() { + resp.Error = NewJSClusterNotAvailError() + s.sendAPIErrResponse(ci, acc, subject, reply, string(msg), s.jsonResponse(&resp)) + return + } + // Make sure we are meta leader. + if !s.JetStreamIsLeader() { + return + } + } } } else { var cc *jetStreamCluster @@ -4645,6 +4456,7 @@ func (s *Server) jsConsumerCreateRequest(sub *subscription, c *client, a *Accoun // Legacy ephemeral. rt = ccLegacyEphemeral streamName = streamNameFromSubject(subject) + consumerName = req.Config.Name } else { // New style and durable legacy. if tokenAt(subject, 4) == "DURABLE" { @@ -4736,7 +4548,7 @@ func (s *Server) jsConsumerCreateRequest(sub *subscription, c *client, a *Accoun return } - if isClustered && !req.Config.Direct { + if isClustered && !direct { s.jsClusteredConsumerRequest(ci, acc, subject, reply, rmsg, req.Stream, &req.Config, req.Action, req.Pedantic) return } @@ -4760,6 +4572,23 @@ func (s *Server) jsConsumerCreateRequest(sub *subscription, c *client, a *Accoun return } + // If the consumer is a direct sourcing consumer, we need to "upgrade" + // it to be durable without AckNone if not a Limits-based stream. + if req.Config.Direct && req.Config.Sourcing && req.Config.Name != _EMPTY_ { + if !isClustered && stream.isInterestRetention() { + req.Config.Direct = false + req.Config.Durable = req.Config.Name + req.Config.AckPolicy = AckFlowControl + req.Config.AckWait = 0 + req.Config.MaxDeliver = 0 + req.Config.InactiveThreshold = 0 + } else { + // Otherwise, need to append a randomized suffix since the source uses a stable name. + req.Config.Name = fmt.Sprintf("%s-%s", req.Config.Name, createConsumerName()) + consumerName = req.Config.Name + } + } + if o := stream.lookupConsumer(consumerName); o != nil { if o.offlineReason != _EMPTY_ { resp.Error = NewJSConsumerOfflineReasonError(errors.New(o.offlineReason)) @@ -4770,6 +4599,12 @@ func (s *Server) jsConsumerCreateRequest(sub *subscription, c *client, a *Accoun // it back to whatever the current configured value is. o.mu.RLock() req.Config.PauseUntil = o.cfg.PauseUntil + // If a durable sourcing consumer is used, we need to reset the deliver policy. + if req.Config.Sourcing && req.Config.Durable != _EMPTY_ { + req.Config.DeliverPolicy = o.cfg.DeliverPolicy + req.Config.OptStartSeq = o.cfg.OptStartSeq + req.Config.OptStartTime = o.cfg.OptStartTime + } o.mu.RUnlock() } @@ -5079,7 +4914,7 @@ func (s *Server) jsConsumerInfoRequest(sub *subscription, c *client, _ *Account, groupCreated := meta.Created() js.mu.RLock() - isLeader, sa, ca := cc.isLeader(), js.streamAssignment(acc.Name, streamName), js.consumerAssignment(acc.Name, streamName, consumerName) + isLeader, sa, ca := cc.isLeader(), js.streamAssignmentOrInflight(acc.Name, streamName), js.consumerAssignmentOrInflight(acc.Name, streamName, consumerName) var rg *raftGroup var offline, isMember bool if ca != nil { @@ -5404,8 +5239,11 @@ func (s *Server) jsConsumerPauseRequest(sub *subscription, c *client, _ *Account return } - nca := *ca + nca := ca.clone() + // We're only holding the read lock and release below, + // we need a copy to prevent concurrent reads/writes. ncfg := *ca.Config + ncfg.Metadata = maps.Clone(ncfg.Metadata) nca.Config = &ncfg meta := cc.meta js.mu.RUnlock() @@ -5420,7 +5258,7 @@ func (s *Server) jsConsumerPauseRequest(sub *subscription, c *client, _ *Account // Only PauseUntil is updated above, so reuse config for both. setStaticConsumerMetadata(nca.Config) - eca := encodeAddConsumerAssignment(&nca) + eca := encodeAddConsumerAssignment(nca) meta.Propose(eca) resp.PauseUntil = pauseUTC @@ -5453,7 +5291,13 @@ func (s *Server) jsConsumerPauseRequest(sub *subscription, c *client, _ *Account return } + // We're only holding the read lock and release below, + // we need a copy to prevent concurrent reads/writes. + obs.mu.RLock() ncfg := obs.cfg + ncfg.Metadata = maps.Clone(ncfg.Metadata) + obs.mu.RUnlock() + pauseUTC := req.PauseUntil.UTC() if !pauseUTC.IsZero() { ncfg.PauseUntil = &pauseUTC diff --git a/vendor/github.com/nats-io/nats-server/v2/server/jetstream_batching.go b/vendor/github.com/nats-io/nats-server/v2/server/jetstream_batching.go index a8793e546..4b04241fa 100644 --- a/vendor/github.com/nats-io/nats-server/v2/server/jetstream_batching.go +++ b/vendor/github.com/nats-io/nats-server/v2/server/jetstream_batching.go @@ -21,6 +21,7 @@ import ( "math/big" "path/filepath" "slices" + "strconv" "strings" "sync" "sync/atomic" @@ -29,60 +30,105 @@ import ( var ( // Tracks the total inflight batches, across all streams and accounts that enable batching. - globalInflightBatches atomic.Int32 + globalInflightAtomicBatches atomic.Int64 + globalInflightFastBatches atomic.Int64 ) type batching struct { - mu sync.Mutex - group map[string]*batchGroup + mu sync.Mutex + atomic map[string]*atomicBatch + fast map[string]*fastBatch } -type batchGroup struct { - lseq uint64 - store StreamStore - timer *time.Timer +type atomicBatch struct { + timer *time.Timer // Inactivity timer for the batch. + lseq uint64 // The highest sequence for this batch. + store StreamStore // Where the batch is staged before committing. } +type fastBatch struct { + timer *time.Timer // Inactivity timer for the batch. + lseq uint64 // The highest sequence for this batch. + sseq uint64 // Last persisted stream sequence. + pseq uint64 // Last persisted batch sequence (is always lower or equal to lseq). + fseq uint64 // Sequence of when we last sent a flow message (is always lower or equal to pseq). + pending uint32 // Number of pending messages in the batch waiting to be persisted. + ackMessages uint16 // Ack will be sent every N messages. + maxAckMessages uint16 // Maximum ackMessages value the client allows. + reply string // The last reply subject seen when persisting a message. + gapOk bool // Whether a gap is okay, if not, the batch would be rejected. + commit bool // If the batch is committed. +} + +// newAtomicBatch creates an atomic batch publish object. // Lock should be held. -func (batches *batching) newBatchGroup(mset *stream, batchId string) (*batchGroup, error) { - store, err := newBatchStore(mset, batchId) +func (batches *batching) newAtomicBatch(mset *stream, batchId string, replicas int, storage StorageType, storeDir, streamName string) (*atomicBatch, error) { + store, err := newBatchStore(mset, batchId, replicas, storage, storeDir, streamName) if err != nil { return nil, err } - b := &batchGroup{store: store} + b := &atomicBatch{store: store} + b.setupCleanupTimer(mset, batchId, batches) + return b, nil +} +// setupCleanupTimer sets up a timer to clean up the batch after a timeout. +func (b *atomicBatch) setupCleanupTimer(mset *stream, batchId string, batches *batching) { // Create a timer to clean up after timeout. - timeout := streamMaxBatchTimeout - if maxBatchTimeout := mset.srv.getOpts().JetStreamLimits.MaxBatchTimeout; maxBatchTimeout > 0 { - timeout = maxBatchTimeout - } + timeout := getCleanupTimeout(mset) b.timer = time.AfterFunc(timeout, func() { b.cleanup(batchId, batches) mset.sendStreamBatchAbandonedAdvisory(batchId, BatchTimeout) }) - return b, nil } -func getBatchStoreDir(mset *stream, batchId string) (string, string) { - mset.mu.RLock() - jsa, name := mset.jsa, mset.cfg.Name - mset.mu.RUnlock() +// resetCleanupTimer resets the cleanup timer, allowing to extend the lifetime of the batch. +// Returns whether the timer was reset without it having expired before. +func (b *atomicBatch) resetCleanupTimer(mset *stream) bool { + timeout := getCleanupTimeout(mset) + return b.timer.Reset(timeout) +} - jsa.mu.RLock() - sd := jsa.storeDir - jsa.mu.RUnlock() +// cleanup deletes underlying resources associated with the batch and unregisters it from the stream's batches. +func (b *atomicBatch) cleanup(batchId string, batches *batching) { + batches.mu.Lock() + defer batches.mu.Unlock() + b.cleanupLocked(batchId, batches) +} +// Lock should be held. +func (b *atomicBatch) cleanupLocked(batchId string, batches *batching) { + if b.timer == nil { + return + } + globalInflightAtomicBatches.Add(-1) + b.timer.Stop() + b.store.Delete(true) + delete(batches.atomic, batchId) + // Reset so that another invocation doesn't double-account. + b.timer = nil +} + +// Lock should be held. +func (b *atomicBatch) stopLocked() { + if b.timer == nil { + return + } + globalInflightAtomicBatches.Add(-1) + b.timer.Stop() + b.store.Stop() + // Reset so that another invocation doesn't double-account. + b.timer = nil +} + +func getBatchStoreDir(storeDir, streamName, batchId string) (string, string) { bname := getHash(batchId) - return bname, filepath.Join(sd, streamsDir, name, batchesDir, bname) + return bname, filepath.Join(storeDir, streamsDir, streamName, batchesDir, bname) } -func newBatchStore(mset *stream, batchId string) (StreamStore, error) { - mset.mu.RLock() - replicas, storage := mset.cfg.Replicas, mset.cfg.Storage - mset.mu.RUnlock() - +func newBatchStore(mset *stream, batchId string, replicas int, storage StorageType, storeDir, streamName string) (StreamStore, error) { if replicas == 1 && storage == FileStorage { - bname, storeDir := getBatchStoreDir(mset, batchId) + bname, storeDir := getBatchStoreDir(storeDir, streamName, batchId) fcfg := FileStoreConfig{AsyncFlush: true, BlockSize: defaultLargeBlockSize, StoreDir: storeDir} s := mset.srv prf := s.jsKeyGen(s.getOpts().JetStreamKey, mset.acc.Name) @@ -101,34 +147,264 @@ func newBatchStore(mset *stream, batchId string) (StreamStore, error) { // If the timer has already cleaned up the batch, we can't commit. // Otherwise, we ensure the timer does not clean up the batch in the meantime. // Lock should be held. -func (b *batchGroup) readyForCommit() bool { +func (b *atomicBatch) readyForCommit() *BatchAbandonReason { if !b.timer.Stop() { + return &BatchTimeout + } + if b.store.FlushAllPending() != nil { + return &BatchIncomplete + } + return nil +} + +// newFastBatch creates a fast batch publish object and registers it in batches.fast. +// Lock should be held. +func (batches *batching) newFastBatch(mset *stream, batchId string, gapOk bool, maxAckMessages uint16) *fastBatch { + b := &fastBatch{gapOk: gapOk, maxAckMessages: maxAckMessages} + if batches.fast == nil { + batches.fast = make(map[string]*fastBatch, 1) + } + batches.fast[batchId] = b + batches.fastBatchInit(b) + b.setupCleanupTimer(mset, batchId, batches) + return b +} + +// fastBatchInit (re)initializes the ackMessages field for a fast batch. +// The batch must already be registered in batches.fast. +// Lock should be held. +func (batches *batching) fastBatchInit(b *fastBatch) { + // If it's the only batch, just allow what the client wants, otherwise we'll + // need to coordinate and slowly ramp up this publisher. + // TODO(mvv): fast ingest's initial flow value improvements? + ackMessages := min(500, b.maxAckMessages) + if len(batches.fast) > 1 { + ackMessages = 1 + } + b.ackMessages = ackMessages +} + +// fastBatchReset resets the fast batch to an empty state and sends a flow control message. +// Lock should be held. +func (batches *batching) fastBatchReset(mset *stream, batchId string, b *fastBatch) { + // If the timer already stopped before we could commit, we clean it up. + if b.timer == nil || (!b.commit && !b.timer.Stop()) { + b.cleanupLocked(batchId, batches) + return + } + // Otherwise, reset the state. + batches.fastBatchInit(b) + b.timer.Reset(getCleanupTimeout(mset)) + b.commit = false + b.pending = 0 + b.fseq, b.lseq = b.pseq, b.pseq + b.sendFlowControl(b.fseq, mset, b.reply) +} + +// fastBatchRegisterSequences registers the highest stored batch and stream sequence and returns +// whether a PubAck should be sent if the batch has been committed. +// If this is called on a follower, it only registers the highest stream and persisted batch sequences. +// Lock should be held. +func (batches *batching) fastBatchRegisterSequences(mset *stream, reply string, streamSeq uint64, isLeader bool, batch *FastBatch) bool { + b, ok := batches.fast[batch.id] + if !ok || !isLeader { + // If this batch has committed, we can clean it up. + if batch.commit { + if b != nil { + b.cleanupLocked(batch.id, batches) + } + return false + } + // Otherwise, even as a follower, we record the latest state of this batch. + if b == nil || !b.resetCleanupTimer(mset) { + if b != nil { + // The timer couldn't be reset, this means the timer already runs and is likely + // waiting to acquire the lock. We reset the timer here so it doesn't clean up + // this batch that we're about to overwrite. + b.timer = nil + } else { + // If this is a new batch for us, even though we're a follower, we still need + // to account toward the global inflight limit. + globalInflightFastBatches.Add(1) + } + // We'll need a copy as we'll use it as a key and later for cleanup. + batchId := copyString(batch.id) + b = batches.newFastBatch(mset, batchId, batch.gapOk, batch.flow) + } + b.sseq = streamSeq + b.pseq, b.lseq = batch.seq, batch.seq + b.reply = reply return false } - b.store.FlushAllPending() + b.reply = reply + if b.pending > 0 { + b.pending-- + } + b.sseq = streamSeq + // Store last persisted batch sequence. + // If we have no remaining pending writes, we might have had duplicate messages + // and need to send additional flow control messages. + var skipped bool + if b.pending == 0 { + skipped = true + b.pseq = b.lseq + } else { + b.pseq = batch.seq + } + // If the PubAck needs to be sent now as a result of a commit. + if b.lseq == b.pseq && b.commit { + b.cleanupLocked(batch.id, batches) + // If we skipped ahead due to duplicate messages, send the PubAck with the highest sequence. + if skipped { + var buf [256]byte + pubAck := append(buf[:0], mset.pubAck...) + response := append(pubAck, strconv.FormatUint(b.sseq, 10)...) + response = append(response, fmt.Sprintf(",\"batch\":%q,\"count\":%d}", batch.id, b.lseq)...) + if len(reply) > 0 { + mset.outq.sendMsg(reply, response) + } + return false + } + return true + } + b.checkFlowControl(mset, reply, batches) + return false +} + +// checkFlowControl checks whether a flow control message should be sent. +// If so, it updates the flow values to speed up or slow down the publisher if needed. +// Returns whether a flow control message was sent. +// Lock should be held. +func (b *fastBatch) checkFlowControl(mset *stream, reply string, batches *batching) bool { + am := uint64(b.ackMessages) + if b.pseq < b.fseq+am { + return false + } + // Instead of sending multiple flow control messages, skip ahead to only send the last. + steps := (b.pseq - b.fseq) / am + b.fseq += steps * am + + // TODO(mvv): fast ingest's dynamic flow value improvements? + // This is currently just a simple value to have a working version. Should take average + // message sizes into account and compare how much this client is contributing to the + // ingest IPQ total size and messages and have publishers share based on that. + maxAckMessages := uint16(500 / len(batches.fast)) + if maxAckMessages < 1 { + maxAckMessages = 1 + } + // Limit to the client's allowed maximum. + if maxAckMessages > b.maxAckMessages { + maxAckMessages = b.maxAckMessages + } + + if b.ackMessages < maxAckMessages { + // Ramp up. + b.ackMessages *= 2 + if b.ackMessages > maxAckMessages { + b.ackMessages = maxAckMessages + } + } else if b.ackMessages > maxAckMessages { + // Slow down. + b.ackMessages /= 2 + if b.ackMessages <= maxAckMessages { + b.ackMessages = maxAckMessages + } + } + + // Finally, send the flow control message. + b.sendFlowControl(b.fseq, mset, reply) return true } +// sendFlowControl sends a fast batch flow control message for the current highest sequence. +// Lock should be held. +func (b *fastBatch) sendFlowControl(batchSeq uint64, mset *stream, reply string) { + if len(reply) == 0 { + return + } + response, _ := BatchFlowAck{Sequence: batchSeq, Messages: b.ackMessages}.MarshalJSON() + mset.outq.sendMsg(reply, response) +} + +// fastBatchCommit ends the batch and commits the data up to that point. If all messages +// have already been persisted, a PubAck is sent immediately. Otherwise, it will be sent +// after the last message has been persisted. +// Lock should be held. +func (batches *batching) fastBatchCommit(b *fastBatch, batchId string, mset *stream, reply string) bool { + // Either we commit now, or we clean up later, so stop the timer. + if b.timer == nil || (!b.commit && !b.timer.Stop()) { + // Shouldn't be possible for the timer to already be stopped if we haven't committed yet, + // since we pre-check being able to reset the timer. But guard against it anyhow. + return true + } + // Mark that this batch commits. + b.commit = true + // If the whole batch has been persisted, we can respond with the PubAck now. + if b.lseq == b.pseq { + b.cleanupLocked(batchId, batches) + var buf [256]byte + pubAck := append(buf[:0], mset.pubAck...) + response := append(pubAck, strconv.FormatUint(b.sseq, 10)...) + response = append(response, fmt.Sprintf(",\"batch\":%q,\"count\":%d}", batchId, b.lseq)...) + if len(reply) > 0 { + mset.outq.sendMsg(reply, response) + } + return true + } + // Otherwise, we need to wait and the PubAck will be sent when the last message is persisted. + return false +} + +// setupCleanupTimer sets up a timer to clean up the batch after a timeout. +func (b *fastBatch) setupCleanupTimer(mset *stream, batchId string, batches *batching) { + // Create a timer to clean up after timeout. + timeout := getCleanupTimeout(mset) + b.timer = time.AfterFunc(timeout, func() { + b.cleanup(batchId, batches) + }) +} + +// resetCleanupTimer resets the cleanup timer, allowing to extend the lifetime of the batch. +// Returns whether the timer was reset without it having expired before. +func (b *fastBatch) resetCleanupTimer(mset *stream) bool { + if b.commit { + return true + } + if b.timer == nil { + return false + } + timeout := getCleanupTimeout(mset) + return b.timer.Reset(timeout) +} + // cleanup deletes underlying resources associated with the batch and unregisters it from the stream's batches. -func (b *batchGroup) cleanup(batchId string, batches *batching) { +func (b *fastBatch) cleanup(batchId string, batches *batching) { batches.mu.Lock() defer batches.mu.Unlock() b.cleanupLocked(batchId, batches) } // Lock should be held. -func (b *batchGroup) cleanupLocked(batchId string, batches *batching) { - globalInflightBatches.Add(-1) +func (b *fastBatch) cleanupLocked(batchId string, batches *batching) { + // If the timer is nil, it means this batch has been replaced with a new one. + // This can happen on a follower depending on timing. + if b.timer == nil { + return + } + globalInflightFastBatches.Add(-1) b.timer.Stop() - b.store.Delete(true) - delete(batches.group, batchId) + delete(batches.fast, batchId) + // Reset so that another invocation doesn't double-account. + b.timer = nil } -// Lock should be held. -func (b *batchGroup) stopLocked() { - globalInflightBatches.Add(-1) - b.timer.Stop() - b.store.Stop() +// getCleanupTimeout returns the timeout for the batch, taking into account the server's limits. +func getCleanupTimeout(mset *stream) time.Duration { + timeout := streamMaxBatchTimeout + if maxBatchTimeout := mset.srv.getOpts().JetStreamLimits.MaxBatchTimeout; maxBatchTimeout > 0 { + timeout = maxBatchTimeout + } + return timeout } // batchStagedDiff stages all changes for consistency checks until commit. @@ -136,6 +412,7 @@ type batchStagedDiff struct { msgIds map[string]struct{} counter map[string]*msgCounterRunningTotal inflight map[string]*inflightSubjectRunningTotal + inflightTransform map[uint64]string expectedPerSubject map[string]*batchExpectedPerSubject } @@ -180,6 +457,16 @@ func (diff *batchStagedDiff) commit(mset *stream) { } } + // Track inflight subject transforms. + if len(diff.inflightTransform) > 0 { + if mset.inflightTransform == nil { + mset.inflightTransform = make(map[uint64]string, len(diff.inflightTransform)) + } + for clseq, subj := range diff.inflightTransform { + mset.inflightTransform[clseq] = subj + } + } + // Track sequence and subject. if len(diff.expectedPerSubject) > 0 { if mset.expectedPerSubjectSequence == nil { @@ -238,7 +525,7 @@ func (batch *batchApply) rejectBatchState(mset *stream) { // mset.mu lock must NOT be held or used. // mset.clMu lock must be held. func checkMsgHeadersPreClusteredProposal( - diff *batchStagedDiff, mset *stream, subject string, hdr []byte, msg []byte, sourced bool, name string, + diff *batchStagedDiff, mset *stream, subject, rsubject string, hdr []byte, msg []byte, sourced bool, name string, jsa *jsAccount, allowRollup, denyPurge, allowTTL, allowMsgCounter, allowMsgSchedules bool, discard DiscardPolicy, discardNewPer bool, maxMsgSize int, maxMsgs int64, maxMsgsPer int64, maxBytes int64, ) ([]byte, []byte, uint64, *ApiError, error) { @@ -515,8 +802,9 @@ func checkMsgHeadersPreClusteredProposal( } // Message scheduling. - if schedule, ok := getMessageSchedule(hdr); !ok { - apiErr := NewJSMessageSchedulesPatternInvalidError() + if sourced { + // noop, sourced messages were already validated by the origin stream. + } else if schedule, apiErr := getMessageSchedule(hdr); apiErr != nil { if !allowMsgSchedules { apiErr = NewJSMessageSchedulesDisabledError() } @@ -528,22 +816,40 @@ func checkMsgHeadersPreClusteredProposal( } else if scheduleTtl, ok := getMessageScheduleTTL(hdr); !ok { apiErr := NewJSMessageSchedulesTTLInvalidError() return hdr, msg, 0, apiErr, apiErr + } else if scheduleRollup := getMessageScheduleRollup(hdr); scheduleRollup != _EMPTY_ && scheduleRollup != JSMsgRollupSubject { + apiErr := NewJSMessageSchedulesRollupInvalidError() + return hdr, msg, 0, apiErr, apiErr } else if scheduleTtl != _EMPTY_ && !allowTTL { return hdr, msg, 0, NewJSMessageTTLDisabledError(), errMsgTTLDisabled } else if scheduleTarget := getMessageScheduleTarget(hdr); scheduleTarget == _EMPTY_ || - !IsValidPublishSubject(scheduleTarget) || SubjectsCollide(scheduleTarget, subject) { + !IsValidPublishSubject(scheduleTarget) || scheduleTarget == subject { apiErr := NewJSMessageSchedulesTargetInvalidError() return hdr, msg, 0, apiErr, apiErr + } else if scheduleSource := getMessageScheduleSource(hdr); scheduleSource != _EMPTY_ && + (scheduleSource == scheduleTarget || scheduleSource == subject || !IsValidPublishSubject(scheduleSource)) { + apiErr := NewJSMessageSchedulesSourceInvalidError() + return hdr, msg, 0, apiErr, apiErr } else { mset.cfgMu.RLock() match := slices.ContainsFunc(mset.cfg.Subjects, func(subj string) bool { return SubjectsCollide(subj, scheduleTarget) }) - mset.cfgMu.RUnlock() if !match { + mset.cfgMu.RUnlock() apiErr := NewJSMessageSchedulesTargetInvalidError() return hdr, msg, 0, apiErr, apiErr } + if scheduleSource != _EMPTY_ { + match = slices.ContainsFunc(mset.cfg.Subjects, func(subj string) bool { + return SubjectsCollide(subj, scheduleSource) + }) + if !match { + mset.cfgMu.RUnlock() + apiErr := NewJSMessageSchedulesSourceInvalidError() + return hdr, msg, 0, apiErr, apiErr + } + } + mset.cfgMu.RUnlock() // Add a rollup sub header if it doesn't already exist. // Otherwise, it must exist already as a rollup on the subject. @@ -555,10 +861,32 @@ func checkMsgHeadersPreClusteredProposal( } } } + if scheduleNext := sliceHeader(JSScheduleNext, hdr); len(scheduleNext) > 0 && !sourced { + // Clients may only use Nats-Schedule-Next to purge a schedule. + if bytesToString(scheduleNext) != JSScheduleNextPurge { + apiErr := NewJSMessageSchedulesSchedulerInvalidError() + return hdr, msg, 0, apiErr, apiErr + } + // Nats-Scheduler must accompany the purge and: + // - it must NOT be empty. + // - it must NOT match the publish subject. + if scheduler := sliceHeader(JSScheduler, hdr); len(scheduler) == 0 || + bytesToString(scheduler) == subject || !IsValidPublishSubject(bytesToString(scheduler)) { + apiErr := NewJSMessageSchedulesSchedulerInvalidError() + return hdr, msg, 0, apiErr, apiErr + } else if !allowMsgSchedules { + apiErr := NewJSMessageSchedulesDisabledError() + return hdr, msg, 0, apiErr, apiErr + } + } else if !sourced && len(sliceHeader(JSScheduler, hdr)) > 0 { + // Clients may only use Nats-Scheduler alongside Nats-Schedule-Next. + apiErr := NewJSMessageSchedulesSchedulerInvalidError() + return hdr, msg, 0, apiErr, apiErr + } // Check for any rollups. if rollup := getRollup(hdr); rollup != _EMPTY_ { - if !allowRollup || denyPurge { + if (!allowRollup || denyPurge) && !sourced { err := errors.New("rollup not permitted") return hdr, msg, 0, NewJSStreamRollupFailedError(err), err } @@ -607,6 +935,19 @@ func checkMsgHeadersPreClusteredProposal( diff.inflight[subject] = i } + // Subject transform. + if subject != rsubject { + // The 'subject' is a transformed subject used for consistency checks. + // But since we propose the original (raw) subject to our peers, we need + // to store the transformed subject separately for when we apply. + // TODO(mvv): since subject transforms are handled by each replica individually, this has a + // potential for desync given out-of-order stream subject transform updates. + if diff.inflightTransform == nil { + diff.inflightTransform = make(map[uint64]string, 1) + } + diff.inflightTransform[mset.clseq] = subject + } + // Check if we have discard new with max msgs or bytes. // We need to deny here otherwise we'd need to bump CLFS, and it could succeed on some // peers and not others depending on consumer ack state (if interest policy). @@ -639,7 +980,8 @@ func checkMsgHeadersPreClusteredProposal( } // Similarly, check DiscardNew per-subject threshold to not need to bump CLFS. - if discardNewPer && maxMsgsPer > 0 { + // Allow rollup messages through since they will purge after storing. + if discardNewPer && maxMsgsPer > 0 && len(sliceHeader(JSMsgRollup, hdr)) == 0 { // Get the current total for this subject. totalMsgsForSubject := mset.store.SubjectsTotals(subject)[subject] // Add inflight count in this batch and for this stream. @@ -656,3 +998,68 @@ func checkMsgHeadersPreClusteredProposal( return hdr, msg, 0, nil, nil } + +// recalculateClusteredSeq initializes or updates mset.clseq, for example after a leader change. +// This is reused for normal clustered publishing into a stream, and for atomic and fast batch publishing. +// mset.clMu lock must be held. +func recalculateClusteredSeq(mset *stream, needStreamLock bool) (lseq uint64) { + // Need to unlock and re-acquire the locks in the proper order. + mset.clMu.Unlock() + // Locking order is stream -> batchMu -> clMu + if needStreamLock { + mset.mu.RLock() + } + batch := mset.batchApply + var batchCount uint64 + if batch != nil { + batch.mu.Lock() + batchCount = batch.count + } + mset.clMu.Lock() + // Re-capture + lseq = mset.lseq + mset.clseq = lseq + mset.clfs + batchCount + // Keep hold of the mset.clMu, but unlock the others. + if batch != nil { + batch.mu.Unlock() + } + if needStreamLock { + mset.mu.RUnlock() + } + return lseq +} + +// commitSingleMsg commits and proposes a single message to the node. +// This is reused both for normal publishing into a stream, and for fast batch publishing. +// mset.clMu lock must be held. +func commitSingleMsg( + diff *batchStagedDiff, mset *stream, subject string, reply string, hdr []byte, msg []byte, name string, + jsa *jsAccount, mt *msgTrace, node RaftNode, replicas int, lseq uint64, +) error { + // Do proposal. + esm := encodeStreamMsgAllowCompress(subject, reply, hdr, msg, mset.clseq, time.Now().UnixNano(), false) + if err := node.Propose(esm); err != nil { + return err + } + + var mtKey uint64 + if mt != nil { + mtKey = mset.clseq + if mset.mt == nil { + mset.mt = make(map[uint64]*msgTrace) + } + mset.mt[mtKey] = mt + } + + diff.commit(mset) + mset.clseq++ + mset.trackReplicationTraffic(node, len(esm), replicas) + + // Check to see if we are being overrun. + // TODO(dlc) - Make this a limit where we drop messages to protect ourselves, but allow to be configured. + if mset.clseq-(lseq+mset.clfs) > streamLagWarnThreshold { + lerr := fmt.Errorf("JetStream stream '%s > %s' has high message lag", jsa.acc().Name, name) + mset.srv.RateLimitWarnf("%s", lerr.Error()) + } + return nil +} diff --git a/vendor/github.com/nats-io/nats-server/v2/server/jetstream_cluster.go b/vendor/github.com/nats-io/nats-server/v2/server/jetstream_cluster.go index ea524abe7..d406c7f1a 100644 --- a/vendor/github.com/nats-io/nats-server/v2/server/jetstream_cluster.go +++ b/vendor/github.com/nats-io/nats-server/v2/server/jetstream_cluster.go @@ -36,7 +36,6 @@ import ( "github.com/antithesishq/antithesis-sdk-go/assert" "github.com/klauspost/compress/s2" - "github.com/minio/highwayhash" "github.com/nats-io/nuid" ) @@ -54,6 +53,10 @@ type jetStreamCluster struct { // a response but they need to be same group, peers etc. and sync subjects. inflightStreams map[string]map[string]*inflightStreamInfo inflightConsumers map[string]map[string]map[string]*inflightConsumerInfo + // Tracks raft groups currently being started by createRaftGroup, so that + // concurrent callers for the same group can wait without holding js.mu + // across the disk I/O performed during startup. + creatingRaftGroups map[string]chan struct{} // Holds a map of a peer ID to the reply subject, to only respond after gaining // quorum on the peer-remove action. peerRemoveReply map[string]peerRemoveInfo @@ -145,6 +148,8 @@ const ( // Batch stream ops. batchMsgOp batchCommitMsgOp + // Consumer rest to specific starting sequence. + resetSeqOp ) // raftGroups are controlled by the metagroup controller. @@ -173,7 +178,7 @@ type streamAssignment struct { Restore *StreamState `json:"restore_state,omitempty"` // Internal consumers map[string]*consumerAssignment - responded bool + responded atomic.Bool // copied via clone() to satisfy go vet's noCopy check recovering bool reassigning bool // i.e. due to placement issues, lack of resources, etc. resetting bool // i.e. there was an error, and we're stopping and starting the stream @@ -181,6 +186,45 @@ type streamAssignment struct { unsupported *unsupportedStreamAssignment } +func (sa *streamAssignment) hasResponded() bool { + return sa.responded.Load() +} + +// markResponded sets the responded flag and returns the prior value. +func (sa *streamAssignment) markResponded() bool { + return sa.responded.Swap(true) +} + +func (sa *streamAssignment) clearResponded() { + sa.responded.Store(false) +} + +// clone returns a copy of sa. Field-explicit (rather than `*sa`) and +// pointer-returning so the embedded atomic.Bool isn't value-copied; +// responded is transferred via Load/Store. Concurrent callers may write +// responded via markResponded/clearResponded without holding js.mu. +func (sa *streamAssignment) clone() *streamAssignment { + csa := &streamAssignment{ + Client: sa.Client, + Created: sa.Created, + ConfigJSON: sa.ConfigJSON, + Config: sa.Config, + Group: sa.Group, + Sync: sa.Sync, + Subject: sa.Subject, + Reply: sa.Reply, + Restore: sa.Restore, + consumers: sa.consumers, + recovering: sa.recovering, + reassigning: sa.reassigning, + resetting: sa.resetting, + err: sa.err, + unsupported: sa.unsupported, + } + csa.responded.Store(sa.responded.Load()) + return csa +} + type unsupportedStreamAssignment struct { reason string info StreamInfo @@ -257,12 +301,49 @@ type consumerAssignment struct { Reply string `json:"reply,omitempty"` State *ConsumerState `json:"state,omitempty"` // Internal - responded bool + responded atomic.Bool // copied via clone() to satisfy go vet's noCopy check recovering bool err error unsupported *unsupportedConsumerAssignment } +func (ca *consumerAssignment) hasResponded() bool { + return ca.responded.Load() +} + +// markResponded sets the responded flag and returns the prior value. +func (ca *consumerAssignment) markResponded() bool { + return ca.responded.Swap(true) +} + +func (ca *consumerAssignment) clearResponded() { + ca.responded.Store(false) +} + +// clone returns a copy of ca. Field-explicit (rather than `*ca`) and +// pointer-returning so the embedded atomic.Bool isn't value-copied; +// responded is transferred via Load/Store. Concurrent callers may write +// responded via markResponded/clearResponded without holding js.mu. +func (ca *consumerAssignment) clone() *consumerAssignment { + cca := &consumerAssignment{ + Client: ca.Client, + Created: ca.Created, + Name: ca.Name, + Stream: ca.Stream, + ConfigJSON: ca.ConfigJSON, + Config: ca.Config, + Group: ca.Group, + Subject: ca.Subject, + Reply: ca.Reply, + State: ca.State, + recovering: ca.recovering, + err: ca.err, + unsupported: ca.unsupported, + } + cca.responded.Store(ca.responded.Load()) + return cca +} + type unsupportedConsumerAssignment struct { reason string info ConsumerInfo @@ -646,6 +727,11 @@ func (js *jetStream) isStreamHealthy(acc *Account, sa *streamAssignment) error { mset.cfgMu.RLock() replicas := mset.cfg.Replicas mset.cfgMu.RUnlock() + var nrgWerr error + if node != nil { + nrgWerr = node.GetWriteErr() + } + streamWerr := mset.getWriteErr() switch { case replicas <= 1: return nil // No further checks for R=1 streams @@ -661,6 +747,12 @@ func (js *jetStream) isStreamHealthy(acc *Account, sa *streamAssignment) error { s.Warnf("Detected stream cluster node skew '%s > %s'", acc.GetName(), streamName) return errors.New("cluster node skew detected") + case nrgWerr != nil: + return fmt.Errorf("node write error: %v", nrgWerr) + + case streamWerr != nil: + return fmt.Errorf("stream write error: %v", streamWerr) + case !mset.isMonitorRunning(): return errors.New("monitor goroutine not running") @@ -2241,7 +2333,7 @@ func (js *jetStream) collectStreamAndConsumerChanges(c RaftNodeCheckpoint, strea func (js *jetStream) setStreamAssignmentRecovering(sa *streamAssignment) { js.mu.Lock() defer js.mu.Unlock() - sa.responded = true + sa.markResponded() sa.recovering = true sa.Restore = nil if sa.Group != nil { @@ -2254,7 +2346,7 @@ func (js *jetStream) setStreamAssignmentRecovering(sa *streamAssignment) { func (js *jetStream) setConsumerAssignmentRecovering(ca *consumerAssignment) { js.mu.Lock() defer js.mu.Unlock() - ca.responded = true + ca.markResponded() ca.recovering = true if ca.Group != nil { ca.Group.Preferred = _EMPTY_ @@ -2265,19 +2357,19 @@ func (js *jetStream) setConsumerAssignmentRecovering(ca *consumerAssignment) { // Just copies over and changes out the group so it can be encoded. // Lock should be held. func (sa *streamAssignment) copyGroup() *streamAssignment { - csa, cg := *sa, *sa.Group + csa, cg := sa.clone(), *sa.Group csa.Group = &cg csa.Group.Peers = copyStrings(sa.Group.Peers) - return &csa + return csa } // Just copies over and changes out the group so it can be encoded. // Lock should be held. func (ca *consumerAssignment) copyGroup() *consumerAssignment { - cca, cg := *ca, *ca.Group + cca, cg := ca.clone(), *ca.Group cca.Group = &cg cca.Group.Peers = copyStrings(ca.Group.Peers) - return &cca + return cca } // Lock should be held. @@ -2659,9 +2751,11 @@ func (rg *raftGroup) setPreferred(s *Server) { // createRaftGroup is called to spin up this raft group if needed. func (js *jetStream) createRaftGroup(accName string, rg *raftGroup, recovering bool, storage StorageType, labels pprofLabels) (RaftNode, error) { - // Must hold JS lock throughout, otherwise two parallel calls for the same raft group could result - // in duplicate instances for the same identifier, if the current Raft node is shutting down. - // We can release the lock temporarily while waiting for the Raft node to shut down. + // js.mu protects the lookup/registration of raft groups so that two parallel + // calls for the same identifier can't end up creating duplicate instances. + // It is released around blocking work (waiting for a previous instance to + // shut down, and the disk I/O inside startRaftNode); concurrent callers for + // the same rg.Name are gated through cc.creatingRaftGroups instead. js.mu.Lock() defer js.mu.Unlock() @@ -2676,8 +2770,21 @@ func (js *jetStream) createRaftGroup(accName string, rg *raftGroup, recovering b return nil, nil } - // Check if we already have this assigned. retry: + // If another goroutine is mid-creation for this raft group, wait for it + // to finish (without holding js.mu) and then retry the lookup. + if ch, ok := cc.creatingRaftGroups[rg.Name]; ok { + js.mu.Unlock() + <-ch + js.mu.Lock() + // js.cluster could have been swapped out (shutdown). + if js.cluster == nil || js.cluster.meta == nil { + return nil, NewJSClusterNotActiveError() + } + cc = js.cluster + goto retry + } + // Check if we already have this assigned. if node := s.lookupRaftNode(rg.Name); node != nil { if node.State() == Closed { // We're waiting for this node to finish shutting down before we replace it. @@ -2734,7 +2841,7 @@ retry: // Check here to see if we have a max HA Assets limit set. if maxHaAssets := s.getOpts().JetStreamLimits.MaxHAAssets; maxHaAssets > 0 { - if s.numRaftNodes() > maxHaAssets { + if s.numRaftNodes()+len(cc.creatingRaftGroups) > maxHaAssets { s.Warnf("Maximum HA Assets limit reached: %d", maxHaAssets) // Since the meta leader assigned this, send a statsz update to them to get them up to date. go s.sendStatszUpdate() @@ -2742,46 +2849,71 @@ retry: } } + // Register an in-flight sentinel so concurrent callers for the same group + // will wait for us. Then drop js.mu around all the blocking work below + // (file store creation, peer state read, snapshot replay, fsyncs) so we + // don't serialize every stream/consumer assignment behind one disk fsync. + if cc.creatingRaftGroups == nil { + cc.creatingRaftGroups = make(map[string]chan struct{}) + } + doneCh := make(chan struct{}) + cc.creatingRaftGroups[rg.Name] = doneCh + + // Snapshot rg fields; we drop js.mu below and rg is shared. + rgName, rgScaleUp := rg.Name, rg.ScaleUp + rgPeers := copyStrings(rg.Peers) storeDir := filepath.Join(js.config.StoreDir, sysAcc.Name, defaultStoreDirName, rg.Name) - var store StreamStore - if storage == FileStorage { - // If the server is set to sync always, do the same for the Raft log. - js.srv.optsMu.RLock() - syncAlways := js.srv.opts.SyncAlways - syncInterval := js.srv.opts.SyncInterval - js.srv.optsMu.RUnlock() - fs, err := newFileStoreWithCreated( - FileStoreConfig{StoreDir: storeDir, BlockSize: defaultMediumBlockSize, AsyncFlush: false, SyncAlways: syncAlways, SyncInterval: syncInterval, srv: s}, - StreamConfig{Name: rg.Name, Storage: FileStorage, Metadata: labels}, - time.Now().UTC(), - s.jsKeyGen(s.getOpts().JetStreamKey, rg.Name), - s.jsKeyGen(s.getOpts().JetStreamOldKey, rg.Name), - ) - if err != nil { - s.Errorf("Error creating filestore WAL: %v", err) + js.mu.Unlock() + + n, err := func() (RaftNode, error) { + var store StreamStore + if storage == FileStorage { + opts := s.getOpts() + fs, err := newFileStoreWithCreated( + FileStoreConfig{StoreDir: storeDir, BlockSize: defaultMediumBlockSize, AsyncFlush: false, SyncAlways: opts.SyncAlways, SyncInterval: opts.SyncInterval, srv: s}, + StreamConfig{Name: rgName, Storage: FileStorage, Metadata: labels}, + time.Now().UTC(), + s.jsKeyGen(opts.JetStreamKey, rgName), + s.jsKeyGen(opts.JetStreamOldKey, rgName), + ) + if err != nil { + s.Errorf("Error creating filestore WAL: %v", err) + return nil, err + } + store = fs + } else { + ms, err := newMemStore(&StreamConfig{Name: rgName, Storage: MemoryStorage}) + if err != nil { + s.Errorf("Error creating memstore WAL: %v", err) + return nil, err + } + store = ms + } + + cfg := &RaftConfig{Name: rgName, Store: storeDir, Log: store, Track: true, Recovering: recovering, ScaleUp: rgScaleUp} + + if _, err := readPeerState(storeDir); err != nil { + s.bootstrapRaftNode(cfg, rgPeers, true) + } + + n, err := s.startRaftNode(accName, cfg, labels) + if err != nil || n == nil { + s.Debugf("Error creating raft group: %v", err) return nil, err } - store = fs - } else { - ms, err := newMemStore(&StreamConfig{Name: rg.Name, Storage: MemoryStorage}) - if err != nil { - s.Errorf("Error creating memstore WAL: %v", err) - return nil, err - } - store = ms - } + return n, nil + }() - cfg := &RaftConfig{Name: rg.Name, Store: storeDir, Log: store, Track: true, Recovering: recovering, ScaleUp: rg.ScaleUp} - - if _, err := readPeerState(storeDir); err != nil { - s.bootstrapRaftNode(cfg, rg.Peers, true) - } - - n, err := s.startRaftNode(accName, cfg, labels) + js.mu.Lock() + delete(cc.creatingRaftGroups, rg.Name) + close(doneCh) if err != nil || n == nil { - s.Debugf("Error creating raft group: %v", err) return nil, err } + if js.cluster == nil || js.cluster.meta == nil { + // Cluster was torn down while we were creating; let n be reaped at shutdown. + return nil, NewJSClusterNotActiveError() + } // Need JS lock to be held for the assignment to avoid data-race reports rg.node = n // See if we are preferred and should start campaign immediately. @@ -2967,61 +3099,117 @@ func (js *jetStream) monitorStream(mset *stream, sa *streamAssignment, sendSnaps } accName := acc.GetName() - // Used to represent how we can detect a changed state quickly and without representing - // a complete and detailed state which could be costly in terms of memory, cpu and GC. - // This only entails how many messages, and the first and last sequence of the stream. - // This is all that is needed to detect a change, and we can get this from FilteredState() - // with an empty filter. - var lastState SimpleState - // Don't allow the upper layer to install snapshots until we have // fully recovered from disk. isRecovering := true - var failedSnapshots int + var ( + snapMu sync.Mutex + snapshotting bool + fallbackSnapshot bool + failedSnapshots int + ) + doSnapshot := func(force bool) { // Suppress during recovery. + if mset == nil || isRecovering || isRestore { + return + } + snapMu.Lock() + defer snapMu.Unlock() // If snapshots have failed, and we're not forced to, we'll wait for the timer since it'll now be forced. - if mset == nil || isRecovering || isRestore || (!force && failedSnapshots > 0) { + if !force && failedSnapshots > 0 { return } - - // Before we actually calculate the detailed state and encode it, let's check the - // simple state to detect any changes. - curState := mset.store.FilteredState(0, _EMPTY_) - - // If the state hasn't changed but the log has gone way over - // the compaction size then we will want to compact anyway. - // This shouldn't happen for streams like it can for pull - // consumers on idle streams but better to be safe than sorry! - ne, nb := n.Size() - if curState == lastState && ne < compactNumMin && nb < compactSizeMin { + // Suppress if an async snapshot is already in progress. + if snapshotting { return } - // Make sure all pending data is flushed before allowing snapshots. - mset.flushAllPending() - // If we had a significant number of failed snapshots, start relaxing Raft-layer checks // to force it through. We might have been catching up a peer for a long period, and this // protects our log size from growing indefinitely. forceSnapshot := failedSnapshots > 4 - if err := n.InstallSnapshot(mset.stateSnapshot(), forceSnapshot); err == nil { - lastState = curState - // If there was a failed snapshot before, we reduced the timer's interval. - // Reset it back to the original interval now. - if failedSnapshots > 0 { - t.Reset(compactInterval + rci) + c, err := n.CreateSnapshotCheckpoint(forceSnapshot) + if err != nil { + if err != errNoSnapAvailable && err != errNodeClosed { + s.RateLimitWarnf("Failed to install snapshot for '%s > %s' [%s]: %v", + mset.acc.Name, mset.name(), n.Group(), err) + // If this is the first failure, reduce the interval of the snapshot timer. + // This ensures we're not waiting too long for snapshotting to eventually become forced. + if failedSnapshots == 0 { + t.Reset(compactMinInterval) + } + failedSnapshots++ } - failedSnapshots = 0 - } else if err != errNoSnapAvailable && err != errNodeClosed && err != errCatchupsRunning { - s.RateLimitWarnf("Failed to install snapshot for '%s > %s' [%s]: %v", mset.acc.Name, mset.name(), n.Group(), err) - // If this is the first failure, reduce the interval of the snapshot timer. - // This ensures we're not waiting too long for snapshotting to eventually become forced. - if failedSnapshots == 0 { - t.Reset(compactMinInterval) + return + } + + // Make sure all pending data is flushed before allowing snapshots. + if err := mset.flushAllPending(); err != nil { + // If the pending data couldn't be flushed, we have no safe way to continue. + s.Errorf("Failed to flush pending data for '%s > %s' [%s]: %v", accName, mset.name(), n.Group(), err) + assert.Unreachable("Stream snapshot flush failed", map[string]any{ + "account": accName, + "stream": mset.name(), + "group": n.Group(), + "err": err, + }) + c.Abort() + mset.setWriteErr(err) + n.Stop() + return + } + + snap := mset.stateSnapshot() + + handleInstallResult := func(err error) { + snapshotting = false + if err == nil { + // If there was a failed snapshot before, we reduced the timer's interval. + // Reset it back to the original interval now. + if failedSnapshots > 0 { + t.Reset(compactInterval + rci) + } + failedSnapshots = 0 + fallbackSnapshot = false + } else { + c.Abort() + + if err == errNoSnapAvailable || err == errNodeClosed || err == errCatchupsRunning || err == errSnapAborted { + return + } + + s.RateLimitWarnf("Failed to install snapshot for '%s > %s' [%s]: %v, will fall back to blocking snapshot", + mset.acc.Name, mset.name(), n.Group(), err) + fallbackSnapshot = true + // If this is the first failure, reduce the interval of the snapshot timer. + // This ensures we're not waiting too long for snapshotting to eventually become forced. + if failedSnapshots == 0 { + t.Reset(compactMinInterval) + } + failedSnapshots++ + } + } + + snapshotting = true + if fallbackSnapshot { + _, err = c.InstallSnapshot(snap) + handleInstallResult(err) + } else { + started := s.startGoRoutine(func() { + defer s.grWG.Done() + + _, err := c.InstallSnapshot(snap) + + snapMu.Lock() + defer snapMu.Unlock() + handleInstallResult(err) + }) + if !started { + snapshotting = false + c.Abort() } - failedSnapshots++ } } @@ -3098,6 +3286,9 @@ func (js *jetStream) monitorStream(mset *stream, sa *streamAssignment, sendSnaps select { case <-s.quitCh: // Server shutting down, but we might receive this before qch, so try to snapshot. + snapMu.Lock() + fallbackSnapshot = true + snapMu.Unlock() doSnapshot(false) return case <-mqch: @@ -3105,6 +3296,9 @@ func (js *jetStream) monitorStream(mset *stream, sa *streamAssignment, sendSnaps // Don't snapshot if not shutting down, monitor goroutine could be going away // on a scale down or a remove for example. if s.isShuttingDown() { + snapMu.Lock() + fallbackSnapshot = true + snapMu.Unlock() doSnapshot(false) } return @@ -3173,7 +3367,7 @@ func (js *jetStream) monitorStream(mset *stream, sa *streamAssignment, sendSnaps aq.recycle(&ces) return } - s.Warnf("Error applying entries to '%s > %s': %v", accName, sa.Config.Name, err) + s.Errorf("Error applying entries to '%s > %s': %v", accName, sa.Config.Name, err) if isClusterResetErr(err) { if mset.isMirror() && mset.IsLeader() { mset.retryMirrorConsumer() @@ -3182,7 +3376,7 @@ func (js *jetStream) monitorStream(mset *stream, sa *streamAssignment, sendSnaps // If the error signals we timed out of a snapshot, we should try to replay the snapshot // instead of fully resetting the state. Resetting the clustered state may result in // race conditions and should only be used as a last effort attempt. - if errors.Is(err, errCatchupAbortedNoLeader) || err == errCatchupTooManyRetries { + if errors.Is(err, errCatchupAbortedNoLeader) || err == errCatchupTooManyRetries || err == errAlreadyLeader { if node := mset.raftNode(); node != nil && node.DrainAndReplaySnapshot() { break } @@ -3195,6 +3389,11 @@ func (js *jetStream) monitorStream(mset *stream, sa *streamAssignment, sendSnaps } else if isOutOfSpaceErr(err) { // If applicable this will tear all of this down, but don't assume so and return. s.handleOutOfSpace(mset) + } else { + // Encountered an unexpected error, can't continue. + mset.setWriteErr(err) + aq.recycle(&ces) + return } } } @@ -3299,7 +3498,9 @@ func (js *jetStream) monitorStream(mset *stream, sa *streamAssignment, sendSnaps case <-t.C: // Start forcing snapshots if they failed previously. + snapMu.Lock() forceIfFailed := failedSnapshots > 0 + snapMu.Unlock() doSnapshot(forceIfFailed) case <-uch: @@ -3849,6 +4050,41 @@ func (js *jetStream) applyStreamEntries(mset *stream, ce *CommittedEntry, isReco return 0, err } + case deleteRangeOp: + dr, err := decodeDeleteRange(buf[1:]) + if err != nil { + if node := mset.raftNode(); node != nil { + s := js.srv + s.Errorf("JetStream cluster could not decode delete range for '%s > %s' [%s]", + mset.account(), mset.name(), node.Group()) + } + panic(err.Error()) + } + if dr.Num == 0 { + continue + } + mset.mu.Lock() + first, num := dr.First, dr.Num + lseq := first + num - 1 + if mset.lseq >= lseq { + mset.mu.Unlock() + continue + } + // Trim any prefix already applied so we only skip the uncovered tail. + if mset.lseq >= first { + first = mset.lseq + 1 + num = lseq - mset.lseq + } + if err = mset.store.SkipMsgs(first, num); err != nil { + mset.mu.Unlock() + js.srv.RateLimitWarnf("JetStream cluster failed to apply delete range [%d..%d] for '%s > %s': %v", + first, lseq, mset.account().Name, mset.cfg.Name, err) + return 0, err + } + mset.clearAllPreAcksInRange(first, lseq) + mset.lseq = lseq + mset.mu.Unlock() + case deleteMsgOp: md, err := decodeMsgDelete(buf[1:]) if err != nil { @@ -3989,10 +4225,8 @@ func (js *jetStream) applyStreamEntries(mset *stream, ce *CommittedEntry, isReco } } - if isRecovering || !mset.IsLeader() { - if err := mset.processSnapshot(ss, ce.Index); err != nil { - return 0, err - } + if err := mset.processSnapshot(ss, ce.Index); err != nil { + return 0, err } } else if e.Type == EntryRemovePeer { js.mu.RLock() @@ -4098,7 +4332,7 @@ func (js *jetStream) applyStreamMsgOp(mset *stream, op entryOp, mbuf []byte, isR if needLock { mset.mu.RLock() } - mset.sendFlowControlReply(reply) + mset.sendFlowControlReply(reply, hdr) if needLock { mset.mu.RUnlock() } @@ -4140,11 +4374,14 @@ func (js *jetStream) applyStreamMsgOp(mset *stream, op entryOp, mbuf []byte, isR // Messages to be skipped have no subject or timestamp or msg or hdr. if subject == _EMPTY_ && ts == 0 && len(msg) == 0 && len(hdr) == 0 { // Skip and update our lseq. - last, _ := mset.store.SkipMsg(0) + last, err := mset.store.SkipMsg(0) + if err != nil { + return err + } if needLock { mset.mu.Lock() } - mset.setLastSeq(last) + mset.lseq = last mset.clearAllPreAcks(last) if needLock { mset.mu.Unlock() @@ -4162,19 +4399,31 @@ func (js *jetStream) applyStreamMsgOp(mset *stream, op entryOp, mbuf []byte, isR // Process the actual message here. err = mset.processJetStreamMsg(subject, reply, hdr, msg, lseq, ts, mt, sourced, needLock) + // Take into account subject transforms, if any. + // The untransformed subject is replicated, but the transformed subject is used for consistency checks below. + csubject := subject + if mset.inflightTransform != nil { + mset.clMu.Lock() + if subj, found := mset.inflightTransform[lseq]; found { + csubject = subj + delete(mset.inflightTransform, lseq) + } + mset.clMu.Unlock() + } + // If we have inflight make sure to clear after processing. // TODO(dlc) - technically check on inflight != nil could cause datarace. // But do not want to acquire lock since tracking this will be rare. if mset.inflight != nil { mset.clMu.Lock() - if i, found := mset.inflight[subject]; found { + if i, found := mset.inflight[csubject]; found { // Decrement from pending operations. Once it reaches zero, it can be deleted. if i.ops > 0 { var sz uint64 if mset.store.Type() == FileStorage { - sz = fileStoreMsgSizeRaw(len(subject), len(hdr), len(msg)) + sz = fileStoreMsgSizeRaw(len(csubject), len(hdr), len(msg)) } else { - sz = memStoreMsgSizeRaw(len(subject), len(hdr), len(msg)) + sz = memStoreMsgSizeRaw(len(csubject), len(hdr), len(msg)) } if i.bytes >= sz { i.bytes -= sz @@ -4184,7 +4433,7 @@ func (js *jetStream) applyStreamMsgOp(mset *stream, op entryOp, mbuf []byte, isR i.ops-- } if i.ops == 0 { - delete(mset.inflight, subject) + delete(mset.inflight, csubject) } } mset.clMu.Unlock() @@ -4193,13 +4442,13 @@ func (js *jetStream) applyStreamMsgOp(mset *stream, op entryOp, mbuf []byte, isR // Update running total for counter. if mset.clusteredCounterTotal != nil { mset.clMu.Lock() - if counter, found := mset.clusteredCounterTotal[subject]; found { + if counter, found := mset.clusteredCounterTotal[csubject]; found { // Decrement from pending operations. Once it reaches zero, it can be deleted. if counter.ops > 0 { counter.ops-- } if counter.ops == 0 { - delete(mset.clusteredCounterTotal, subject) + delete(mset.clusteredCounterTotal, csubject) } } mset.clMu.Unlock() @@ -4225,9 +4474,11 @@ func (js *jetStream) applyStreamMsgOp(mset *stream, op entryOp, mbuf []byte, isR // should be reset. This is possible if the other side has a stale snapshot and no longer // has those messages. So compact and retry to reset. if state.Msgs == 0 { - mset.store.Compact(lseq + 1) - // Retry - err = mset.processJetStreamMsg(subject, reply, hdr, msg, lseq, ts, mt, sourced, needLock) + _, err = mset.store.Compact(lseq + 1) + if err == nil { + // Retry + err = mset.processJetStreamMsg(subject, reply, hdr, msg, lseq, ts, mt, sourced, needLock) + } } // FIXME(dlc) - We could just run a catchup with a request defining the span between what we expected // and what we got. @@ -4239,6 +4490,11 @@ func (js *jetStream) applyStreamMsgOp(mset *stream, op entryOp, mbuf []byte, isR } s.Debugf("Apply stream entries for '%s > %s' got error processing message: %v", mset.accountLocked(needLock), mset.nameLocked(needLock), err) + + // There are some errors that we can't recover from. + if err != ErrMaxMsgs && err != ErrMaxBytes && err != ErrMaxMsgsPerSubject && err != ErrMsgTooLarge && err != ErrStoreClosed { + return err + } } return nil } @@ -4295,6 +4551,7 @@ func (js *jetStream) processStreamLeaderChange(mset *stream, isLeader bool) { mset.clMu.Lock() // Clear inflight if we have it. mset.inflight = nil + mset.inflightTransform = nil // Clear running counter totals. mset.clusteredCounterTotal = nil // Clear expected per subject state. @@ -4302,12 +4559,11 @@ func (js *jetStream) processStreamLeaderChange(mset *stream, isLeader bool) { mset.expectedPerSubjectInProcess = nil mset.clMu.Unlock() - js.mu.Lock() + js.mu.RLock() s, account, err := js.srv, sa.Client.serviceAccount(), sa.err client, subject, reply := sa.Client, sa.Subject, sa.Reply - hasResponded := sa.responded - sa.responded = true - js.mu.Unlock() + hasResponded := sa.markResponded() + js.mu.RUnlock() streamName := mset.name() @@ -4320,16 +4576,16 @@ func (js *jetStream) processStreamLeaderChange(mset *stream, isLeader bool) { if node := mset.raftNode(); node != nil && !node.Quorum() && time.Since(node.Created()) > 5*time.Second { s.sendStreamLostQuorumAdvisory(mset) } - - // Clear clseq. If we become leader again, it will be fixed up - // automatically on the next mset.setLeader call. - mset.clMu.Lock() - if mset.clseq > 0 { - mset.clseq = 0 - } - mset.clMu.Unlock() } + // Clear clseq on every leader transition. recalculateClusteredSeq + // repopulates it on the next proposal. + mset.clMu.Lock() + if mset.clseq > 0 { + mset.clseq = 0 + } + mset.clMu.Unlock() + // Tell stream to switch leader status. mset.setLeader(isLeader) @@ -4572,7 +4828,9 @@ func (js *jetStream) processStreamAssignment(sa *streamAssignment) { sa.Group.node = osa.Group.node } sa.consumers = osa.consumers - sa.responded = osa.responded + if osa.hasResponded() { + sa.markResponded() + } sa.err = osa.err } // Unsubscribe if it was previously unsupported. @@ -4588,7 +4846,7 @@ func (js *jetStream) processStreamAssignment(sa *streamAssignment) { // Update our state. accStreams[stream] = sa cc.streams[accName] = accStreams - hasResponded := sa.responded + hasResponded := sa.hasResponded() // If unsupported, we can't register any further. if sa.unsupported != nil { @@ -4706,7 +4964,7 @@ func (js *jetStream) processUpdateStreamAssignment(sa *streamAssignment) { // Make sure we respond if we are a member. if isMember { - sa.responded = false + sa.clearResponded() } else { // Make sure to clean up any old node in case this stream moves back here. if sa.Group != nil { @@ -4802,16 +5060,15 @@ func (js *jetStream) processClusterUpdateStream(acc *Account, osa, sa *streamAss return } - js.mu.Lock() + js.mu.RLock() s, rg := js.srv, sa.Group client, subject, reply := sa.Client, sa.Subject, sa.Reply - alreadyRunning, numReplicas := osa.Group.node != nil, len(rg.Peers) + alreadyRunning, oldNumReplicas, numReplicas := osa.Group.node != nil, len(osa.Group.Peers), len(rg.Peers) needsNode := rg.node == nil storage, cfg := sa.Config.Storage, sa.Config - hasResponded := sa.responded - sa.responded = true recovering := sa.recovering - js.mu.Unlock() + hasResponded := sa.markResponded() + js.mu.RUnlock() mset, err := acc.lookupStream(cfg.Name) if err == nil && mset != nil { @@ -4831,6 +5088,9 @@ func (js *jetStream) processClusterUpdateStream(acc *Account, osa, sa *streamAss if !alreadyRunning && numReplicas > 1 { if needsNode { + // Must run before startClusterSubs reads mset.sa.Sync. + mset.setStreamAssignment(sa) + // Since we are scaling up we want to make sure our sync subject // is registered before we start our raft node. mset.mu.Lock() @@ -4907,6 +5167,11 @@ func (js *jetStream) processClusterUpdateStream(acc *Account, osa, sa *streamAss isLeader := mset.IsLeader() + // If the stream is scaled down, there is a chance we weren't already the leader. + if isLeader && numReplicas == 1 && oldNumReplicas > 1 { + js.processStreamLeaderChange(mset, true) + } + // Check for missing syncSubject bug. if isLeader && osa != nil && osa.Sync == _EMPTY_ { if node := mset.raftNode(); node != nil { @@ -5069,7 +5334,7 @@ func (js *jetStream) processClusterCreateStream(acc *Account, sa *streamAssignme js.mu.Lock() sa.err = err - hasResponded := sa.responded + hasResponded := sa.hasResponded() // If out of space do nothing for now. if isOutOfSpaceErr(err) { @@ -5404,7 +5669,9 @@ func (js *jetStream) processConsumerAssignment(ca *consumerAssignment) { if ca.Group != nil { ca.Group.node = oca.Group.node } - ca.responded = oca.responded + if oca.hasResponded() { + ca.markResponded() + } ca.err = oca.err // Unsubscribe if it was previously unsupported. @@ -5688,13 +5955,13 @@ func (js *jetStream) processClusterCreateConsumer(oca, ca *consumerAssignment, s // Check if we already had a consumer assignment and its still pending. cca, oca := ca, o.consumerAssignment() if oca != nil { - if !oca.responded { + if !oca.hasResponded() { // We can't override info for replying here otherwise leader once elected can not respond. // So copy over original client and the reply from the old ca. - cac := *ca + cac := ca.clone() cac.Client = oca.Client cac.Reply = oca.Reply - cca = &cac + cca = cac needsLocalResponse = true } // If we look like we are scaling up, let's send our current state to the group. @@ -5740,7 +6007,7 @@ func (js *jetStream) processClusterCreateConsumer(oca, ca *consumerAssignment, s js.mu.Lock() ca.err = err - hasResponded := ca.responded + hasResponded := ca.hasResponded() // If out of space do nothing for now. if isOutOfSpaceErr(err) { @@ -5803,10 +6070,15 @@ func (js *jetStream) processClusterCreateConsumer(oca, ca *consumerAssignment, s func() { defer s.grWG.Done() defer o.clearMonitorRunning() - o.setLeader(true) + err = o.setLeader(true) var resp = JSApiConsumerCreateResponse{ApiResponse: ApiResponse{Type: JSApiConsumerCreateResponseType}} - resp.ConsumerInfo = setDynamicConsumerInfoMetadata(o.info()) - s.sendAPIResponse(client, acc, subject, reply, _EMPTY_, s.jsonResponse(&resp)) + if err != nil { + resp.Error = NewJSConsumerCreateError(err, Unless(err)) + s.sendAPIErrResponse(client, acc, subject, reply, _EMPTY_, s.jsonResponse(&resp)) + } else { + resp.ConsumerInfo = setDynamicConsumerInfoMetadata(o.info()) + s.sendAPIResponse(client, acc, subject, reply, _EMPTY_, s.jsonResponse(&resp)) + } }, pprofLabels{ "type": "consumer", @@ -5828,12 +6100,10 @@ func (js *jetStream) processClusterCreateConsumer(oca, ca *consumerAssignment, s o.signalMonitorQuit() o.monitorWg.Wait() // Single replica consumer, process manually here. - js.mu.Lock() // Force response in case we think this is an update. - if !js.metaRecovering && isConfigUpdate { - ca.responded = false + if !js.isMetaRecovering() && isConfigUpdate { + ca.clearResponded() } - js.mu.Unlock() cca := o.consumerAssignment() // Perform the leader change in a goroutine, otherwise we could block meta operations. if o.shouldStartMonitor() { @@ -5881,12 +6151,26 @@ func (js *jetStream) processClusterCreateConsumer(oca, ca *consumerAssignment, s if o.IsLeader() || (!didCreate && needsLocalResponse) { // Process if existing as an update. Double check that this is not recovered. js.mu.RLock() - client, subject, reply, recovering := ca.Client, ca.Subject, ca.Reply, ca.recovering + client, subject, reply, recovering, sourcing := ca.Client, ca.Subject, ca.Reply, ca.recovering, ca.Config.Sourcing js.mu.RUnlock() if !recovering { - var resp = JSApiConsumerCreateResponse{ApiResponse: ApiResponse{Type: JSApiConsumerCreateResponseType}} - resp.ConsumerInfo = setDynamicConsumerInfoMetadata(o.info()) - s.sendAPIResponse(client, acc, subject, reply, _EMPTY_, s.jsonResponse(&resp)) + // If it's a sourcing consumer, we need to respond after the consumer has been reset instead. + if sourcing { + var resp = JSApiConsumerResetResponse{ApiResponse: ApiResponse{Type: JSApiConsumerResetResponseType}} + resetSeq, canRespond, err := o.resetStartingSeq(0, reply, true) + if err != nil { + resp.Error = NewJSConsumerInvalidResetError(err) + s.sendAPIErrResponse(client, acc, subject, reply, _EMPTY_, s.jsonResponse(&resp)) + } else if canRespond { + resp.ConsumerInfo = setDynamicConsumerInfoMetadata(o.info()) + resp.ResetSeq = resetSeq + s.sendAPIResponse(client, acc, subject, reply, _EMPTY_, s.jsonResponse(&resp)) + } + } else { + var resp = JSApiConsumerCreateResponse{ApiResponse: ApiResponse{Type: JSApiConsumerCreateResponseType}} + resp.ConsumerInfo = setDynamicConsumerInfoMetadata(o.info()) + s.sendAPIResponse(client, acc, subject, reply, _EMPTY_, s.jsonResponse(&resp)) + } } } } @@ -6151,8 +6435,6 @@ func (js *jetStream) monitorConsumer(o *consumer, ca *consumerAssignment) { key := make([]byte, 32) crand.Read(key) - // Hash of the last snapshot (fixed size in memory). - var lastSnap []byte var lastSnapTime time.Time // Don't allow the upper layer to install snapshots until we have @@ -6167,45 +6449,30 @@ func (js *jetStream) monitorConsumer(o *consumer, ca *consumerAssignment) { return } - // Check several things to see if we need a snapshot. - ne, nb := n.Size() - if !n.NeedSnapshot() { - // Check if we should compact etc. based on size of log. - if !force && ne < compactNumMin && nb < compactSizeMin { - return - } - } - if snap, err := o.store.EncodedState(); err == nil { - hash := highwayhash.Sum(snap, key) - // If the state hasn't changed but the log has gone way over - // the compaction size then we will want to compact anyway. - // This can happen for example when a pull consumer fetches a - // lot on an idle stream, log entries get distributed but the - // state never changes, therefore the log never gets compacted. - if !bytes.Equal(hash[:], lastSnap) || ne >= compactNumMin || nb >= compactSizeMin { - // If we had a significant number of failed snapshots, start relaxing Raft-layer checks - // to force it through. We might have been catching up a peer for a long period, and this - // protects our log size from growing indefinitely. - forceSnapshot := failedSnapshots > 4 - if err := n.InstallSnapshot(snap, forceSnapshot); err == nil { - lastSnap, lastSnapTime = hash[:], time.Now() - // If there was a failed snapshot before, we reduced the timer's interval. - // Reset it back to the original interval now. - if failedSnapshots > 0 { - t.Reset(compactInterval + rci) - } - failedSnapshots = 0 - } else if err != errNoSnapAvailable && err != errNodeClosed && err != errCatchupsRunning { - s.RateLimitWarnf("Failed to install snapshot for '%s > %s > %s' [%s]: %v", o.acc.Name, ca.Stream, ca.Name, n.Group(), err) - // If this is the first failure, reduce the interval of the snapshot timer. - // This ensures we're not waiting too long for snapshotting to eventually become forced. - if failedSnapshots == 0 { - t.Reset(compactMinInterval) - } - failedSnapshots++ + // If we had a significant number of failed snapshots, start relaxing Raft-layer checks + // to force it through. We might have been catching up a peer for a long period, and this + // protects our log size from growing indefinitely. + forceSnapshot := failedSnapshots > 4 + if err := n.InstallSnapshot(snap, forceSnapshot); err == nil { + lastSnapTime = time.Now() + // If there was a failed snapshot before, we reduced the timer's interval. + // Reset it back to the original interval now. + if failedSnapshots > 0 { + t.Reset(compactInterval + rci) } + failedSnapshots = 0 + } else if err != errNoSnapAvailable && err != errNodeClosed && err != errCatchupsRunning { + s.RateLimitWarnf("Failed to install snapshot for '%s > %s > %s' [%s]: %v", o.acc.Name, ca.Stream, ca.Name, n.Group(), err) + // If this is the first failure, reduce the interval of the snapshot timer. + // This ensures we're not waiting too long for snapshotting to eventually become forced. + if failedSnapshots == 0 { + t.Reset(compactMinInterval) + } + failedSnapshots++ } + } else { + s.RateLimitWarnf("Failed to install snapshot for '%s > %s > %s' [%s]: %v", o.acc.Name, ca.Stream, ca.Name, n.Group(), err) } } @@ -6503,10 +6770,57 @@ func (js *jetStream) applyConsumerEntries(o *consumer, ce *CommittedEntry, isLea if !o.isLeader() && sseq > o.sseq { o.sseq = sseq } + if o.dseq == 0 { + o.dseq = 1 + } if o.store != nil { o.store.UpdateStarting(sseq - 1) } o.mu.Unlock() + case resetSeqOp: + o.mu.Lock() + var le = binary.LittleEndian + sseq := le.Uint64(buf[1:9]) + reply := string(buf[9:]) + o.resetLocalStartingSeq(sseq) + if o.store != nil { + o.store.Reset(sseq - 1) + } + // Cleanup messages that lost interest. + if o.retention == InterestPolicy { + if mset := o.mset; mset != nil { + o.mu.Unlock() + ss := mset.state() + o.checkStateForInterestStream(&ss) + o.mu.Lock() + } + } + // Recalculate pending, and re-trigger message delivery. + if !o.isLeader() { + o.mu.Unlock() + } else { + o.streamNumPending() + o.signalNewMessages() + s, a := o.srv, o.acc + if reply == _EMPTY_ { + o.mu.Unlock() + } else if internal, ok := o.rsm[reply]; !ok { + o.mu.Unlock() + } else { + delete(o.rsm, reply) + o.mu.Unlock() + + // Check if the reset request needs to be answered on the system account. + // This will happen for replicated sourcing consumers that get reset as part of a create/update. + if internal { + a = nil + } + var resp = JSApiConsumerResetResponse{ApiResponse: ApiResponse{Type: JSApiConsumerResetResponseType}} + resp.ConsumerInfo = setDynamicConsumerInfoMetadata(o.info()) + resp.ResetSeq = sseq + s.sendInternalAccountMsg(a, reply, s.jsonResponse(&resp)) + } + } case addPendingRequest: o.mu.Lock() if !o.isLeader() { @@ -6540,7 +6854,7 @@ func (o *consumer) processReplicatedAck(dseq, sseq uint64) error { o.lat = time.Now() var sagap uint64 - if o.cfg.AckPolicy == AckAll { + if o.cfg.AckPolicy == AckAll || o.cfg.AckPolicy == AckFlowControl { // Always use the store state, as o.asflr is skipped ahead already. // Capture before updating store. state, err := o.store.BorrowState() @@ -6643,12 +6957,11 @@ func (js *jetStream) processConsumerLeaderChangeWithAssignment(o *consumer, ca * if ca == nil { return stepDownIfLeader() } - js.mu.Lock() + js.mu.RLock() s, account, err := js.srv, ca.Client.serviceAccount(), ca.err - client, subject, reply, streamName, consumerName := ca.Client, ca.Subject, ca.Reply, ca.Stream, ca.Name - hasResponded := ca.responded - ca.responded = true - js.mu.Unlock() + client, subject, reply, streamName, consumerName, sourcing := ca.Client, ca.Subject, ca.Reply, ca.Stream, ca.Name, ca.Config.Sourcing + hasResponded := ca.markResponded() + js.mu.RUnlock() acc, _ := s.LookupAccount(account) if acc == nil { @@ -6674,7 +6987,9 @@ func (js *jetStream) processConsumerLeaderChangeWithAssignment(o *consumer, ca * } // Tell consumer to switch leader status. - o.setLeader(isLeader) + if lerr := o.setLeader(isLeader); lerr != nil && err == nil { + err = lerr + } if !isLeader || hasResponded { if isLeader { @@ -6688,8 +7003,22 @@ func (js *jetStream) processConsumerLeaderChangeWithAssignment(o *consumer, ca * resp.Error = NewJSConsumerCreateError(err, Unless(err)) s.sendAPIErrResponse(client, acc, subject, reply, _EMPTY_, s.jsonResponse(&resp)) } else { - resp.ConsumerInfo = setDynamicConsumerInfoMetadata(o.initialInfo()) - s.sendAPIResponse(client, acc, subject, reply, _EMPTY_, s.jsonResponse(&resp)) + // If it's a sourcing consumer, we need to respond after the consumer has been reset instead. + if sourcing { + var rresp = JSApiConsumerResetResponse{ApiResponse: ApiResponse{Type: JSApiConsumerResetResponseType}} + resetSeq, canRespond, err := o.resetStartingSeq(0, reply, true) + if err != nil { + rresp.Error = NewJSConsumerInvalidResetError(err) + s.sendAPIErrResponse(client, acc, subject, reply, _EMPTY_, s.jsonResponse(&rresp)) + } else if canRespond { + rresp.ConsumerInfo = setDynamicConsumerInfoMetadata(o.info()) + rresp.ResetSeq = resetSeq + s.sendAPIResponse(client, acc, subject, reply, _EMPTY_, s.jsonResponse(&rresp)) + } + } else { + resp.ConsumerInfo = setDynamicConsumerInfoMetadata(o.initialInfo()) + s.sendAPIResponse(client, acc, subject, reply, _EMPTY_, s.jsonResponse(&resp)) + } o.sendCreateAdvisory() } @@ -6864,8 +7193,8 @@ func (js *jetStream) processStreamAssignmentResults(sub *subscription, c *client } else if result.Restore != nil { resp = s.jsonResponse(result.Restore) } - if !sa.responded || result.Update { - sa.responded = true + if !sa.hasResponded() || result.Update { + sa.markResponded() js.srv.sendAPIErrResponse(sa.Client, acc, sa.Subject, sa.Reply, _EMPTY_, resp) } // Remove this assignment if possible. @@ -6898,9 +7227,9 @@ func (js *jetStream) processConsumerAssignmentResults(sub *subscription, c *clie } if sa := js.streamAssignment(result.Account, result.Stream); sa != nil && sa.consumers != nil { - if ca := sa.consumers[result.Consumer]; ca != nil && !ca.responded { + if ca := sa.consumers[result.Consumer]; ca != nil && !ca.hasResponded() { js.srv.sendAPIErrResponse(ca.Client, acc, ca.Subject, ca.Reply, _EMPTY_, s.jsonResponse(result.Response)) - ca.responded = true + ca.markResponded() // Check if this failed. // TODO(dlc) - Could have mixed results, should track per peer. @@ -7941,10 +8270,11 @@ func (s *Server) jsClusteredStreamUpdateRequest(ci *ClientInfo, acc *Account, su return } // Single nodes are not recorded by the NRG layer so we can rename. - if len(peers) == 1 { + if len(peers) == 1 || osa.Config.Replicas == 1 { rg.Name = groupNameForStream(peers, rg.Storage) - } else if len(rg.Peers) == 1 { - // This is scale up from being a singelton, set preferred to that singelton. + } + if len(rg.Peers) == 1 { + // This is scale up from being a singleton, set preferred to that singleton. rg.Preferred = rg.Peers[0] } rg.ScaleUp = true @@ -7988,6 +8318,11 @@ func (s *Server) jsClusteredStreamUpdateRequest(ci *ClientInfo, acc *Account, su } } rg.Peers = selected + // Single nodes are not recorded by the NRG layer so we can rename. + // MUST do this, otherwise a scaleup afterward could potentially lead to inconsistencies. + if len(rg.Peers) == 1 { + rg.Name = groupNameForStream(rg.Peers, rg.Storage) + } } // Need to remap any consumers. @@ -8006,6 +8341,10 @@ func (s *Server) jsClusteredStreamUpdateRequest(ci *ClientInfo, acc *Account, su } // Assign new peers. cca.Group.Peers = rg.Peers + // Single nodes are not recorded by the NRG layer so we can rename. + if len(cca.Group.Peers) == 1 || numPeers == 1 { + cca.Group.Name = groupNameForConsumer(cca.Group.Peers, cca.Group.Storage) + } // If the replicas was not 0 make sure it matches here. if cca.Config.Replicas != 0 { cca.Config.Replicas = len(rg.Peers) @@ -8034,6 +8373,10 @@ func (s *Server) jsClusteredStreamUpdateRequest(ci *ClientInfo, acc *Account, su cca := ca.copyGroup() // Assign new peers. cca.Group.Peers = newPeers + // Single nodes are not recorded by the NRG layer so we can rename. + if len(cca.Group.Peers) == 1 || numPeers == 1 { + cca.Group.Name = groupNameForConsumer(cca.Group.Peers, cca.Group.Storage) + } // If the replicas was not 0 make sure it matches here. if cca.Config.Replicas != 0 { cca.Config.Replicas = len(newPeers) @@ -8132,7 +8475,11 @@ func (s *Server) jsClusteredStreamUpdateRequest(ci *ClientInfo, acc *Account, su rg.Preferred = _EMPTY_ } - sa := &streamAssignment{Group: rg, Sync: osa.Sync, Created: osa.Created, Config: newCfg, Subject: subject, Reply: reply, Client: ci} + syncSubject := osa.Sync + if syncSubject == _EMPTY_ { + syncSubject = syncSubjForStream() + } + sa := &streamAssignment{Group: rg, Sync: syncSubject, Created: osa.Created, Config: newCfg, Subject: subject, Reply: reply, Client: ci} if err := meta.Propose(encodeUpdateStreamAssignment(sa)); err != nil { return } @@ -8722,7 +9069,7 @@ func (s *Server) jsClusteredMsgDeleteRequest(ci *ClientInfo, acc *Account, mset } func encodeAddStreamAssignment(sa *streamAssignment) []byte { - csa := *sa + csa := sa.clone() csa.Client = csa.Client.forProposal() csa.ConfigJSON, _ = json.Marshal(sa.Config) var bb bytes.Buffer @@ -8732,7 +9079,7 @@ func encodeAddStreamAssignment(sa *streamAssignment) []byte { } func encodeUpdateStreamAssignment(sa *streamAssignment) []byte { - csa := *sa + csa := sa.clone() csa.Client = csa.Client.forProposal() csa.ConfigJSON, _ = json.Marshal(sa.Config) var bb bytes.Buffer @@ -8742,7 +9089,7 @@ func encodeUpdateStreamAssignment(sa *streamAssignment) []byte { } func encodeDeleteStreamAssignment(sa *streamAssignment) []byte { - csa := *sa + csa := sa.clone() csa.Client = csa.Client.forProposal() csa.ConfigJSON, _ = json.Marshal(sa.Config) var bb bytes.Buffer @@ -8848,6 +9195,17 @@ func (s *Server) jsClusteredConsumerRequest(ci *ClientInfo, acc *Account, subjec return } + // If the consumer is a direct sourcing consumer, we need to "upgrade" it to be durable without AckNone. + // We only get here if the stream is not Limits-based. + if cfg.Direct && cfg.Sourcing && cfg.Name != _EMPTY_ { + cfg.Direct = false + cfg.Durable = cfg.Name + cfg.AckPolicy = AckFlowControl + cfg.AckWait = 0 + cfg.MaxDeliver = 0 + cfg.InactiveThreshold = 0 + } + var resp = JSApiConsumerCreateResponse{ApiResponse: ApiResponse{Type: JSApiConsumerCreateResponseType}} streamCfg, ok := js.clusterStreamConfig(acc.Name, stream) @@ -8914,13 +9272,13 @@ func (s *Server) jsClusteredConsumerRequest(ci *ClientInfo, acc *Account, subjec // we're likely updating an existing consumer, so don't count it. Otherwise // we will incorrectly return NewJSMaximumConsumersLimitError for an update. if oname == _EMPTY_ || js.consumerAssignmentOrInflight(acc.Name, stream, oname) == nil { - // Don't count DIRECTS. + // Don't count direct/sourcing consumers. total := 0 for ca := range js.consumerAssignmentsOrInflightSeq(acc.Name, stream) { if ca.unsupported != nil { continue } - if ca.Config != nil && !ca.Config.Direct { + if ca.Config != nil && !ca.Config.Direct && !ca.Config.Sourcing { total++ } } @@ -8967,6 +9325,13 @@ func (s *Server) jsClusteredConsumerRequest(ci *ClientInfo, acc *Account, subjec // Provided config might miss metadata, copy from existing config. copyConsumerMetadata(cfg, ca.Config) + // If a durable sourcing consumer is used, we need to reset the deliver policy. + if cfg.Sourcing && cfg.Durable != _EMPTY_ { + cfg.DeliverPolicy = ca.Config.DeliverPolicy + cfg.OptStartSeq = ca.Config.OptStartSeq + cfg.OptStartTime = ca.Config.OptStartTime + } + if action == ActionCreate && !reflect.DeepEqual(cfg, ca.Config) { resp.Error = NewJSConsumerAlreadyExistsError() s.sendAPIErrResponse(ci, acc, subject, reply, string(rmsg), s.jsonResponse(&resp)) @@ -9052,22 +9417,22 @@ func (s *Server) jsClusteredConsumerRequest(ci *ClientInfo, acc *Account, subjec // Check if we are work queue policy. // We will do pre-checks here to avoid thrashing meta layer. - if sa.Config.Retention == WorkQueuePolicy && !cfg.Direct { - if cfg.AckPolicy != AckExplicit { + if sa.Config.Retention == WorkQueuePolicy && !cfg.Direct && !cfg.Sourcing { + if cfg.AckPolicy != AckExplicit && cfg.AckPolicy != AckFlowControl { resp.Error = NewJSConsumerWQRequiresExplicitAckError() s.sendAPIErrResponse(ci, acc, subject, reply, string(rmsg), s.jsonResponse(&resp)) return } subjects := gatherSubjectFilters(cfg.FilterSubject, cfg.FilterSubjects) - if len(subjects) == 0 && len(sa.consumers) > 0 { - resp.Error = NewJSConsumerWQMultipleUnfilteredError() - s.sendAPIErrResponse(ci, acc, subject, reply, string(rmsg), s.jsonResponse(&resp)) - return - } for oca := range js.consumerAssignmentsOrInflightSeq(acc.Name, stream) { - if oca.Name == oname { + if oca.Name == oname || oca.Config.Direct || oca.Config.Sourcing { continue } + if len(subjects) == 0 { + resp.Error = NewJSConsumerWQMultipleUnfilteredError() + s.sendAPIErrResponse(ci, acc, subject, reply, string(rmsg), s.jsonResponse(&resp)) + return + } for _, psubj := range gatherSubjectFilters(oca.Config.FilterSubject, oca.Config.FilterSubjects) { for _, subj := range subjects { if SubjectsCollide(subj, psubj) { @@ -9150,6 +9515,10 @@ func (s *Server) jsClusteredConsumerRequest(ci *ClientInfo, acc *Account, subjec } } } + // Single nodes are not recorded by the NRG layer so we can rename. + if rBefore == 1 { + nca.Group.Name = groupNameForConsumer(newPeerSet, nca.Group.Storage) + } nca.Group.Peers = newPeerSet nca.Group.Preferred = curLeader nca.Group.ScaleUp = true @@ -9168,6 +9537,11 @@ func (s *Server) jsClusteredConsumerRequest(ci *ClientInfo, acc *Account, subjec // scale down by removing peers from the end newPeerSet = newPeerSet[len(newPeerSet)-rAfter:] nca.Group.Peers = newPeerSet + // Single nodes are not recorded by the NRG layer so we can rename. + // MUST do this, otherwise a scaleup afterward could potentially lead to inconsistencies. + if len(nca.Group.Peers) == 1 { + nca.Group.Name = groupNameForConsumer(nca.Group.Peers, nca.Group.Storage) + } } // Update config and client info on copy of existing. @@ -9185,7 +9559,7 @@ func (s *Server) jsClusteredConsumerRequest(ci *ClientInfo, acc *Account, subjec } func encodeAddConsumerAssignment(ca *consumerAssignment) []byte { - cca := *ca + cca := ca.clone() cca.Client = cca.Client.forProposal() cca.ConfigJSON, _ = json.Marshal(ca.Config) var bb bytes.Buffer @@ -9195,7 +9569,7 @@ func encodeAddConsumerAssignment(ca *consumerAssignment) []byte { } func encodeDeleteConsumerAssignment(ca *consumerAssignment) []byte { - cca := *ca + cca := ca.clone() cca.Client = cca.Client.forProposal() cca.ConfigJSON, _ = json.Marshal(ca.Config) var bb bytes.Buffer @@ -9236,7 +9610,7 @@ func decodeConsumerAssignmentConfig(ca *consumerAssignment) error { } func encodeAddConsumerAssignmentCompressed(ca *consumerAssignment) []byte { - cca := *ca + cca := ca.clone() cca.Client = cca.Client.forProposal() cca.ConfigJSON, _ = json.Marshal(ca.Config) var bb bytes.Buffer @@ -9527,6 +9901,16 @@ func (mset *stream) processClusteredInboundMsg(subject, reply string, hdr, msg [ s, js, jsa, st, r, tierName, outq, node := mset.srv, mset.js, mset.jsa, mset.cfg.Storage, mset.cfg.Replicas, mset.tier, mset.outq, mset.node maxMsgSize, lseq := int(mset.cfg.MaxMsgSize), mset.lseq isLeader, isSealed, allowRollup, denyPurge, allowTTL, allowMsgCounter, allowMsgSchedules := mset.isLeader(), mset.cfg.Sealed, mset.cfg.AllowRollup, mset.cfg.DenyPurge, mset.cfg.AllowMsgTTL, mset.cfg.AllowMsgCounter, mset.cfg.AllowMsgSchedules + + // Apply the input subject transform if any + csubject := subject + if mset.itr != nil { + ts, err := mset.itr.Match(csubject) + if err == nil { + // no filtering: if the subject doesn't map the source of the transform, don't change it + csubject = ts + } + } mset.mu.RUnlock() // This should not happen but possible now that we allow scale up, and scale down where this could trigger. @@ -9577,7 +9961,7 @@ func (mset *stream) processClusteredInboundMsg(subject, reply string, hdr, msg [ } // Check here pre-emptively if we have exceeded our account limits. - if exceeded, err := jsa.wouldExceedLimits(st, tierName, r, subject, hdr, msg); exceeded { + if exceeded, err := jsa.wouldExceedLimits(st, tierName, r, csubject, hdr, msg); exceeded { if err == nil { err = NewJSAccountResourcesExceededError() } @@ -9611,25 +9995,7 @@ func (mset *stream) processClusteredInboundMsg(subject, reply string, hdr, msg [ // Check if we need to set initial value here mset.clMu.Lock() if mset.clseq == 0 || mset.clseq < lseq+mset.clfs { - // Need to unlock and re-acquire the locks in the proper order. - mset.clMu.Unlock() - // Locking order is stream -> batchMu -> clMu - mset.mu.RLock() - batch := mset.batchApply - var batchCount uint64 - if batch != nil { - batch.mu.Lock() - batchCount = batch.count - } - mset.clMu.Lock() - // Re-capture - lseq = mset.lseq - mset.clseq = lseq + mset.clfs + batchCount - // Keep hold of the mset.clMu, but unlock the others. - if batch != nil { - batch.mu.Unlock() - } - mset.mu.RUnlock() + lseq = recalculateClusteredSeq(mset, true) } var ( @@ -9638,7 +10004,7 @@ func (mset *stream) processClusteredInboundMsg(subject, reply string, hdr, msg [ err error ) diff := &batchStagedDiff{} - if hdr, msg, dseq, apiErr, err = checkMsgHeadersPreClusteredProposal(diff, mset, subject, hdr, msg, sourced, name, jsa, allowRollup, denyPurge, allowTTL, allowMsgCounter, allowMsgSchedules, discard, discardNewPer, maxMsgSize, maxMsgs, maxMsgsPer, maxBytes); err != nil { + if hdr, msg, dseq, apiErr, err = checkMsgHeadersPreClusteredProposal(diff, mset, csubject, subject, hdr, msg, sourced, name, jsa, allowRollup, denyPurge, allowTTL, allowMsgCounter, allowMsgSchedules, discard, discardNewPer, maxMsgSize, maxMsgs, maxMsgsPer, maxBytes); err != nil { mset.clMu.Unlock() if err == errMsgIdDuplicate && dseq > 0 { var buf [256]byte @@ -9652,52 +10018,13 @@ func (mset *stream) processClusteredInboundMsg(subject, reply string, hdr, msg [ var resp = &JSPubAckResponse{PubAck: &PubAck{Stream: name}} resp.Error = apiErr response, _ = json.Marshal(resp) - outq.send(newJSPubMsg(reply, _EMPTY_, _EMPTY_, nil, response, nil, 0)) + outq.sendMsg(reply, response) } return err } - diff.commit(mset) - esm := encodeStreamMsgAllowCompress(subject, reply, hdr, msg, mset.clseq, time.Now().UnixNano(), sourced) - var mtKey uint64 - if mt != nil { - mtKey = mset.clseq - if mset.mt == nil { - mset.mt = make(map[uint64]*msgTrace) - } - mset.mt[mtKey] = mt - } - - // Do proposal. - _ = node.Propose(esm) - // The proposal can fail, but we always account for trying. - mset.clseq++ - mset.trackReplicationTraffic(node, len(esm), r) - - // Check to see if we are being overrun. - // TODO(dlc) - Make this a limit where we drop messages to protect ourselves, but allow to be configured. - if mset.clseq-(lseq+mset.clfs) > streamLagWarnThreshold { - lerr := fmt.Errorf("JetStream stream '%s > %s' has high message lag", jsa.acc().Name, name) - s.RateLimitWarnf("%s", lerr.Error()) - } + err = commitSingleMsg(diff, mset, subject, reply, hdr, msg, name, jsa, mt, node, r, lseq) mset.clMu.Unlock() - - if err != nil { - if mt != nil { - mset.getAndDeleteMsgTrace(mtKey) - } - if canRespond { - var resp = &JSPubAckResponse{PubAck: &PubAck{Stream: mset.cfg.Name}} - resp.Error = &ApiError{Code: 503, Description: err.Error()} - response, _ = json.Marshal(resp) - // If we errored out respond here. - outq.send(newJSPubMsg(reply, _EMPTY_, _EMPTY_, nil, response, nil, 0)) - } - if isOutOfSpaceErr(err) { - s.handleOutOfSpace(mset) - } - } - return err } @@ -9741,14 +10068,17 @@ func (mset *stream) calculateSyncRequest(state *StreamState, snap *StreamReplica // processSnapshotDeletes will update our current store based on the snapshot // but only processing deletes and new FirstSeq / purges. -func (mset *stream) processSnapshotDeletes(snap *StreamReplicatedState) { +func (mset *stream) processSnapshotDeletes(snap *StreamReplicatedState) error { mset.mu.Lock() var state StreamState mset.store.FastState(&state) // Always adjust if FirstSeq has moved beyond our state. var didReset bool if snap.FirstSeq > state.FirstSeq { - mset.store.Compact(snap.FirstSeq) + if _, err := mset.store.Compact(snap.FirstSeq); err != nil { + mset.mu.Unlock() + return err + } mset.store.FastState(&state) mset.lseq = state.LastSeq mset.clearAllPreAcksBelowFloor(state.FirstSeq) @@ -9763,8 +10093,9 @@ func (mset *stream) processSnapshotDeletes(snap *StreamReplicatedState) { } if len(snap.Deleted) > 0 { - mset.store.SyncDeleted(snap.Deleted) + return mset.store.SyncDeleted(snap.Deleted) } + return nil } func (mset *stream) setCatchupPeer(peer string, lag uint64) { @@ -9874,7 +10205,9 @@ var ( // Process a stream snapshot. func (mset *stream) processSnapshot(snap *StreamReplicatedState, index uint64) (e error) { // Update any deletes, etc. - mset.processSnapshotDeletes(snap) + if err := mset.processSnapshotDeletes(snap); err != nil { + return err + } mset.setCLFS(snap.Failed) mset.mu.Lock() @@ -9910,7 +10243,14 @@ func (mset *stream) processSnapshot(snap *StreamReplicatedState, index uint64) ( // Pause the apply channel for our raft group while we catch up. if err := n.PauseApply(); err != nil { - return err + // The only reason PauseApply can fail is due to errAlreadyLeader. + // We step down to get someone else to become the leader that can catch us up. + // Ignore the error since we could have already stepped down before us doing so here. + _ = n.StepDown() + // Now try pausing again and continue to catchup. + if err = n.PauseApply(); err != nil { + return err + } } // Set our catchup state. @@ -10089,9 +10429,13 @@ RETRY: if lseq >= snap.LastSeq { // We MUST ensure all data is flushed up to this point, if the store hadn't already. // Because the snapshot needs to represent what has been persisted. - mset.flushAllPending() - s.Noticef("Catchup for stream '%s > %s' complete (took %v)", mset.account(), mset.name(), time.Since(start).Round(time.Millisecond)) - return nil + err = mset.flushAllPending() + if err == nil { + s.Noticef("Catchup for stream '%s > %s' complete (took %v)", mset.account(), mset.name(), time.Since(start).Round(time.Millisecond)) + } else { + s.Noticef("Catchup for stream '%s > %s' errored: %v (took %v)", mset.account(), mset.name(), err, time.Since(start).Round(time.Millisecond)) + } + return err } // Make sure we do not spin and make things worse. @@ -10187,17 +10531,13 @@ func (mset *stream) processCatchupMsg(msg []byte) (uint64, error) { // Handle the delete range. // Make sure the sequences match up properly. mset.mu.Lock() - if len(mset.preAcks) > 0 { - for seq := dr.First; seq < dr.First+dr.Num; seq++ { - mset.clearAllPreAcks(seq) - } - } + lseq := dr.First + dr.Num - 1 if err = mset.store.SkipMsgs(dr.First, dr.Num); err != nil { mset.mu.Unlock() return 0, errCatchupWrongSeqForSkip } - mset.lseq = dr.First + dr.Num - 1 - lseq := mset.lseq + mset.clearAllPreAcksInRange(dr.First, lseq) + mset.lseq = lseq mset.mu.Unlock() return lseq, nil } @@ -10241,14 +10581,14 @@ func (mset *stream) processCatchupMsg(msg []byte) (uint64, error) { if _, err = mset.store.SkipMsg(seq); err != nil { return 0, errCatchupWrongSeqForSkip } - } else if err := mset.store.StoreRawMsg(subj, hdr, msg, seq, ts, ttl); err != nil { + } else if err := mset.store.StoreRawMsg(subj, hdr, msg, seq, ts, ttl, false); err != nil { return 0, err } mset.mu.Lock() defer mset.mu.Unlock() // Update our lseq. - mset.setLastSeq(seq) + mset.lseq = seq // Check for MsgId and if we have one here make sure to update our internal map. if len(hdr) > 0 { @@ -10263,8 +10603,8 @@ func (mset *stream) processCatchupMsg(msg []byte) (uint64, error) { } // flushAllPending will flush any pending writes as a result of installing a snapshot or performing catchup. -func (mset *stream) flushAllPending() { - mset.store.FlushAllPending() +func (mset *stream) flushAllPending() error { + return mset.store.FlushAllPending() } func (mset *stream) handleClusterSyncRequest(sub *subscription, c *client, _ *Account, subject, reply string, msg []byte) { @@ -10297,24 +10637,29 @@ func (js *jetStream) clusterInfo(rg *raftGroup) *ClusterInfo { return nil } js.mu.RLock() - defer js.mu.RUnlock() - s := js.srv if rg == nil || rg.node == nil { + js.mu.RUnlock() return &ClusterInfo{ Name: s.cachedClusterName(), Leader: s.Name(), } } + // Capture what we need and let go of the lock to ensure that + // contention on Raft locks can't happen while holding JS lock. n := rg.node + rgName := rg.Name + rgPeers := slices.Clone(rg.Peers) + js.mu.RUnlock() + ci := &ClusterInfo{ Name: s.cachedClusterName(), Leader: s.serverNameForNode(n.GroupLeader()), LeaderSince: n.LeaderSince(), SystemAcc: n.IsSystemAccount(), TrafficAcc: n.GetTrafficAccountName(), - RaftGroup: rg.Name, + RaftGroup: rgName, } now := time.Now() @@ -10326,7 +10671,7 @@ func (js *jetStream) clusterInfo(rg *raftGroup) *ClusterInfo { } for _, rp := range peers { - if rp.ID != id && rg.isMember(rp.ID) { + if rp.ID != id && slices.Contains(rgPeers, rp.ID) { var lastSeen time.Duration if now.After(rp.Last) && !rp.Last.IsZero() { lastSeen = now.Sub(rp.Last) diff --git a/vendor/github.com/nats-io/nats-server/v2/server/jetstream_errors_generated.go b/vendor/github.com/nats-io/nats-server/v2/server/jetstream_errors_generated.go index 8baf4211c..37431d898 100644 --- a/vendor/github.com/nats-io/nats-server/v2/server/jetstream_errors_generated.go +++ b/vendor/github.com/nats-io/nats-server/v2/server/jetstream_errors_generated.go @@ -29,12 +29,30 @@ const ( // JSAtomicPublishTooLargeBatchErrF atomic publish batch is too large: {size} JSAtomicPublishTooLargeBatchErrF ErrorIdentifier = 10199 + // JSAtomicPublishTooManyInflight atomic publish too many inflight + JSAtomicPublishTooManyInflight ErrorIdentifier = 10210 + // JSAtomicPublishUnsupportedHeaderBatchErr atomic publish unsupported header used: {header} JSAtomicPublishUnsupportedHeaderBatchErr ErrorIdentifier = 10177 // JSBadRequestErr bad request JSBadRequestErr ErrorIdentifier = 10003 + // JSBatchPublishDisabledErr batch publish is disabled + JSBatchPublishDisabledErr ErrorIdentifier = 10205 + + // JSBatchPublishInvalidBatchIDErr batch publish ID is invalid + JSBatchPublishInvalidBatchIDErr ErrorIdentifier = 10207 + + // JSBatchPublishInvalidPatternErr batch publish pattern is invalid + JSBatchPublishInvalidPatternErr ErrorIdentifier = 10206 + + // JSBatchPublishTooManyInflight batch publish too many inflight + JSBatchPublishTooManyInflight ErrorIdentifier = 10211 + + // JSBatchPublishUnknownBatchIDErr batch publish ID unknown + JSBatchPublishUnknownBatchIDErr ErrorIdentifier = 10208 + // JSClusterIncompleteErr incomplete results JSClusterIncompleteErr ErrorIdentifier = 10004 @@ -71,6 +89,21 @@ const ( // JSClusterUnSupportFeatureErr not currently supported in clustered mode JSClusterUnSupportFeatureErr ErrorIdentifier = 10036 + // JSConsumerAckFCRequiresFCErr flow control ack policy requires flow control + JSConsumerAckFCRequiresFCErr ErrorIdentifier = 10219 + + // JSConsumerAckFCRequiresMaxAckPendingErr flow control ack policy requires max ack pending + JSConsumerAckFCRequiresMaxAckPendingErr ErrorIdentifier = 10220 + + // JSConsumerAckFCRequiresNoAckWaitErr flow control ack policy requires unset ack wait + JSConsumerAckFCRequiresNoAckWaitErr ErrorIdentifier = 10221 + + // JSConsumerAckFCRequiresNoMaxDeliverErr flow control ack policy requires unset max deliver + JSConsumerAckFCRequiresNoMaxDeliverErr ErrorIdentifier = 10222 + + // JSConsumerAckFCRequiresPushErr flow control ack policy requires a push based consumer + JSConsumerAckFCRequiresPushErr ErrorIdentifier = 10218 + // JSConsumerAckPolicyInvalidErr consumer ack policy invalid JSConsumerAckPolicyInvalidErr ErrorIdentifier = 10181 @@ -167,6 +200,9 @@ const ( // JSConsumerInvalidPriorityGroupErr Provided priority group does not exist for this consumer JSConsumerInvalidPriorityGroupErr ErrorIdentifier = 10160 + // JSConsumerInvalidResetErr invalid reset: {err} + JSConsumerInvalidResetErr ErrorIdentifier = 10204 + // JSConsumerInvalidSamplingErrF failed to parse consumer sampling configuration: {err} JSConsumerInvalidSamplingErrF ErrorIdentifier = 10095 @@ -317,21 +353,36 @@ const ( // JSMessageSchedulesRollupInvalidErr message schedules invalid rollup JSMessageSchedulesRollupInvalidErr ErrorIdentifier = 10192 + // JSMessageSchedulesSchedulerInvalidErr message schedules invalid scheduler + JSMessageSchedulesSchedulerInvalidErr ErrorIdentifier = 10212 + + // JSMessageSchedulesSourceInvalidErr message schedules source is invalid + JSMessageSchedulesSourceInvalidErr ErrorIdentifier = 10203 + // JSMessageSchedulesTTLInvalidErr message schedules invalid per-message TTL JSMessageSchedulesTTLInvalidErr ErrorIdentifier = 10191 // JSMessageSchedulesTargetInvalidErr message schedules target is invalid JSMessageSchedulesTargetInvalidErr ErrorIdentifier = 10190 + // JSMessageSchedulesTimeZoneInvalidErr message schedules time zone is invalid + JSMessageSchedulesTimeZoneInvalidErr ErrorIdentifier = 10223 + // JSMessageTTLDisabledErr per-message TTL is disabled JSMessageTTLDisabledErr ErrorIdentifier = 10166 // JSMessageTTLInvalidErr invalid per-message TTL JSMessageTTLInvalidErr ErrorIdentifier = 10165 + // JSMirrorConsumerRequiresAckFCErr stream mirror consumer requires flow control ack policy + JSMirrorConsumerRequiresAckFCErr ErrorIdentifier = 10214 + // JSMirrorConsumerSetupFailedErrF generic mirror consumer setup failure string ({err}) JSMirrorConsumerSetupFailedErrF ErrorIdentifier = 10029 + // JSMirrorDurableConsumerCfgInvalid stream mirror consumer config is invalid + JSMirrorDurableConsumerCfgInvalid ErrorIdentifier = 10213 + // JSMirrorInvalidStreamName mirrored stream name is invalid JSMirrorInvalidStreamName ErrorIdentifier = 10142 @@ -353,6 +404,9 @@ const ( // JSMirrorWithAtomicPublishErr stream mirrors can not also use atomic publishing JSMirrorWithAtomicPublishErr ErrorIdentifier = 10198 + // JSMirrorWithBatchPublishErr stream mirrors can not also use batch publishing + JSMirrorWithBatchPublishErr ErrorIdentifier = 10209 + // JSMirrorWithCountersErr stream mirrors can not also calculate counters JSMirrorWithCountersErr ErrorIdentifier = 10173 @@ -416,12 +470,21 @@ const ( // JSSnapshotDeliverSubjectInvalidErr deliver subject not valid JSSnapshotDeliverSubjectInvalidErr ErrorIdentifier = 10015 + // JSSourceConsumerRequiresAckFCErr stream source consumer requires flow control ack policy + JSSourceConsumerRequiresAckFCErr ErrorIdentifier = 10217 + // JSSourceConsumerSetupFailedErrF General source consumer setup failure string ({err}) JSSourceConsumerSetupFailedErrF ErrorIdentifier = 10045 // JSSourceDuplicateDetected source stream, filter and transform (plus external if present) must form a unique combination (duplicate source configuration detected) JSSourceDuplicateDetected ErrorIdentifier = 10140 + // JSSourceDurableConsumerCfgInvalid stream source consumer config is invalid + JSSourceDurableConsumerCfgInvalid ErrorIdentifier = 10215 + + // JSSourceDurableConsumerDuplicateDetected duplicate stream source consumer detected + JSSourceDurableConsumerDuplicateDetected ErrorIdentifier = 10216 + // JSSourceInvalidStreamName sourced stream name is invalid JSSourceInvalidStreamName ErrorIdentifier = 10141 @@ -619,8 +682,14 @@ var ( JSAtomicPublishInvalidBatchIDErr: {Code: 400, ErrCode: 10179, Description: "atomic publish batch ID is invalid"}, JSAtomicPublishMissingSeqErr: {Code: 400, ErrCode: 10175, Description: "atomic publish sequence is missing"}, JSAtomicPublishTooLargeBatchErrF: {Code: 400, ErrCode: 10199, Description: "atomic publish batch is too large: {size}"}, + JSAtomicPublishTooManyInflight: {Code: 429, ErrCode: 10210, Description: "atomic publish too many inflight"}, JSAtomicPublishUnsupportedHeaderBatchErr: {Code: 400, ErrCode: 10177, Description: "atomic publish unsupported header used: {header}"}, JSBadRequestErr: {Code: 400, ErrCode: 10003, Description: "bad request"}, + JSBatchPublishDisabledErr: {Code: 400, ErrCode: 10205, Description: "batch publish is disabled"}, + JSBatchPublishInvalidBatchIDErr: {Code: 400, ErrCode: 10207, Description: "batch publish ID is invalid"}, + JSBatchPublishInvalidPatternErr: {Code: 400, ErrCode: 10206, Description: "batch publish pattern is invalid"}, + JSBatchPublishTooManyInflight: {Code: 429, ErrCode: 10211, Description: "batch publish too many inflight"}, + JSBatchPublishUnknownBatchIDErr: {Code: 400, ErrCode: 10208, Description: "batch publish ID unknown"}, JSClusterIncompleteErr: {Code: 503, ErrCode: 10004, Description: "incomplete results"}, JSClusterNoPeersErrF: {Code: 400, ErrCode: 10005, Description: "{err}"}, JSClusterNotActiveErr: {Code: 500, ErrCode: 10006, Description: "JetStream not in clustered mode"}, @@ -633,6 +702,11 @@ var ( JSClusterServerNotMemberErr: {Code: 400, ErrCode: 10044, Description: "server is not a member of the cluster"}, JSClusterTagsErr: {Code: 400, ErrCode: 10011, Description: "tags placement not supported for operation"}, JSClusterUnSupportFeatureErr: {Code: 503, ErrCode: 10036, Description: "not currently supported in clustered mode"}, + JSConsumerAckFCRequiresFCErr: {Code: 400, ErrCode: 10219, Description: "flow control ack policy requires flow control"}, + JSConsumerAckFCRequiresMaxAckPendingErr: {Code: 400, ErrCode: 10220, Description: "flow control ack policy requires max ack pending"}, + JSConsumerAckFCRequiresNoAckWaitErr: {Code: 400, ErrCode: 10221, Description: "flow control ack policy requires unset ack wait"}, + JSConsumerAckFCRequiresNoMaxDeliverErr: {Code: 400, ErrCode: 10222, Description: "flow control ack policy requires unset max deliver"}, + JSConsumerAckFCRequiresPushErr: {Code: 400, ErrCode: 10218, Description: "flow control ack policy requires a push based consumer"}, JSConsumerAckPolicyInvalidErr: {Code: 400, ErrCode: 10181, Description: "consumer ack policy invalid"}, JSConsumerAckWaitNegativeErr: {Code: 400, ErrCode: 10183, Description: "consumer ack wait needs to be positive"}, JSConsumerAlreadyExists: {Code: 400, ErrCode: 10148, Description: "consumer already exists"}, @@ -665,6 +739,7 @@ var ( JSConsumerInvalidGroupNameErr: {Code: 400, ErrCode: 10162, Description: "Valid priority group name must match A-Z, a-z, 0-9, -_/=)+ and may not exceed 16 characters"}, JSConsumerInvalidPolicyErrF: {Code: 400, ErrCode: 10094, Description: "{err}"}, JSConsumerInvalidPriorityGroupErr: {Code: 400, ErrCode: 10160, Description: "Provided priority group does not exist for this consumer"}, + JSConsumerInvalidResetErr: {Code: 400, ErrCode: 10204, Description: "invalid reset: {err}"}, JSConsumerInvalidSamplingErrF: {Code: 400, ErrCode: 10095, Description: "failed to parse consumer sampling configuration: {err}"}, JSConsumerMaxDeliverBackoffErr: {Code: 400, ErrCode: 10116, Description: "max deliver is required to be > length of backoff values"}, JSConsumerMaxPendingAckExcessErrF: {Code: 400, ErrCode: 10121, Description: "consumer max ack pending exceeds system limit of {limit}"}, @@ -715,11 +790,16 @@ var ( JSMessageSchedulesDisabledErr: {Code: 400, ErrCode: 10188, Description: "message schedules is disabled"}, JSMessageSchedulesPatternInvalidErr: {Code: 400, ErrCode: 10189, Description: "message schedules pattern is invalid"}, JSMessageSchedulesRollupInvalidErr: {Code: 400, ErrCode: 10192, Description: "message schedules invalid rollup"}, + JSMessageSchedulesSchedulerInvalidErr: {Code: 400, ErrCode: 10212, Description: "message schedules invalid scheduler"}, + JSMessageSchedulesSourceInvalidErr: {Code: 400, ErrCode: 10203, Description: "message schedules source is invalid"}, JSMessageSchedulesTTLInvalidErr: {Code: 400, ErrCode: 10191, Description: "message schedules invalid per-message TTL"}, JSMessageSchedulesTargetInvalidErr: {Code: 400, ErrCode: 10190, Description: "message schedules target is invalid"}, + JSMessageSchedulesTimeZoneInvalidErr: {Code: 400, ErrCode: 10223, Description: "message schedules time zone is invalid"}, JSMessageTTLDisabledErr: {Code: 400, ErrCode: 10166, Description: "per-message TTL is disabled"}, JSMessageTTLInvalidErr: {Code: 400, ErrCode: 10165, Description: "invalid per-message TTL"}, + JSMirrorConsumerRequiresAckFCErr: {Code: 400, ErrCode: 10214, Description: "stream mirror consumer requires flow control ack policy"}, JSMirrorConsumerSetupFailedErrF: {Code: 500, ErrCode: 10029, Description: "{err}"}, + JSMirrorDurableConsumerCfgInvalid: {Code: 400, ErrCode: 10213, Description: "stream mirror consumer config is invalid"}, JSMirrorInvalidStreamName: {Code: 400, ErrCode: 10142, Description: "mirrored stream name is invalid"}, JSMirrorInvalidSubjectFilter: {Code: 400, ErrCode: 10151, Description: "mirror transform source: {err}"}, JSMirrorInvalidTransformDestination: {Code: 400, ErrCode: 10154, Description: "mirror transform: {err}"}, @@ -727,6 +807,7 @@ var ( JSMirrorMultipleFiltersNotAllowed: {Code: 400, ErrCode: 10150, Description: "mirror with multiple subject transforms cannot also have a single subject filter"}, JSMirrorOverlappingSubjectFilters: {Code: 400, ErrCode: 10152, Description: "mirror subject filters can not overlap"}, JSMirrorWithAtomicPublishErr: {Code: 400, ErrCode: 10198, Description: "stream mirrors can not also use atomic publishing"}, + JSMirrorWithBatchPublishErr: {Code: 400, ErrCode: 10209, Description: "stream mirrors can not also use batch publishing"}, JSMirrorWithCountersErr: {Code: 400, ErrCode: 10173, Description: "stream mirrors can not also calculate counters"}, JSMirrorWithFirstSeqErr: {Code: 400, ErrCode: 10143, Description: "stream mirrors can not have first sequence configured"}, JSMirrorWithMsgSchedulesErr: {Code: 400, ErrCode: 10186, Description: "stream mirrors can not also schedule messages"}, @@ -748,8 +829,11 @@ var ( JSRestoreSubscribeFailedErrF: {Code: 500, ErrCode: 10042, Description: "JetStream unable to subscribe to restore snapshot {subject}: {err}"}, JSSequenceNotFoundErrF: {Code: 400, ErrCode: 10043, Description: "sequence {seq} not found"}, JSSnapshotDeliverSubjectInvalidErr: {Code: 400, ErrCode: 10015, Description: "deliver subject not valid"}, + JSSourceConsumerRequiresAckFCErr: {Code: 400, ErrCode: 10217, Description: "stream source consumer requires flow control ack policy"}, JSSourceConsumerSetupFailedErrF: {Code: 500, ErrCode: 10045, Description: "{err}"}, JSSourceDuplicateDetected: {Code: 400, ErrCode: 10140, Description: "duplicate source configuration detected"}, + JSSourceDurableConsumerCfgInvalid: {Code: 400, ErrCode: 10215, Description: "stream source consumer config is invalid"}, + JSSourceDurableConsumerDuplicateDetected: {Code: 400, ErrCode: 10216, Description: "duplicate stream source consumer detected"}, JSSourceInvalidStreamName: {Code: 400, ErrCode: 10141, Description: "sourced stream name is invalid"}, JSSourceInvalidSubjectFilter: {Code: 400, ErrCode: 10145, Description: "source transform source: {err}"}, JSSourceInvalidTransformDestination: {Code: 400, ErrCode: 10146, Description: "source transform: {err}"}, @@ -923,6 +1007,16 @@ func NewJSAtomicPublishTooLargeBatchError(size interface{}, opts ...ErrorOption) } } +// NewJSAtomicPublishTooManyInflightError creates a new JSAtomicPublishTooManyInflight error: "atomic publish too many inflight" +func NewJSAtomicPublishTooManyInflightError(opts ...ErrorOption) *ApiError { + eopts := parseOpts(opts) + if ae, ok := eopts.err.(*ApiError); ok { + return ae + } + + return ApiErrors[JSAtomicPublishTooManyInflight] +} + // NewJSAtomicPublishUnsupportedHeaderBatchError creates a new JSAtomicPublishUnsupportedHeaderBatchErr error: "atomic publish unsupported header used: {header}" func NewJSAtomicPublishUnsupportedHeaderBatchError(header interface{}, opts ...ErrorOption) *ApiError { eopts := parseOpts(opts) @@ -949,6 +1043,56 @@ func NewJSBadRequestError(opts ...ErrorOption) *ApiError { return ApiErrors[JSBadRequestErr] } +// NewJSBatchPublishDisabledError creates a new JSBatchPublishDisabledErr error: "batch publish is disabled" +func NewJSBatchPublishDisabledError(opts ...ErrorOption) *ApiError { + eopts := parseOpts(opts) + if ae, ok := eopts.err.(*ApiError); ok { + return ae + } + + return ApiErrors[JSBatchPublishDisabledErr] +} + +// NewJSBatchPublishInvalidBatchIDError creates a new JSBatchPublishInvalidBatchIDErr error: "batch publish ID is invalid" +func NewJSBatchPublishInvalidBatchIDError(opts ...ErrorOption) *ApiError { + eopts := parseOpts(opts) + if ae, ok := eopts.err.(*ApiError); ok { + return ae + } + + return ApiErrors[JSBatchPublishInvalidBatchIDErr] +} + +// NewJSBatchPublishInvalidPatternError creates a new JSBatchPublishInvalidPatternErr error: "batch publish pattern is invalid" +func NewJSBatchPublishInvalidPatternError(opts ...ErrorOption) *ApiError { + eopts := parseOpts(opts) + if ae, ok := eopts.err.(*ApiError); ok { + return ae + } + + return ApiErrors[JSBatchPublishInvalidPatternErr] +} + +// NewJSBatchPublishTooManyInflightError creates a new JSBatchPublishTooManyInflight error: "batch publish too many inflight" +func NewJSBatchPublishTooManyInflightError(opts ...ErrorOption) *ApiError { + eopts := parseOpts(opts) + if ae, ok := eopts.err.(*ApiError); ok { + return ae + } + + return ApiErrors[JSBatchPublishTooManyInflight] +} + +// NewJSBatchPublishUnknownBatchIDError creates a new JSBatchPublishUnknownBatchIDErr error: "batch publish ID unknown" +func NewJSBatchPublishUnknownBatchIDError(opts ...ErrorOption) *ApiError { + eopts := parseOpts(opts) + if ae, ok := eopts.err.(*ApiError); ok { + return ae + } + + return ApiErrors[JSBatchPublishUnknownBatchIDErr] +} + // NewJSClusterIncompleteError creates a new JSClusterIncompleteErr error: "incomplete results" func NewJSClusterIncompleteError(opts ...ErrorOption) *ApiError { eopts := parseOpts(opts) @@ -1075,6 +1219,56 @@ func NewJSClusterUnSupportFeatureError(opts ...ErrorOption) *ApiError { return ApiErrors[JSClusterUnSupportFeatureErr] } +// NewJSConsumerAckFCRequiresFCError creates a new JSConsumerAckFCRequiresFCErr error: "flow control ack policy requires flow control" +func NewJSConsumerAckFCRequiresFCError(opts ...ErrorOption) *ApiError { + eopts := parseOpts(opts) + if ae, ok := eopts.err.(*ApiError); ok { + return ae + } + + return ApiErrors[JSConsumerAckFCRequiresFCErr] +} + +// NewJSConsumerAckFCRequiresMaxAckPendingError creates a new JSConsumerAckFCRequiresMaxAckPendingErr error: "flow control ack policy requires max ack pending" +func NewJSConsumerAckFCRequiresMaxAckPendingError(opts ...ErrorOption) *ApiError { + eopts := parseOpts(opts) + if ae, ok := eopts.err.(*ApiError); ok { + return ae + } + + return ApiErrors[JSConsumerAckFCRequiresMaxAckPendingErr] +} + +// NewJSConsumerAckFCRequiresNoAckWaitError creates a new JSConsumerAckFCRequiresNoAckWaitErr error: "flow control ack policy requires unset ack wait" +func NewJSConsumerAckFCRequiresNoAckWaitError(opts ...ErrorOption) *ApiError { + eopts := parseOpts(opts) + if ae, ok := eopts.err.(*ApiError); ok { + return ae + } + + return ApiErrors[JSConsumerAckFCRequiresNoAckWaitErr] +} + +// NewJSConsumerAckFCRequiresNoMaxDeliverError creates a new JSConsumerAckFCRequiresNoMaxDeliverErr error: "flow control ack policy requires unset max deliver" +func NewJSConsumerAckFCRequiresNoMaxDeliverError(opts ...ErrorOption) *ApiError { + eopts := parseOpts(opts) + if ae, ok := eopts.err.(*ApiError); ok { + return ae + } + + return ApiErrors[JSConsumerAckFCRequiresNoMaxDeliverErr] +} + +// NewJSConsumerAckFCRequiresPushError creates a new JSConsumerAckFCRequiresPushErr error: "flow control ack policy requires a push based consumer" +func NewJSConsumerAckFCRequiresPushError(opts ...ErrorOption) *ApiError { + eopts := parseOpts(opts) + if ae, ok := eopts.err.(*ApiError); ok { + return ae + } + + return ApiErrors[JSConsumerAckFCRequiresPushErr] +} + // NewJSConsumerAckPolicyInvalidError creates a new JSConsumerAckPolicyInvalidErr error: "consumer ack policy invalid" func NewJSConsumerAckPolicyInvalidError(opts ...ErrorOption) *ApiError { eopts := parseOpts(opts) @@ -1419,6 +1613,22 @@ func NewJSConsumerInvalidPriorityGroupError(opts ...ErrorOption) *ApiError { return ApiErrors[JSConsumerInvalidPriorityGroupErr] } +// NewJSConsumerInvalidResetError creates a new JSConsumerInvalidResetErr error: "invalid reset: {err}" +func NewJSConsumerInvalidResetError(err error, opts ...ErrorOption) *ApiError { + eopts := parseOpts(opts) + if ae, ok := eopts.err.(*ApiError); ok { + return ae + } + + e := ApiErrors[JSConsumerInvalidResetErr] + args := e.toReplacerArgs([]interface{}{"{err}", err}) + return &ApiError{ + Code: e.Code, + ErrCode: e.ErrCode, + Description: strings.NewReplacer(args...).Replace(e.Description), + } +} + // NewJSConsumerInvalidSamplingError creates a new JSConsumerInvalidSamplingErrF error: "failed to parse consumer sampling configuration: {err}" func NewJSConsumerInvalidSamplingError(err error, opts ...ErrorOption) *ApiError { eopts := parseOpts(opts) @@ -1967,6 +2177,26 @@ func NewJSMessageSchedulesRollupInvalidError(opts ...ErrorOption) *ApiError { return ApiErrors[JSMessageSchedulesRollupInvalidErr] } +// NewJSMessageSchedulesSchedulerInvalidError creates a new JSMessageSchedulesSchedulerInvalidErr error: "message schedules invalid scheduler" +func NewJSMessageSchedulesSchedulerInvalidError(opts ...ErrorOption) *ApiError { + eopts := parseOpts(opts) + if ae, ok := eopts.err.(*ApiError); ok { + return ae + } + + return ApiErrors[JSMessageSchedulesSchedulerInvalidErr] +} + +// NewJSMessageSchedulesSourceInvalidError creates a new JSMessageSchedulesSourceInvalidErr error: "message schedules source is invalid" +func NewJSMessageSchedulesSourceInvalidError(opts ...ErrorOption) *ApiError { + eopts := parseOpts(opts) + if ae, ok := eopts.err.(*ApiError); ok { + return ae + } + + return ApiErrors[JSMessageSchedulesSourceInvalidErr] +} + // NewJSMessageSchedulesTTLInvalidError creates a new JSMessageSchedulesTTLInvalidErr error: "message schedules invalid per-message TTL" func NewJSMessageSchedulesTTLInvalidError(opts ...ErrorOption) *ApiError { eopts := parseOpts(opts) @@ -1987,6 +2217,16 @@ func NewJSMessageSchedulesTargetInvalidError(opts ...ErrorOption) *ApiError { return ApiErrors[JSMessageSchedulesTargetInvalidErr] } +// NewJSMessageSchedulesTimeZoneInvalidError creates a new JSMessageSchedulesTimeZoneInvalidErr error: "message schedules time zone is invalid" +func NewJSMessageSchedulesTimeZoneInvalidError(opts ...ErrorOption) *ApiError { + eopts := parseOpts(opts) + if ae, ok := eopts.err.(*ApiError); ok { + return ae + } + + return ApiErrors[JSMessageSchedulesTimeZoneInvalidErr] +} + // NewJSMessageTTLDisabledError creates a new JSMessageTTLDisabledErr error: "per-message TTL is disabled" func NewJSMessageTTLDisabledError(opts ...ErrorOption) *ApiError { eopts := parseOpts(opts) @@ -2007,6 +2247,16 @@ func NewJSMessageTTLInvalidError(opts ...ErrorOption) *ApiError { return ApiErrors[JSMessageTTLInvalidErr] } +// NewJSMirrorConsumerRequiresAckFCError creates a new JSMirrorConsumerRequiresAckFCErr error: "stream mirror consumer requires flow control ack policy" +func NewJSMirrorConsumerRequiresAckFCError(opts ...ErrorOption) *ApiError { + eopts := parseOpts(opts) + if ae, ok := eopts.err.(*ApiError); ok { + return ae + } + + return ApiErrors[JSMirrorConsumerRequiresAckFCErr] +} + // NewJSMirrorConsumerSetupFailedError creates a new JSMirrorConsumerSetupFailedErrF error: "{err}" func NewJSMirrorConsumerSetupFailedError(err error, opts ...ErrorOption) *ApiError { eopts := parseOpts(opts) @@ -2023,6 +2273,16 @@ func NewJSMirrorConsumerSetupFailedError(err error, opts ...ErrorOption) *ApiErr } } +// NewJSMirrorDurableConsumerCfgInvalidError creates a new JSMirrorDurableConsumerCfgInvalid error: "stream mirror consumer config is invalid" +func NewJSMirrorDurableConsumerCfgInvalidError(opts ...ErrorOption) *ApiError { + eopts := parseOpts(opts) + if ae, ok := eopts.err.(*ApiError); ok { + return ae + } + + return ApiErrors[JSMirrorDurableConsumerCfgInvalid] +} + // NewJSMirrorInvalidStreamNameError creates a new JSMirrorInvalidStreamName error: "mirrored stream name is invalid" func NewJSMirrorInvalidStreamNameError(opts ...ErrorOption) *ApiError { eopts := parseOpts(opts) @@ -2105,6 +2365,16 @@ func NewJSMirrorWithAtomicPublishError(opts ...ErrorOption) *ApiError { return ApiErrors[JSMirrorWithAtomicPublishErr] } +// NewJSMirrorWithBatchPublishError creates a new JSMirrorWithBatchPublishErr error: "stream mirrors can not also use batch publishing" +func NewJSMirrorWithBatchPublishError(opts ...ErrorOption) *ApiError { + eopts := parseOpts(opts) + if ae, ok := eopts.err.(*ApiError); ok { + return ae + } + + return ApiErrors[JSMirrorWithBatchPublishErr] +} + // NewJSMirrorWithCountersError creates a new JSMirrorWithCountersErr error: "stream mirrors can not also calculate counters" func NewJSMirrorWithCountersError(opts ...ErrorOption) *ApiError { eopts := parseOpts(opts) @@ -2339,6 +2609,16 @@ func NewJSSnapshotDeliverSubjectInvalidError(opts ...ErrorOption) *ApiError { return ApiErrors[JSSnapshotDeliverSubjectInvalidErr] } +// NewJSSourceConsumerRequiresAckFCError creates a new JSSourceConsumerRequiresAckFCErr error: "stream source consumer requires flow control ack policy" +func NewJSSourceConsumerRequiresAckFCError(opts ...ErrorOption) *ApiError { + eopts := parseOpts(opts) + if ae, ok := eopts.err.(*ApiError); ok { + return ae + } + + return ApiErrors[JSSourceConsumerRequiresAckFCErr] +} + // NewJSSourceConsumerSetupFailedError creates a new JSSourceConsumerSetupFailedErrF error: "{err}" func NewJSSourceConsumerSetupFailedError(err error, opts ...ErrorOption) *ApiError { eopts := parseOpts(opts) @@ -2365,6 +2645,26 @@ func NewJSSourceDuplicateDetectedError(opts ...ErrorOption) *ApiError { return ApiErrors[JSSourceDuplicateDetected] } +// NewJSSourceDurableConsumerCfgInvalidError creates a new JSSourceDurableConsumerCfgInvalid error: "stream source consumer config is invalid" +func NewJSSourceDurableConsumerCfgInvalidError(opts ...ErrorOption) *ApiError { + eopts := parseOpts(opts) + if ae, ok := eopts.err.(*ApiError); ok { + return ae + } + + return ApiErrors[JSSourceDurableConsumerCfgInvalid] +} + +// NewJSSourceDurableConsumerDuplicateDetectedError creates a new JSSourceDurableConsumerDuplicateDetected error: "duplicate stream source consumer detected" +func NewJSSourceDurableConsumerDuplicateDetectedError(opts ...ErrorOption) *ApiError { + eopts := parseOpts(opts) + if ae, ok := eopts.err.(*ApiError); ok { + return ae + } + + return ApiErrors[JSSourceDurableConsumerDuplicateDetected] +} + // NewJSSourceInvalidStreamNameError creates a new JSSourceInvalidStreamName error: "sourced stream name is invalid" func NewJSSourceInvalidStreamNameError(opts ...ErrorOption) *ApiError { eopts := parseOpts(opts) diff --git a/vendor/github.com/nats-io/nats-server/v2/server/jetstream_events.go b/vendor/github.com/nats-io/nats-server/v2/server/jetstream_events.go index c7042f89d..f85618e06 100644 --- a/vendor/github.com/nats-io/nats-server/v2/server/jetstream_events.go +++ b/vendor/github.com/nats-io/nats-server/v2/server/jetstream_events.go @@ -71,10 +71,9 @@ const ( // JSStreamActionAdvisory indicates that a stream was created, edited or deleted type JSStreamActionAdvisory struct { TypedEvent - Stream string `json:"stream"` - Action ActionAdvisoryType `json:"action"` - Template string `json:"template,omitempty"` // Deprecated: stream templates are deprecated and will be removed in a future version. - Domain string `json:"domain,omitempty"` + Stream string `json:"stream"` + Action ActionAdvisoryType `json:"action"` + Domain string `json:"domain,omitempty"` } const JSStreamActionAdvisoryType = "io.nats.jetstream.advisory.v1.stream_action" @@ -269,9 +268,10 @@ type JSStreamBatchAbandonedAdvisory struct { type BatchAbandonReason string var ( - BatchTimeout BatchAbandonReason = "timeout" - BatchLarge BatchAbandonReason = "large" - BatchIncomplete BatchAbandonReason = "incomplete" + BatchTimeout BatchAbandonReason = "timeout" + BatchLarge BatchAbandonReason = "large" + BatchIncomplete BatchAbandonReason = "incomplete" + BatchRequirementsNotMet BatchAbandonReason = "unsupported" ) // JSConsumerLeaderElectedAdvisoryType is sent when the system elects a leader for a consumer. diff --git a/vendor/github.com/nats-io/nats-server/v2/server/jetstream_versioning.go b/vendor/github.com/nats-io/nats-server/v2/server/jetstream_versioning.go index 30e0005f4..db2f1e97b 100644 --- a/vendor/github.com/nats-io/nats-server/v2/server/jetstream_versioning.go +++ b/vendor/github.com/nats-io/nats-server/v2/server/jetstream_versioning.go @@ -17,7 +17,7 @@ import "strconv" const ( // JSApiLevel is the maximum supported JetStream API level for this server. - JSApiLevel int = 3 + JSApiLevel int = 4 JSRequiredLevelMetadataKey = "_nats.req.level" JSServerVersionMetadataKey = "_nats.ver" @@ -82,6 +82,11 @@ func setStaticStreamMetadata(cfg *StreamConfig) { requires(2) } + // Fast batch publishing was added in v2.14 and requires API level 4. + if cfg.AllowBatchPublish { + requires(4) + } + cfg.Metadata[JSRequiredLevelMetadataKey] = strconv.Itoa(requiredApiLevel) } @@ -158,6 +163,11 @@ func setStaticConsumerMetadata(cfg *ConsumerConfig) { requires(1) } + // Added in 2.14 + if cfg.AckPolicy == AckFlowControl { + requires(4) + } + cfg.Metadata[JSRequiredLevelMetadataKey] = strconv.Itoa(requiredApiLevel) } diff --git a/vendor/github.com/nats-io/nats-server/v2/server/jwt.go b/vendor/github.com/nats-io/nats-server/v2/server/jwt.go index 82d65d90d..ee8655538 100644 --- a/vendor/github.com/nats-io/nats-server/v2/server/jwt.go +++ b/vendor/github.com/nats-io/nats-server/v2/server/jwt.go @@ -202,12 +202,15 @@ func validateSrc(claims *jwt.UserClaims, host string) bool { } func validateTimes(claims *jwt.UserClaims) (bool, time.Duration) { + return validateTimesAt(claims, time.Now()) +} + +func validateTimesAt(claims *jwt.UserClaims, now time.Time) (bool, time.Duration) { if claims == nil { return false, time.Duration(0) } else if len(claims.Times) == 0 { return true, time.Duration(0) } - now := time.Now() loc := time.Local if claims.Locale != "" { var err error @@ -216,10 +219,11 @@ func validateTimes(claims *jwt.UserClaims) (bool, time.Duration) { } now = now.In(loc) } + + var ok bool + var validFor time.Duration + for _, timeRange := range claims.Times { - y, m, d := now.Date() - m = m - 1 - d = d - 1 start, err := time.ParseInLocation("15:04:05", timeRange.Start, loc) if err != nil { return false, time.Duration(0) // parsing not expected to fail at this point @@ -228,17 +232,43 @@ func validateTimes(claims *jwt.UserClaims) (bool, time.Duration) { if err != nil { return false, time.Duration(0) // parsing not expected to fail at this point } - if start.After(end) { - start = start.AddDate(y, int(m), d) - d++ // the intent is to be the next day - } else { - start = start.AddDate(y, int(m), d) + + y, m, d := now.Date() + start = time.Date(y, m, d, start.Hour(), start.Minute(), start.Second(), 0, loc) + end = time.Date(y, m, d, end.Hour(), end.Minute(), end.Second(), 0, loc) + + inRange, expires := validateTimeRangeAt(start, end, now) + if inRange && (!ok || expires > validFor) { + ok = true + validFor = expires } - if start.Before(now) { - end = end.AddDate(y, int(m), d) - if end.After(now) { - return true, end.Sub(now) - } + } + return ok, validFor +} + +// Returns true if now is within `start` and `end`, and +// how much time is left until `end`. +// False if `now` is not within range. +func validateTimeRangeAt(start, end, now time.Time) (bool, time.Duration) { + // Now falls within range. + // For example 11:00-22:00 at 13:00 + if start.Before(now) && end.After(now) { + return true, end.Sub(now) + } + + // Range crosses midnight. + if start.After(end) { + // Now is after midnight. + // For example 22:00-06:00 at 05:00. + if end.After(now) { + return true, end.Sub(now) + } + + // Now is before midnight. + // For example 22:00-06:00 at 23:30. + end = end.AddDate(0, 0, 1) + if start.Before(now) && end.After(now) { + return true, end.Sub(now) } } return false, time.Duration(0) diff --git a/vendor/github.com/nats-io/nats-server/v2/server/leafnode.go b/vendor/github.com/nats-io/nats-server/v2/server/leafnode.go index bd3e26462..be84f7b19 100644 --- a/vendor/github.com/nats-io/nats-server/v2/server/leafnode.go +++ b/vendor/github.com/nats-io/nats-server/v2/server/leafnode.go @@ -1,4 +1,4 @@ -// Copyright 2019-2025 The NATS Authors +// Copyright 2019-2026 The NATS Authors // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. // You may obtain a copy of the License at @@ -27,7 +27,6 @@ import ( "net/url" "os" "path" - "reflect" "regexp" "runtime" "strconv" @@ -115,21 +114,24 @@ type leafNodeCfg struct { perms *Permissions connDelay time.Duration // Delay before a connect, could be used while detecting loop condition, etc.. jsMigrateTimer *time.Timer + quitCh chan struct{} + removed bool + connInProgress bool } // Check to see if this is a solicited leafnode. We do special processing for solicited. func (c *client) isSolicitedLeafNode() bool { - return c.kind == LEAF && c.leaf.remote != nil + return c.kind == LEAF && c.leaf != nil && c.leaf.remote != nil } // Returns true if this is a solicited leafnode and is not configured to be treated as a hub or a receiving // connection leafnode where the otherside has declared itself to be the hub. func (c *client) isSpokeLeafNode() bool { - return c.kind == LEAF && c.leaf.isSpoke + return c.kind == LEAF && c.leaf != nil && c.leaf.isSpoke } func (c *client) isHubLeafNode() bool { - return c.kind == LEAF && !c.leaf.isSpoke + return c.kind == LEAF && c.leaf != nil && !c.leaf.isSpoke } func (c *client) isIsolatedLeafNode() bool { @@ -137,7 +139,7 @@ func (c *client) isIsolatedLeafNode() bool { // group name here, which the hub and/or leaf could provide, so that we // can isolate away certain LNs but not others on an opt-in basis. For // now we will just isolate all LN interest until then. - return c.kind == LEAF && c.leaf.isolated + return c.kind == LEAF && c.leaf != nil && c.leaf.isolated } // This will spin up go routines to solicit the remote leaf node connections. @@ -152,7 +154,10 @@ func (s *Server) solicitLeafNodeRemotes(remotes []*RemoteLeafOpts) { remote := newLeafNodeCfg(r) creds := remote.Credentials accName := remote.LocalAccount - s.leafRemoteCfgs = append(s.leafRemoteCfgs, remote) + if s.leafRemoteCfgs == nil { + s.leafRemoteCfgs = make(map[*leafNodeCfg]struct{}) + } + s.leafRemoteCfgs[remote] = struct{}{} // Print notice if if isSysAccRemote { if len(remote.DenyExports) > 0 { @@ -192,34 +197,30 @@ func (s *Server) solicitLeafNodeRemotes(remotes []*RemoteLeafOpts) { // configuration required for configuration reload. remote := addRemote(r, r.LocalAccount == sysAccName) if !r.Disabled { - s.startGoRoutine(func() { s.connectToRemoteLeafNode(remote, true) }) + s.connectToRemoteLeafNodeAsynchronously(remote, true) } } } -func (s *Server) remoteLeafNodeStillValid(remote *leafNodeCfg) bool { - if remote.Disabled { - return false - } - for _, ri := range s.getOpts().LeafNode.Remotes { - // FIXME(dlc) - What about auth changes? - if reflect.DeepEqual(ri.URLs, remote.URLs) { - return true - } - } - return false -} - // Ensure that leafnode is properly configured. func validateLeafNode(o *Options) error { if err := validateLeafNodeAuthOptions(o); err != nil { return err } - // Users can bind to any local account, if its empty we will assume the $G account. - for _, r := range o.LeafNode.Remotes { - if r.LocalAccount == _EMPTY_ { - r.LocalAccount = globalAccountName + if len(o.LeafNode.Remotes) > 0 { + names := make(map[string]struct{}) + // Check for duplicate remotes, also, users can bind to any local account, + // if its empty we will assume the $G account. + for _, r := range o.LeafNode.Remotes { + if r.LocalAccount == _EMPTY_ { + r.LocalAccount = globalAccountName + } + rn := r.name() + if _, dup := names[rn]; dup { + return fmt.Errorf("duplicate remote %s", r.safeName()) + } + names[rn] = struct{}{} } } @@ -428,42 +429,25 @@ func validateLeafNodeProxyOptions(remote *RemoteLeafOpts) ([]string, error) { return warnings, nil } -// Update remote LeafNode TLS configurations after a config reload. -func (s *Server) updateRemoteLeafNodesTLSConfig(opts *Options) { - max := len(opts.LeafNode.Remotes) - if max == 0 { - return - } - - s.mu.RLock() - defer s.mu.RUnlock() - - // Changes in the list of remote leaf nodes is not supported. - // However, make sure that we don't go over the arrays. - if len(s.leafRemoteCfgs) < max { - max = len(s.leafRemoteCfgs) - } - for i := 0; i < max; i++ { - ro := opts.LeafNode.Remotes[i] - cfg := s.leafRemoteCfgs[i] - if ro.TLSConfig != nil { - cfg.Lock() - cfg.TLSConfig = ro.TLSConfig.Clone() - cfg.TLSHandshakeFirst = ro.TLSHandshakeFirst - cfg.Unlock() - } - } -} - +// Wait for the configured reconnect interval before attempting to connect +// again to the remote leafnode. func (s *Server) reConnectToRemoteLeafNode(remote *leafNodeCfg) { + clearInProgress := true + defer func() { + s.grWG.Done() + if clearInProgress { + remote.setConnectInProgress(false) + } + }() delay := s.getOpts().LeafNode.ReconnectInterval select { case <-time.After(delay): + case <-remote.quitCh: + return case <-s.quitCh: - s.grWG.Done() return } - s.connectToRemoteLeafNode(remote, false) + clearInProgress = !connectToRemoteLeafNode(s, remote, false) } // Creates a leafNodeCfg object that wraps the RemoteLeafOpts. @@ -471,6 +455,7 @@ func newLeafNodeCfg(remote *RemoteLeafOpts) *leafNodeCfg { cfg := &leafNodeCfg{ RemoteLeafOpts: remote, urls: make([]*url.URL, 0, len(remote.URLs)), + quitCh: make(chan struct{}, 1), } if len(remote.DenyExports) > 0 || len(remote.DenyImports) > 0 { perms := &Permissions{} @@ -506,6 +491,53 @@ func newLeafNodeCfg(remote *RemoteLeafOpts) *leafNodeCfg { return cfg } +// Notifies the quit channel without blocking. +// No lock is needed to invoke this function. +func (cfg *leafNodeCfg) notifyQuitChannel() { + select { + case cfg.quitCh <- struct{}{}: + default: + } +} + +// Sets the connect-in-progress status for this remote leaf configuration. +func (cfg *leafNodeCfg) setConnectInProgress(inProgress bool) { + cfg.Lock() + defer cfg.Unlock() + // In both cases we want to drain the "quit" channel. + select { + case <-cfg.quitCh: + default: + } + cfg.connInProgress = inProgress +} + +// Returns `true` if this remote is in the middle of a connect, `false` otherwise. +func (cfg *leafNodeCfg) isConnectInProgress() bool { + cfg.RLock() + defer cfg.RUnlock() + return cfg.connInProgress +} + +// Mark that this remote is being removed from the configuration. +func (cfg *leafNodeCfg) markAsRemoved() { + cfg.Lock() + defer cfg.Unlock() + // This function should be invoked only once, but protect. + if cfg.removed { + return + } + cfg.removed = true + cfg.notifyQuitChannel() +} + +// Returns false if it has been disabled or removed. +func (cfg *leafNodeCfg) stillValid() bool { + cfg.RLock() + defer cfg.RUnlock() + return !cfg.Disabled && !cfg.removed +} + // Will pick an URL from the list of available URLs. func (cfg *leafNodeCfg) pickNextURL() *url.URL { cfg.Lock() @@ -622,12 +654,26 @@ func establishHTTPProxyTunnel(proxyURL, targetHost string, timeout time.Duration return conn, nil } -func (s *Server) connectToRemoteLeafNode(remote *leafNodeCfg, firstConnect bool) { - defer s.grWG.Done() +// Connect to a remote leaf node asynchronously (that is, this function will do +// the connect in a go routine). +func (s *Server) connectToRemoteLeafNodeAsynchronously(remote *leafNodeCfg, firstConnect bool) { + remote.setConnectInProgress(true) + s.startGoRoutine(func() { + defer s.grWG.Done() + if !connectToRemoteLeafNode(s, remote, firstConnect) { + remote.setConnectInProgress(false) + } + }) +} + +// Connect to a remote leaf node. Should only be invoked from +// `s.connectToRemoteLeafNodeAsynchronously()` or `s.reConnectToRemoteLeafNode()`. +// Returns `true` if this function invoked `s.createLeafNode()`, false otherwise. +func connectToRemoteLeafNode(s *Server, remote *leafNodeCfg, firstConnect bool) bool { if remote == nil || len(remote.URLs) == 0 { s.Debugf("Empty remote leafnode definition, nothing to connect") - return + return false } opts := s.getOpts() @@ -651,8 +697,10 @@ func (s *Server) connectToRemoteLeafNode(remote *leafNodeCfg, firstConnect bool) if connDelay := remote.getConnectDelay(); connDelay > 0 { select { case <-time.After(connDelay): + case <-remote.quitCh: + return false case <-s.quitCh: - return + return false } remote.setConnectDelay(0) } @@ -676,7 +724,14 @@ func (s *Server) connectToRemoteLeafNode(remote *leafNodeCfg, firstConnect bool) attempts := 0 - for s.isRunning() && s.remoteLeafNodeStillValid(remote) { + // In case the migrate timer was created but not canceled, do it when + // this function exits. Note that the timer would not be created if + // `jetstreamMigrateDelay == 0`. + if jetstreamMigrateDelay > 0 { + defer remote.cancelMigrateTimer() + } + + for s.isRunning() && remote.stillValid() { rURL := remote.pickNextURL() url, err := s.getRandomIP(resolver, rURL.Host, nil) if err == nil { @@ -729,8 +784,9 @@ func (s *Server) connectToRemoteLeafNode(remote *leafNodeCfg, firstConnect bool) remote.Unlock() select { case <-s.quitCh: - remote.cancelMigrateTimer() - return + return false + case <-remote.quitCh: + return false case <-time.After(delay): // Check if we should migrate any JetStream assets immediately while this remote is down. // This will be used if JetStreamClusterMigrateDelay was not set @@ -741,9 +797,11 @@ func (s *Server) connectToRemoteLeafNode(remote *leafNodeCfg, firstConnect bool) } } remote.cancelMigrateTimer() - if !s.remoteLeafNodeStillValid(remote) { + // We can check here, but really we will have to check again when the server + // is about to add to the `s.leafs` map later in the process. + if !remote.stillValid() { conn.Close() - return + return false } // We have a connection here to a remote server. @@ -753,8 +811,10 @@ func (s *Server) connectToRemoteLeafNode(remote *leafNodeCfg, firstConnect bool) // Clear any observer states if we had them. s.clearObserverState(remote) - return + return true } + + return false } func (cfg *leafNodeCfg) cancelMigrateTimer() { @@ -854,6 +914,8 @@ func (s *Server) isLeafConnectDisabled() bool { // their remote connections did not have a tls{} block). // We now save the host name regardless in case the remote returns an INFO indicating // that TLS is required. +// +// Lock held on entry. func (cfg *leafNodeCfg) saveTLSHostname(u *url.URL) { if cfg.tlsName == _EMPTY_ && net.ParseIP(u.Hostname()) == nil { cfg.tlsName = u.Hostname() @@ -862,6 +924,8 @@ func (cfg *leafNodeCfg) saveTLSHostname(u *url.URL) { // Save off the username/password for when we connect using a bare URL // that we get from the INFO protocol. +// +// Lock held on entry. func (cfg *leafNodeCfg) saveUserPassword(u *url.URL) { if cfg.username == _EMPTY_ && u.User != nil { cfg.username = u.User.Username() @@ -1459,6 +1523,15 @@ func (c *client) processLeafnodeInfo(info *Info) { // Check for compression, unless already done. if firstINFO && !c.flags.isSet(compressionNegotiated) { + // A solicited leafnode connection must first receive a leafnode INFO. + // Classify wrong-port connections before any leaf-specific negotiation. + if didSolicit && (info.CID == 0 || info.LeafNodeURLs == nil) { + c.mu.Unlock() + c.Errorf(ErrConnectedToWrongPort.Error()) + c.closeConnection(WrongPort) + return + } + // Prevent from getting back here. c.flags.set(compressionNegotiated) @@ -1536,15 +1609,6 @@ func (c *client) processLeafnodeInfo(info *Info) { // ** Not if "no advertise" is enabled. // *** Not if leafnode's "no advertise" is enabled. // - // As seen from above, a solicited LeafNode connection should receive - // from the remote server an INFO with CID and LeafNodeURLs. Anything - // else should be considered an attempt to connect to a wrong port. - if didSolicit && (info.CID == 0 || info.LeafNodeURLs == nil) { - c.mu.Unlock() - c.Errorf(ErrConnectedToWrongPort.Error()) - c.closeConnection(WrongPort) - return - } // Reject a cluster that contains spaces. if info.Cluster != _EMPTY_ && strings.Contains(info.Cluster, " ") { c.mu.Unlock() @@ -1552,8 +1616,12 @@ func (c *client) processLeafnodeInfo(info *Info) { c.closeConnection(ProtocolViolation) return } - // Capture a nonce here. - c.nonce = []byte(info.Nonce) + // For solicited outbound leaf connections, capture the remote's nonce. + // For inbound leaf connections, keep using the server-issued nonce that + // was sent in our initial INFO and must be signed in CONNECT. + if didSolicit { + c.nonce = []byte(info.Nonce) + } if info.TLSRequired && didSolicit { remote.TLS = true } @@ -1578,15 +1646,17 @@ func (c *client) processLeafnodeInfo(info *Info) { } // For both initial INFO and async INFO protocols, Possibly - // update our list of remote leafnode URLs we can connect to. - if didSolicit && (len(info.LeafNodeURLs) > 0 || len(info.WSConnectURLs) > 0) { + // update our list of remote leafnode URLs we can connect to, + // unless we are instructed not to. + if didSolicit && !remote.IgnoreDiscoveredServers && + (len(info.LeafNodeURLs) > 0 || len(info.WSConnectURLs) > 0) { // Consider the incoming array as the most up-to-date // representation of the remote cluster's list of URLs. c.updateLeafNodeURLs(info) } - // Check to see if we have permissions updates here. - if info.Import != nil || info.Export != nil { + // Only solicited leafnode connections trust permission updates from INFO. + if didSolicit && (info.Import != nil || info.Export != nil) { perms := &Permissions{ Publish: info.Export, Subscribe: info.Import, @@ -1623,6 +1693,12 @@ func (c *client) processLeafnodeInfo(info *Info) { // Check if we have the remote account information and if so make sure it's stored. if info.RemoteAccount != _EMPTY_ { + if c.acc == nil { + c.mu.Unlock() + c.sendErr("Authorization Violation") + c.closeConnection(ProtocolViolation) + return + } s.leafRemoteAccounts.Store(c.acc.Name, info.RemoteAccount) } c.mu.Unlock() @@ -1807,7 +1883,7 @@ func (s *Server) setLeafNodeInfoHostPortAndIP() error { // (this solves the stale connection situation). An error is returned to help the // remote detect the misconfiguration when the duplicate is the result of that // misconfiguration. -func (s *Server) addLeafNodeConnection(c *client, srvName, clusterName string, checkForDup bool) { +func (s *Server) addLeafNodeConnection(c *client, srvName, clusterName string, checkForDup bool) bool { var accName string c.mu.Lock() cid := c.cid @@ -1819,7 +1895,8 @@ func (s *Server) addLeafNodeConnection(c *client, srvName, clusterName string, c mySrvName := c.leaf.remoteServer remoteAccName := c.leaf.remoteAccName myClustName := c.leaf.remoteCluster - solicited := c.leaf.remote != nil + remote := c.leaf.remote + solicited := remote != nil c.mu.Unlock() var old *client @@ -1843,6 +1920,23 @@ func (s *Server) addLeafNodeConnection(c *client, srvName, clusterName string, c } } } + // Now that we are under the server lock and before adding it to the map, + // for a solicited leaf, we need to make sure that it has not been removed + // from the config or disabled. + if solicited { + // If no longer valid, do not add to the server map. The connection + // should have been marked so that it can't reconnect. When the caller + // calls closeConnection(), cleanup (including clearing the connect- + // in-progress flag) will occur at the appropriate time. + if !remote.stillValid() { + // Prevent reconnect in case it was not yet done. + c.setNoReconnect() + s.mu.Unlock() + s.removeFromTempClients(cid) + return false + } + remote.setConnectInProgress(false) + } // Store new connection in the map s.leafs[cid] = c s.mu.Unlock() @@ -1891,7 +1985,7 @@ func (s *Server) addLeafNodeConnection(c *client, srvName, clusterName string, c } else if domain, ok := opts.JsAccDefaultDomain[accName]; ok && domain == _EMPTY_ { // for backwards compatibility with old setups that do not have a domain name set c.Debugf("Skipping deny %q for account %q due to default domain", jsAllAPI, accName) - return + return true } } @@ -1969,9 +2063,11 @@ func (s *Server) addLeafNodeConnection(c *client, srvName, clusterName string, c c.Debugf("Adding deny %q for outgoing messages to account %q", src, accName) } } + return true } func (s *Server) removeLeafNodeConnection(c *client) { + s.mu.Lock() c.mu.Lock() cid := c.cid if c.leaf != nil { @@ -1984,10 +2080,18 @@ func (s *Server) removeLeafNodeConnection(c *client) { // We need to set this to nil for GC to release the connection c.leaf.gwSub = nil } + if remote := c.leaf.remote; remote != nil { + // If "noReconnect" is true, then we won't attempt to reconnect, so + // we will clear the "connect-in-progress" flag. However, if we can + // reconnect, then we should set "connect-in-progress" to true while + // we are under the server/client lock. The go routine that performs + // the reconnect will be started later and there would be a gap with + // the wrong flag value otherwise. + remote.setConnectInProgress(!c.flags.isSet(noReconnect)) + } } proxyKey := c.proxyKey c.mu.Unlock() - s.mu.Lock() delete(s.leafs, cid) if proxyKey != _EMPTY_ { s.removeProxiedConn(proxyKey, cid) @@ -2154,6 +2258,13 @@ func (c *client) processLeafNodeConnect(s *Server, arg []byte, lang string) erro acc := c.acc c.mu.Unlock() + // If the account is not set (e.g. connection was closed due to auth + // timeout while still being processed), bail out to avoid a panic. + if acc == nil { + c.closeConnection(MissingAccount) + return ErrMissingAccount + } + // Register the cluster, even if empty, as long as we are acting as a hub. if !proto.Hub { acc.registerLeafNodeCluster(proto.Cluster) @@ -2999,6 +3110,11 @@ func (c *client) processLeafHeaderMsgArgs(arg []byte) error { if c.pa.hdr > c.pa.size { return fmt.Errorf("processLeafHeaderMsgArgs Header Size larger then TotalSize: '%s'", arg) } + maxPayload := atomic.LoadInt32(&c.mpay) + if maxPayload != jwt.NoLimit && int64(c.pa.size) > int64(maxPayload) { + c.maxPayloadViolation(c.pa.size, maxPayload) + return ErrMaxPayload + } // Common ones processed after check for arg length c.pa.subject = args[0] @@ -3068,6 +3184,11 @@ func (c *client) processLeafMsgArgs(arg []byte) error { if c.pa.size < 0 { return fmt.Errorf("processLeafMsgArgs Bad or Missing Size: '%s'", args) } + maxPayload := atomic.LoadInt32(&c.mpay) + if maxPayload != jwt.NoLimit && int64(c.pa.size) > int64(maxPayload) { + c.maxPayloadViolation(c.pa.size, maxPayload) + return ErrMaxPayload + } // Common ones processed after check for arg length c.pa.subject = args[0] @@ -3089,6 +3210,12 @@ func (c *client) processInboundLeafMsg(msg []byte) { return } + // Check that leaf messages respect the subject permissions. + if c.perms != nil && !c.leafMsgAllowed() { + c.leafPubPermViolation(c.pa.subject) + return + } + // Match the subscriptions. We will use our own L1 map if // it's still valid, avoiding contention on the shared sublist. var r *SublistResult @@ -3150,12 +3277,102 @@ func (c *client) processInboundLeafMsg(msg []byte) { } } +// Checks whether the inbound leaf message is allowed by the +// connection's permissions. On the hub side this enforces what +// the remote leaf may publish. On the spoke side this enforces +// import restrictions such as deny_imports. +func (c *client) leafMsgAllowed() bool { + wireSubject := c.pa.subject + if len(c.pa.mapped) > 0 { + // Mappings rewrite c.pa.subject to the internal + // destination. For leaf ACLs, need to check + // the original wire subject from the remote side. + wireSubject = c.pa.mapped + } + // Strip any gateway routing prefix for the permission check. + subjectToCheck, isGW := getGWRoutedSubjectOrSelf(wireSubject) + + // Service-import replies (_R_), JS ack subjects ($JS.ACK.) + // are internal routing subjects forwarded via LS+ without + // permission checks. + if isServiceReply(subjectToCheck) || isJSAckSubject(subjectToCheck) { + return true + } + + c.mu.Lock() + defer c.mu.Unlock() + + if c.isSpokeLeafNode() { + // Gateway routed replies are forwarded without + // permission checks. + if isGW || c.leafReceiveAllowed(subjectToCheck) { + return true + } + } else if c.leafSendAllowed(subjectToCheck) { + return true + } + // Check tracked reply permissions (allow_responses). + // Use the pre-strip subject since deliverMsg tracks + // replies under the original form, which includes + // the GW routing prefix for routed requests. + return c.responseAllowed(bytesToString(wireSubject)) +} + +// Returns true if the leaf side ACLs allow importing this subject, +// based on the permissions received over INFO and any local deny_imports. +// Lock must be held. +func (c *client) leafReceiveAllowed(subject []byte) bool { + return c.canSubscribe(bytesToString(subject)) +} + +// Returns true if the hub side ACLs allow the remote leaf to send +// this subject. +// Lock must be held. +func (c *client) leafSendAllowed(bsubject []byte) bool { + // Use the original export ACL captured for this accepted leaf. + // The live perms also contain additional JetStream denies used by + // the normal forwarding path, and applying them here would reject + // legitimate inbound JS API requests. + subject := bytesToString(bsubject) + perms := c.opts.Export + if perms == nil || (perms.Allow == nil && perms.Deny == nil) { + return true + } + + allowed := true + if perms.Allow != nil && !strings.HasPrefix(subject, mqttPrefix) { + allowed = false + for _, allowSubj := range perms.Allow { + if matchLiteral(subject, allowSubj) { + allowed = true + break + } + } + } + + if allowed && len(perms.Deny) > 0 { + for _, denySubj := range perms.Deny { + if matchLiteral(subject, denySubj) { + allowed = false + break + } + } + } + return allowed +} + // Handles a subscription permission violation. // See leafPermViolation() for details. func (c *client) leafSubPermViolation(subj []byte) { c.leafPermViolation(false, subj) } +// Handles a publish permission violation. +// See leafPermViolation() for details. +func (c *client) leafPubPermViolation(subj []byte) { + c.leafPermViolation(true, subj) +} + // Common function to process publish or subscribe leafnode permission violation. // Sends the permission violation error to the remote, logs it and closes the connection. // If this is from a server soliciting, the reconnection will be delayed. @@ -3433,6 +3650,12 @@ func (s *Server) leafNodeFinishConnectProcess(c *client) { return } remote := c.leaf.remote + if remote == nil || c.acc == nil { + c.mu.Unlock() + c.sendErr("Authorization Violation") + c.closeConnection(ProtocolViolation) + return + } // Check if we will need to send the system connect event. remote.RLock() sendSysConnectEvent := remote.Hub @@ -3457,19 +3680,22 @@ func (s *Server) leafNodeFinishConnectProcess(c *client) { c.closeConnection(ProtocolViolation) return } - s.addLeafNodeConnection(c, _EMPTY_, _EMPTY_, false) + if !s.addLeafNodeConnection(c, _EMPTY_, _EMPTY_, false) { + // Was not added, could be because the remote configuration has been removed. + c.closeConnection(ClientClosed) + return + } s.initLeafNodeSmapAndSendSubs(c) if sendSysConnectEvent { s.sendLeafNodeConnect(acc) } + s.accountConnectEvent(c) - // The above functions are not atomically under the client - // lock doing those operations. It is possible - since we - // have started the read/write loops - that the connection - // is closed before or in between. This would leave the - // closed LN connection possible registered with the account - // and/or the server's leafs map. So check if connection - // is closed, and if so, manually cleanup. + // The above functions are not running under the client lock, so it is + // possible that between the time we have started the read/write loops + // and now, that the connection was closed. This would leave the closed + // LN connection possibly registered with the account and/or the server's + // leafs map. So check if connection is closed, and if so, manually cleanup. c.mu.Lock() closed := c.isClosed() if !closed { diff --git a/vendor/github.com/nats-io/nats-server/v2/server/log.go b/vendor/github.com/nats-io/nats-server/v2/server/log.go index 2cd294c45..d251864a4 100644 --- a/vendor/github.com/nats-io/nats-server/v2/server/log.go +++ b/vendor/github.com/nats-io/nats-server/v2/server/log.go @@ -227,6 +227,14 @@ func (s *Server) rateLimitFormatWarnf(format string, v ...any) { s.Warnf("%s", statement) } +func (s *Server) RateLimitErrorf(format string, v ...any) { + statement := fmt.Sprintf(format, v...) + if _, loaded := s.rateLimitLogging.LoadOrStore(statement, time.Now()); loaded { + return + } + s.Errorf("%s", statement) +} + func (s *Server) RateLimitWarnf(format string, v ...any) { statement := fmt.Sprintf(format, v...) if _, loaded := s.rateLimitLogging.LoadOrStore(statement, time.Now()); loaded { diff --git a/vendor/github.com/nats-io/nats-server/v2/server/memstore.go b/vendor/github.com/nats-io/nats-server/v2/server/memstore.go index 63b5a9df8..4e3f113b3 100644 --- a/vendor/github.com/nats-io/nats-server/v2/server/memstore.go +++ b/vendor/github.com/nats-io/nats-server/v2/server/memstore.go @@ -184,7 +184,7 @@ func (ms *memStore) recoverMsgSchedulingState() { if len(sm.hdr) == 0 { continue } - if schedule, ok := getMessageSchedule(sm.hdr); ok && !schedule.IsZero() { + if schedule, apiErr := nextMessageSchedule(sm.hdr, sm.ts); apiErr == nil && !schedule.IsZero() { ms.scheduling.init(seq, sm.subj, schedule.UnixNano()) } } @@ -192,7 +192,7 @@ func (ms *memStore) recoverMsgSchedulingState() { // Stores a raw message with expected sequence number and timestamp. // Lock should be held. -func (ms *memStore) storeRawMsg(subj string, hdr, msg []byte, seq uint64, ts, ttl int64) error { +func (ms *memStore) storeRawMsg(subj string, hdr, msg []byte, seq uint64, ts, ttl int64, discardNewCheck bool) error { if ms.msgs == nil { return ErrStoreClosed } @@ -208,31 +208,31 @@ func (ms *memStore) storeRawMsg(subj string, hdr, msg []byte, seq uint64, ts, tt } // Check if we are discarding new messages when we reach the limit. - if ms.cfg.Discard == DiscardNew { - if asl && ms.cfg.DiscardNewPer { + // If we are clustered, we do the enforcement above and should not disqualify + // the message here since it could cause replicas to drift. + if discardNewCheck && ms.cfg.Discard == DiscardNew { + // Allow rollup messages through since they will purge old + // messages for the subject after storing, restoring the limit. + if asl && ms.cfg.DiscardNewPer && len(sliceHeader(JSMsgRollup, hdr)) == 0 { return ErrMaxMsgsPerSubject } - // If we are discard new and limits policy and clustered, we do the enforcement - // above and should not disqualify the message here since it could cause replicas to drift. - if ms.cfg.Retention == LimitsPolicy || ms.cfg.Replicas == 1 { - if ms.cfg.MaxMsgs > 0 && ms.state.Msgs >= uint64(ms.cfg.MaxMsgs) { - // If we are tracking max messages per subject and are at the limit we will replace, so this is ok. - if !asl { - return ErrMaxMsgs - } + if ms.cfg.MaxMsgs > 0 && ms.state.Msgs >= uint64(ms.cfg.MaxMsgs) { + // If we are tracking max messages per subject and are at the limit we will replace, so this is ok. + if !asl { + return ErrMaxMsgs } - if ms.cfg.MaxBytes > 0 && ms.state.Bytes+memStoreMsgSize(subj, hdr, msg) >= uint64(ms.cfg.MaxBytes) { - if !asl { - return ErrMaxBytes - } - // If we are here we are at a subject maximum, need to determine if dropping last message gives us enough room. - if ss.firstNeedsUpdate || ss.lastNeedsUpdate { - ms.recalculateForSubj(subj, ss) - } - sm, ok := ms.msgs[ss.First] - if !ok || memStoreMsgSize(sm.subj, sm.hdr, sm.msg) < memStoreMsgSize(subj, hdr, msg) { - return ErrMaxBytes - } + } + if ms.cfg.MaxBytes > 0 && ms.state.Bytes+memStoreMsgSize(subj, hdr, msg) > uint64(ms.cfg.MaxBytes) { + if !asl { + return ErrMaxBytes + } + // If we are here we are at a subject maximum, need to determine if dropping last message gives us enough room. + if ss.firstNeedsUpdate || ss.lastNeedsUpdate { + ms.recalculateForSubj(subj, ss) + } + sm, ok := ms.msgs[ss.First] + if !ok || memStoreMsgSize(sm.subj, sm.hdr, sm.msg) < memStoreMsgSize(subj, hdr, msg) { + return ErrMaxBytes } } } @@ -309,20 +309,28 @@ func (ms *memStore) storeRawMsg(subj string, hdr, msg []byte, seq uint64, ts, tt // Message scheduling. if ms.scheduling != nil { - if schedule, ok := getMessageSchedule(hdr); ok && !schedule.IsZero() { + if schedule, apiErr := nextMessageSchedule(hdr, ts); apiErr == nil && !schedule.IsZero() { ms.scheduling.add(seq, subj, schedule.UnixNano()) - } else { + } else if getMessageScheduler(hdr) == _EMPTY_ { ms.scheduling.removeSubject(subj) } + + // Check for a repeating schedule and update such that it triggers again. + if scheduleNext := bytesToString(sliceHeader(JSScheduleNext, hdr)); scheduleNext != _EMPTY_ && scheduleNext != JSScheduleNextPurge { + scheduler := getMessageScheduler(hdr) + if next, err := time.Parse(time.RFC3339Nano, scheduleNext); err == nil && scheduler != _EMPTY_ { + ms.scheduling.update(scheduler, next.UnixNano()) + } + } } return nil } // StoreRawMsg stores a raw message with expected sequence number and timestamp. -func (ms *memStore) StoreRawMsg(subj string, hdr, msg []byte, seq uint64, ts, ttl int64) error { +func (ms *memStore) StoreRawMsg(subj string, hdr, msg []byte, seq uint64, ts, ttl int64, discardNewCheck bool) error { ms.mu.Lock() - err := ms.storeRawMsg(subj, hdr, msg, seq, ts, ttl) + err := ms.storeRawMsg(subj, hdr, msg, seq, ts, ttl, discardNewCheck) cb := ms.scb // Check if first message timestamp requires expiry // sooner than initial replica expiry timer set to MaxAge when initializing. @@ -344,7 +352,8 @@ func (ms *memStore) StoreRawMsg(subj string, hdr, msg []byte, seq uint64, ts, tt func (ms *memStore) StoreMsg(subj string, hdr, msg []byte, ttl int64) (uint64, int64, error) { ms.mu.Lock() seq, ts := ms.state.LastSeq+1, time.Now().UnixNano() - err := ms.storeRawMsg(subj, hdr, msg, seq, ts, ttl) + // This is called for a R1 with no expected sequence number, so perform DiscardNew checks on the store-level. + err := ms.storeRawMsg(subj, hdr, msg, seq, ts, ttl, true) cb := ms.scb ms.mu.Unlock() @@ -414,8 +423,9 @@ func (ms *memStore) SkipMsgs(seq uint64, num uint64) error { } // FlushAllPending flushes all data that was still pending to be written. -func (ms *memStore) FlushAllPending() { +func (ms *memStore) FlushAllPending() error { // Noop, in-memory store doesn't use async applying. + return nil } // RegisterStorageUpdates registers a callback for updates to storage changes. @@ -521,13 +531,13 @@ loop: } // FilteredState will return the SimpleState associated with the filtered subject and a proposed starting sequence. -func (ms *memStore) FilteredState(sseq uint64, subj string) SimpleState { +func (ms *memStore) FilteredState(sseq uint64, subj string) (SimpleState, error) { // This needs to be a write lock, as filteredStateLocked can // mutate the per-subject state. ms.mu.Lock() defer ms.mu.Unlock() - return ms.filteredStateLocked(sseq, subj, false) + return ms.filteredStateLocked(sseq, subj, false), nil } func (ms *memStore) filteredStateLocked(sseq uint64, filter string, lastPerSubject bool) SimpleState { @@ -1391,10 +1401,16 @@ func (ms *memStore) runMsgScheduling() { } ms.scheduling.running = true - scheduledMsgs := ms.scheduling.getScheduledMessages(func(seq uint64, smv *StoreMsg) *StoreMsg { - sm, _ := ms.loadMsgLocked(seq, smv, false) - return sm - }) + scheduledMsgs := ms.scheduling.getScheduledMessages( + func(seq uint64, smv *StoreMsg) *StoreMsg { + sm, _ := ms.loadMsgLocked(seq, smv, false) + return sm + }, + func(subj string, smv *StoreMsg) *StoreMsg { + sm, _ := ms.loadLastLocked(subj, smv) + return sm + }, + ) if len(scheduledMsgs) > 0 { ms.mu.Unlock() for _, msg := range scheduledMsgs { @@ -1429,7 +1445,7 @@ func (ms *memStore) PurgeEx(subject string, sequence, keep uint64) (purged uint6 } eq := compareFn(subject) - if ss := ms.FilteredState(1, subject); ss.Msgs > 0 { + if ss, _ := ms.FilteredState(1, subject); ss.Msgs > 0 { if keep > 0 { if keep >= ss.Msgs { return 0, nil @@ -1712,13 +1728,17 @@ func (ms *memStore) loadMsgLocked(seq uint64, smp *StoreMsg, needMSLock bool) (* // LoadLastMsg will return the last message we have that matches a given subject. // The subject can be a wildcard. func (ms *memStore) LoadLastMsg(subject string, smp *StoreMsg) (*StoreMsg, error) { - var sm *StoreMsg - var ok bool - // This needs to be a write lock, as filteredStateLocked can // mutate the per-subject state. ms.mu.Lock() defer ms.mu.Unlock() + return ms.loadLastLocked(subject, smp) +} + +// Lock should be held. +func (ms *memStore) loadLastLocked(subject string, smp *StoreMsg) (*StoreMsg, error) { + var sm *StoreMsg + var ok bool if subject == _EMPTY_ || subject == fwcs { sm, ok = ms.msgs[ms.state.LastSeq] @@ -1907,31 +1927,41 @@ func (ms *memStore) loadNextMsgLocked(filter string, wc bool, start uint64, smp return nil, ms.state.LastSeq, ErrStoreEOF } -// Will load the next non-deleted msg starting at the start sequence and walking backwards. -func (ms *memStore) LoadPrevMsg(start uint64, smp *StoreMsg) (sm *StoreMsg, err error) { +// Will load the previous message matching the filter subject, starting at the start sequence and walking backwards. +func (ms *memStore) LoadPrevMsg(filter string, wc bool, start uint64, smp *StoreMsg) (sm *StoreMsg, skip uint64, err error) { ms.mu.RLock() defer ms.mu.RUnlock() if ms.msgs == nil { - return nil, ErrStoreClosed + return nil, 0, ErrStoreClosed } if ms.state.Msgs == 0 || start < ms.state.FirstSeq { - return nil, ErrStoreEOF + return nil, ms.state.FirstSeq, ErrStoreEOF } if start > ms.state.LastSeq { start = ms.state.LastSeq } + if filter == _EMPTY_ { + filter = fwcs + wc = true + } + isAll := filter == fwcs + eq := subjectsEqual + if wc { + eq = matchLiteral + } + for seq := start; seq >= ms.state.FirstSeq; seq-- { - if sm, ok := ms.msgs[seq]; ok { + if sm, ok := ms.msgs[seq]; ok && (isAll || eq(sm.subj, filter)) { if smp == nil { smp = new(StoreMsg) } sm.copy(smp) - return smp, nil + return smp, seq, nil } } - return nil, ErrStoreEOF + return nil, ms.state.FirstSeq, ErrStoreEOF } // LoadPrevMsgMulti will find the previous message matching any entry in the sublist. @@ -1965,7 +1995,7 @@ func (ms *memStore) LoadPrevMsgMulti(sl *gsl.SimpleSublist, start uint64, smp *S return smp, nseq, nil } } - return nil, ms.state.LastSeq, ErrStoreEOF + return nil, ms.state.FirstSeq, ErrStoreEOF } // RemoveMsg will remove the message from this store. @@ -2329,10 +2359,7 @@ func (ms *memStore) EncodedStreamState(failed uint64) ([]byte, error) { b := buf[0:n] if numDeleted > 0 { - buf, err := ms.dmap.Encode(nil) - if err != nil { - return nil, err - } + buf := ms.dmap.Encode(nil) b = append(b, buf...) } @@ -2340,7 +2367,11 @@ func (ms *memStore) EncodedStreamState(failed uint64) ([]byte, error) { } // SyncDeleted will make sure this stream has same deleted state as dbs. -func (ms *memStore) SyncDeleted(dbs DeleteBlocks) { +func (ms *memStore) SyncDeleted(dbs DeleteBlocks) error { + if len(dbs) == 0 { + return nil + } + ms.mu.Lock() defer ms.mu.Unlock() @@ -2349,7 +2380,7 @@ func (ms *memStore) SyncDeleted(dbs DeleteBlocks) { if len(dbs) == 1 { min, max, num := ms.dmap.State() if pmin, pmax, pnum := dbs[0].State(); pmin == min && pmax == max && pnum == num { - return + return nil } } lseq := ms.state.LastSeq @@ -2363,6 +2394,7 @@ func (ms *memStore) SyncDeleted(dbs DeleteBlocks) { return true }) } + return nil } func (o *consumerMemStore) Update(state *ConsumerState) error { @@ -2410,10 +2442,51 @@ func (o *consumerMemStore) Update(state *ConsumerState) error { return nil } +func (o *consumerMemStore) ForceUpdate(state *ConsumerState) error { + // Sanity checks. + if state.AckFloor.Consumer > state.Delivered.Consumer { + return fmt.Errorf("bad ack floor for consumer") + } + if state.AckFloor.Stream > state.Delivered.Stream { + return fmt.Errorf("bad ack floor for stream") + } + + // Copy to our state. + var pending map[uint64]*Pending + var redelivered map[uint64]uint64 + if len(state.Pending) > 0 { + pending = make(map[uint64]*Pending, len(state.Pending)) + for seq, p := range state.Pending { + pending[seq] = &Pending{p.Sequence, p.Timestamp} + if seq <= state.AckFloor.Stream || seq > state.Delivered.Stream { + return fmt.Errorf("bad pending entry, sequence [%d] out of range", seq) + } + } + } + if len(state.Redelivered) > 0 { + redelivered = make(map[uint64]uint64, len(state.Redelivered)) + for seq, dc := range state.Redelivered { + redelivered[seq] = dc + } + } + + // Replace our state. + o.mu.Lock() + defer o.mu.Unlock() + + o.state.Delivered = state.Delivered + o.state.AckFloor = state.AckFloor + o.state.Pending = pending + o.state.Redelivered = redelivered + + return nil +} + // SetStarting sets our starting stream sequence. func (o *consumerMemStore) SetStarting(sseq uint64) error { o.mu.Lock() o.state.Delivered.Stream = sseq + o.state.AckFloor.Stream = sseq o.mu.Unlock() return nil } @@ -2432,6 +2505,14 @@ func (o *consumerMemStore) UpdateStarting(sseq uint64) { } } +// Reset all values in the store, and reset the starting sequence. +func (o *consumerMemStore) Reset(sseq uint64) error { + o.mu.Lock() + o.state = ConsumerState{} + o.mu.Unlock() + return o.SetStarting(sseq) +} + // HasState returns if this store has a recorded state. func (o *consumerMemStore) HasState() bool { o.mu.Lock() @@ -2524,8 +2605,8 @@ func (o *consumerMemStore) UpdateAcks(dseq, sseq uint64) error { return ErrStoreMsgNotFound } - // Check for AckAll here. - if o.cfg.AckPolicy == AckAll { + // Check for AckAll here (or AckFlowControl which functions like AckAll). + if o.cfg.AckPolicy == AckAll || o.cfg.AckPolicy == AckFlowControl { sgap := sseq - o.state.AckFloor.Stream o.state.AckFloor.Consumer = dseq o.state.AckFloor.Stream = sseq @@ -2675,14 +2756,3 @@ func (o *consumerMemStore) copyRedelivered() map[uint64]uint64 { // Type returns the type of the underlying store. func (o *consumerMemStore) Type() StorageType { return MemoryStorage } - -// Templates -type templateMemStore struct{} - -func newTemplateMemStore() *templateMemStore { - return &templateMemStore{} -} - -// No-ops for memstore. -func (ts *templateMemStore) Store(t *streamTemplate) error { return nil } -func (ts *templateMemStore) Delete(t *streamTemplate) error { return nil } diff --git a/vendor/github.com/nats-io/nats-server/v2/server/monitor.go b/vendor/github.com/nats-io/nats-server/v2/server/monitor.go index c1ad73e91..6d4460b23 100644 --- a/vendor/github.com/nats-io/nats-server/v2/server/monitor.go +++ b/vendor/github.com/nats-io/nats-server/v2/server/monitor.go @@ -189,6 +189,17 @@ func newSubsList(client *client) []string { return subs } +func redactBearerJWT(userJWT string) string { + if userJWT == _EMPTY_ { + return _EMPTY_ + } + uc, err := jwt.DecodeUserClaims(userJWT) + if err == nil && uc != nil && uc.BearerToken { + return _EMPTY_ + } + return userJWT +} + // Connz returns a Connz struct containing information about connections. func (s *Server) Connz(opts *ConnzOptions) (*Connz, error) { var ( @@ -441,6 +452,7 @@ func (s *Server) Connz(opts *ConnzOptions) (*Connz, error) { ci.NameTag = client.acc.getNameTag() } client.mu.Unlock() + ci.JWT = redactBearerJWT(ci.JWT) pconns[i] = ci i++ } @@ -487,6 +499,7 @@ func (s *Server) Connz(opts *ConnzOptions) (*Connz, error) { cc.NameTag = acc.getNameTag() } } + cc.JWT = redactBearerJWT(cc.JWT) } pconns[i] = &cc.ConnInfo i++ @@ -1271,6 +1284,7 @@ type Varz struct { ConfigDigest string `json:"config_digest"` // ConfigDigest is a calculated hash of the current configuration Tags jwt.TagList `json:"tags,omitempty"` // Tags are the tags assigned to the server in configuration Metadata map[string]string `json:"metadata,omitempty"` // Metadata is the metadata assigned to the server in configuration + FeatureFlags map[string]bool `json:"feature_flags,omitempty"` // FeatureFlags is the feature flags enabled/disabled in configuration TrustedOperatorsJwt []string `json:"trusted_operators_jwt,omitempty"` // TrustedOperatorsJwt is the JWTs for all trusted operators TrustedOperatorsClaim []*jwt.OperatorClaims `json:"trusted_operators_claim,omitempty"` // TrustedOperatorsClaim is the decoded claims for each trusted operator SystemAccount string `json:"system_account,omitempty"` // SystemAccount is the name of the System account @@ -1570,8 +1584,13 @@ func (s *Server) updateJszVarz(js *jetStream, v *JetStreamVarz, doConfig bool) { v.Meta.Replicas = ci.Replicas } if ipq := s.jsAPIRoutedReqs; ipq != nil { - v.Meta.Pending = ipq.len() + v.Meta.PendingRequests = ipq.len() } + if ipq := s.jsAPIRoutedInfoReqs; ipq != nil { + v.Meta.PendingInfos = ipq.len() + } + v.Meta.Pending = v.Meta.PendingRequests + v.Meta.PendingInfos + v.Meta.Snapshot = s.metaClusterSnapshotStats(js, mg) } } } @@ -1788,6 +1807,7 @@ func (s *Server) updateVarzConfigReloadableFields(v *Varz) { v.ConfigDigest = opts.configDigest v.Tags = opts.Tags v.Metadata = opts.Metadata + v.FeatureFlags = opts.getMergedFeatureFlags() // Update route URLs if applicable if s.varzUpdateRouteURLs { v.Cluster.URLs = urlsToStrings(opts.Routes) @@ -3008,15 +3028,43 @@ type MetaSnapshotStats struct { LastDuration time.Duration `json:"last_duration,omitempty"` // LastDuration is how long the last meta snapshot took } +// metaClusterSnapshotStats returns snapshot statistics for the meta group. +func (s *Server) metaClusterSnapshotStats(js *jetStream, mg RaftNode) *MetaSnapshotStats { + entries, bytes := mg.Size() + snap := &MetaSnapshotStats{ + PendingEntries: entries, + PendingSize: bytes, + } + + js.mu.RLock() + cluster := js.cluster + js.mu.RUnlock() + + if cluster != nil { + timeNanos := atomic.LoadInt64(&cluster.lastMetaSnapTime) + durationNanos := atomic.LoadInt64(&cluster.lastMetaSnapDuration) + if timeNanos > 0 { + snap.LastTime = time.Unix(0, timeNanos).UTC() + } + if durationNanos > 0 { + snap.LastDuration = time.Duration(durationNanos) + } + } + + return snap +} + // MetaClusterInfo shows information about the meta group. type MetaClusterInfo struct { - Name string `json:"name,omitempty"` // Name is the name of the cluster - Leader string `json:"leader,omitempty"` // Leader is the server name of the cluster leader - Peer string `json:"peer,omitempty"` // Peer is unique ID of the leader - Replicas []*PeerInfo `json:"replicas,omitempty"` // Replicas is a list of known peers - Size int `json:"cluster_size"` // Size is the known size of the cluster - Pending int `json:"pending"` // Pending is how many RAFT messages are not yet processed - Snapshot *MetaSnapshotStats `json:"snapshot"` // Snapshot contains meta snapshot statistics + Name string `json:"name,omitempty"` // Name is the name of the cluster + Leader string `json:"leader,omitempty"` // Leader is the server name of the cluster leader + Peer string `json:"peer,omitempty"` // Peer is unique ID of the leader + Replicas []*PeerInfo `json:"replicas,omitempty"` // Replicas is a list of known peers + Size int `json:"cluster_size"` // Size is the known size of the cluster + Pending int `json:"pending"` // Pending is how many RAFT messages are not yet processed + PendingRequests int `json:"pending_requests"` // PendingRequests is how many CRUD operations are queued for processing + PendingInfos int `json:"pending_infos"` // PendingInfos is how many info operations are queued for processing + Snapshot *MetaSnapshotStats `json:"snapshot"` // Snapshot contains meta snapshot statistics } // JSInfo has detailed information on JetStream. @@ -3233,32 +3281,18 @@ func (s *Server) Jsz(opts *JSzOptions) (*JSInfo, error) { if mg := js.getMetaGroup(); mg != nil { if ci := s.raftNodeToClusterInfo(mg); ci != nil { - entries, bytes := mg.Size() jsi.Meta = &MetaClusterInfo{Name: ci.Name, Leader: ci.Leader, Peer: getHash(ci.Leader), Size: mg.ClusterSize()} if isLeader { jsi.Meta.Replicas = ci.Replicas } if ipq := s.jsAPIRoutedReqs; ipq != nil { - jsi.Meta.Pending = ipq.len() + jsi.Meta.PendingRequests = ipq.len() } - // Add meta snapshot stats - jsi.Meta.Snapshot = &MetaSnapshotStats{ - PendingEntries: entries, - PendingSize: bytes, - } - js.mu.RLock() - cluster := js.cluster - js.mu.RUnlock() - if cluster != nil { - timeNanos := atomic.LoadInt64(&cluster.lastMetaSnapTime) - durationNanos := atomic.LoadInt64(&cluster.lastMetaSnapDuration) - if timeNanos > 0 { - jsi.Meta.Snapshot.LastTime = time.Unix(0, timeNanos).UTC() - } - if durationNanos > 0 { - jsi.Meta.Snapshot.LastDuration = time.Duration(durationNanos) - } + if ipq := s.jsAPIRoutedInfoReqs; ipq != nil { + jsi.Meta.PendingInfos = ipq.len() } + jsi.Meta.Pending = jsi.Meta.PendingRequests + jsi.Meta.PendingInfos + jsi.Meta.Snapshot = s.metaClusterSnapshotStats(js, mg) } } @@ -3695,6 +3729,20 @@ func (s *Server) healthz(opts *HealthzOptions) *HealthStatus { }) continue } + if streamWerr := s.getWriteErr(); streamWerr != nil { + if !details { + health.Status = na + health.Error = fmt.Sprintf("JetStream stream '%s > %s' write error: %v", acc, stream, streamWerr) + return health + } + health.Errors = append(health.Errors, HealthzError{ + Type: HealthzErrorStream, + Account: acc.Name, + Stream: stream, + Error: fmt.Sprintf("JetStream stream '%s > %s' write error: %v", acc, stream, streamWerr), + }) + continue + } if streamFound { // if consumer option is passed, verify that the consumer exists on stream if opts.Consumer != _EMPTY_ { @@ -3771,49 +3819,37 @@ func (s *Server) healthz(opts *HealthzOptions) *HealthStatus { meta = cc.meta js.mu.RUnlock() - // If no meta leader. - if meta == nil || meta.GroupLeader() == _EMPTY_ { - if !details { - health.Status = na - health.Error = "JetStream has not established contact with a meta leader" - } else { - health.Errors = []HealthzError{ - { - Type: HealthzErrorJetStream, - Error: "JetStream has not established contact with a meta leader", - }, - } - } - return health + // Check meta layer health. + var metaNoLeader, metaClosed, metaUnhealthy bool + var metaWerr error + if meta != nil { + metaNoLeader = meta.GroupLeader() == _EMPTY_ + metaClosed = meta.State() == Closed + metaUnhealthy = !meta.Healthy() + metaWerr = meta.GetWriteErr() } - - // If we are not current with the meta leader. - if !meta.Healthy() { - if !details { - health.Status = na - health.Error = "JetStream is not current with the meta leader" + metaRecovering := js.isMetaRecovering() + if meta == nil || metaNoLeader || metaClosed || metaUnhealthy || metaWerr != nil || metaRecovering { + var desc string + if metaWerr != nil { + desc = fmt.Sprintf("JetStream meta layer write error: %v", metaWerr) + } else if metaClosed { + desc = "JetStream meta layer is not running" + } else if meta != nil && metaRecovering { + desc = "JetStream is still recovering meta layer" + } else if meta == nil || metaNoLeader { + desc = "JetStream has not established contact with a meta leader" } else { - health.Errors = []HealthzError{ - { - Type: HealthzErrorJetStream, - Error: "JetStream is not current with the meta leader", - }, - } + desc = "JetStream is not current with the meta leader" } - return health - } - - // Are we still recovering meta layer? - if js.isMetaRecovering() { if !details { health.Status = na - health.Error = "JetStream is still recovering meta layer" - + health.Error = desc } else { health.Errors = []HealthzError{ { Type: HealthzErrorJetStream, - Error: "JetStream is still recovering meta layer", + Error: desc, }, } } @@ -4090,6 +4126,8 @@ type RaftzGroup struct { QuorumNeeded int `json:"quorum_needed"` Observer bool `json:"observer,omitempty"` Paused bool `json:"paused,omitempty"` + Overrun bool `json:"overrun,omitempty"` + OverrunCount uint64 `json:"overrun_count,omitempty"` Committed uint64 `json:"committed"` Applied uint64 `json:"applied"` CatchingUp bool `json:"catching_up,omitempty"` @@ -4198,6 +4236,8 @@ func (s *Server) Raftz(opts *RaftzOptions) *RaftzStatus { QuorumNeeded: n.qn, Observer: n.observer, Paused: n.paused, + Overrun: n.quorumPaused || n.isLeaderOverrun(), + OverrunCount: n.overrunCount, Committed: n.commit, Applied: n.applied, CatchingUp: n.catchup != nil, diff --git a/vendor/github.com/nats-io/nats-server/v2/server/mqtt.go b/vendor/github.com/nats-io/nats-server/v2/server/mqtt.go index 2ca023078..7b0e5c2fd 100644 --- a/vendor/github.com/nats-io/nats-server/v2/server/mqtt.go +++ b/vendor/github.com/nats-io/nats-server/v2/server/mqtt.go @@ -15,7 +15,6 @@ package server import ( "bytes" - "cmp" "crypto/tls" "encoding/binary" "encoding/json" @@ -33,6 +32,8 @@ import ( "unicode/utf8" "github.com/nats-io/jwt/v2" + "github.com/nats-io/nats-server/v2/server/gsl" + "github.com/nats-io/nats-server/v2/server/stree" "github.com/nats-io/nuid" ) @@ -258,14 +259,13 @@ type mqttSessionManager struct { type mqttAccountSessionManager struct { mu sync.RWMutex - sessions map[string]*mqttSession // key is MQTT client ID - sessByHash map[string]*mqttSession // key is MQTT client ID hash - sessLocked map[string]struct{} // key is MQTT client ID and indicate that a session can not be taken by a new client at this time - flappers map[string]time.Time // When connection connects with client ID already in use - flapTimer *time.Timer // Timer to perform some cleanup of the flappers map - sl *Sublist // sublist allowing to find retained messages for given subscription - retmsgs map[string]*mqttRetainedMsgRef // retained messages - rmsCache *sync.Map // map[subject]mqttRetainedMsg + sessions map[string]*mqttSession // key is MQTT client ID + sessByHash map[string]*mqttSession // key is MQTT client ID hash + sessLocked map[string]struct{} // key is MQTT client ID and indicate that a session can not be taken by a new client at this time + flappers map[string]time.Time // When connection connects with client ID already in use + flapTimer *time.Timer // Timer to perform some cleanup of the flappers map + retmsgs *stree.SubjectTree[mqttRetainedMsgRef] // retained message metadata + rmsCache *sync.Map // map[subject]mqttRetainedMsg jsa mqttJSA domainTk string // Domain (with trailing "."), or possibly empty. This is added to session subject. } @@ -366,7 +366,6 @@ type mqttRetainedMsg struct { type mqttRetainedMsgRef struct { sseq uint64 - sub *subscription } // mqttSub contains fields associated with a MQTT subscription, and is added to @@ -2022,10 +2021,14 @@ func (as *mqttAccountSessionManager) processRetainedMsg(_ *subscription, c *clie if err != nil { return } + if strings.IndexByte(rm.Subject, 0x7f) >= 0 { + c.Warnf("Skipping retained message for subject %q: unsupported character 0x7f", rm.Subject) + return + } // The as.jsa.id is immutable, so no need to have a rlock here. local := rm.Origin == as.jsa.id // Get the stream sequence for this message. - seq, _, _ := ackReplyInfo(reply) + seq, _, _, _, _ := ackReplyInfo(reply) if len(m) == 0 { // An empty payload means that we need to remove the retained message. rmSeq := as.removeRetainedMsg(rm.Subject, 0) @@ -2042,7 +2045,7 @@ func (as *mqttAccountSessionManager) processRetainedMsg(_ *subscription, c *clie // Add this retained message. The `rm.Msg` references some buffer that we // don't own. But addRetainedMsg() will take care of making a copy of // `rm.Msg` it `rm` ends-up being stored in the cache. - as.addRetainedMsg(rm.Subject, &mqttRetainedMsgRef{sseq: seq}, rm) + as.addRetainedMsg(rm.Subject, seq, rm) } } @@ -2310,17 +2313,16 @@ func (as *mqttAccountSessionManager) sendJSAPIrequests(s *Server, c *client, acc // If a message for this topic already existed, the existing record is updated // with the provided information. // Lock not held on entry. -func (as *mqttAccountSessionManager) addRetainedMsg(key string, rf *mqttRetainedMsgRef, rm *mqttRetainedMsg) { +func (as *mqttAccountSessionManager) addRetainedMsg(key string, sseq uint64, rm *mqttRetainedMsg) { as.mu.Lock() defer as.mu.Unlock() if as.retmsgs == nil { - as.retmsgs = make(map[string]*mqttRetainedMsgRef) - as.sl = NewSublistWithCache() + as.retmsgs = stree.NewSubjectTree[mqttRetainedMsgRef]() } else { // Check if we already had one retained message. If so, update the existing one. - if erf, exists := as.retmsgs[key]; exists { + if erf, exists := as.retmsgs.Find(stringToBytes(key)); exists { // Update the stream sequence with the new value. - erf.sseq = rf.sseq + erf.sseq = sseq // Update the in-memory retained message cache but only for messages // that are already in the cache, i.e. have been (recently) used. // If that is the case, we ask setCachedRetainedMsg() to make a copy @@ -2329,9 +2331,7 @@ func (as *mqttAccountSessionManager) addRetainedMsg(key string, rf *mqttRetained return } } - rf.sub = &subscription{subject: []byte(key)} - as.retmsgs[key] = rf - as.sl.Insert(rf.sub) + as.retmsgs.Insert([]byte(key), mqttRetainedMsgRef{sseq: sseq}) } // Remove the retained message stored with the `subject` key from the map/cache. @@ -2348,15 +2348,13 @@ func (as *mqttAccountSessionManager) addRetainedMsg(key string, rf *mqttRetained func (as *mqttAccountSessionManager) removeRetainedMsg(subject string, seq uint64) uint64 { as.mu.Lock() defer as.mu.Unlock() - rm, ok := as.retmsgs[subject] + rm, ok := as.retmsgs.Find(stringToBytes(subject)) if !ok || (seq > 0 && rm.sseq != seq) { return 0 } - seq = rm.sseq + rm, _ = as.retmsgs.Delete(stringToBytes(subject)) as.rmsCache.Delete(subject) - delete(as.retmsgs, subject) - as.sl.Remove(rm.sub) - return seq + return rm.sseq } // First check if this session's client ID is already in the "locked" map, @@ -2684,27 +2682,22 @@ func (as *mqttAccountSessionManager) processSubs(sess *mqttSession, c *client, // Account session manager lock held on entry. // Session lock held on entry. func (as *mqttAccountSessionManager) serializeRetainedMsgsForSub(rms map[string]*mqttRetainedMsg, sess *mqttSession, c *client, sub *subscription, trace bool) { - if len(as.retmsgs) == 0 || len(rms) == 0 { - return - } - result := as.sl.ReverseMatch(string(sub.subject)) - if len(result.psubs) == 0 { + if as.retmsgs.Size() == 0 || len(rms) == 0 { return } toTrace := []mqttPublish{} - for _, psub := range result.psubs { - - rm := rms[string(psub.subject)] + as.retmsgs.Match(sub.subject, func(subj []byte, _ *mqttRetainedMsgRef) { + rm := rms[string(subj)] if rm == nil { // This should not happen since we pre-load messages into rms before // calling serialize. - continue + return } var pi uint16 qos := min(mqttGetQoS(rm.Flags), sub.mqtt.qos) if c.mqtt.rejectQoS2Pub && qos == 2 { c.Warnf("Rejecting retained message with QoS2 for subscription %q, as configured", sub.subject) - continue + return } if qos > 0 { pi = sess.trackPublishRetained() @@ -2731,7 +2724,7 @@ func (as *mqttAccountSessionManager) serializeRetainedMsgsForSub(rms map[string] sz: len(rm.Msg), }) } - } + }) for _, pp := range toTrace { c.traceOutOp("PUBLISH", []byte(mqttPubTrace(&pp))) } @@ -2743,27 +2736,21 @@ func (as *mqttAccountSessionManager) serializeRetainedMsgsForSub(rms map[string] // Account session manager NOT lock held on entry. func (as *mqttAccountSessionManager) addRetainedSubjectsForSubject(list map[string]uint64, topSubject string) { as.mu.RLock() - if len(as.retmsgs) == 0 { - as.mu.RUnlock() + defer as.mu.RUnlock() + + if as.retmsgs.Size() == 0 { return } - result := as.sl.ReverseMatch(topSubject) - as.mu.RUnlock() - for _, sub := range result.psubs { - if _, ok := list[string(sub.subject)]; ok { - continue + as.retmsgs.Match(stringToBytes(topSubject), func(subj []byte, ret *mqttRetainedMsgRef) { + subject := string(subj) + if _, ok := list[subject]; ok { + return } - var seq uint64 - as.mu.RLock() - if rm, ok := as.retmsgs[string(sub.subject)]; ok { - seq = rm.sseq + if seq := ret.sseq; seq > 0 { + list[subject] = seq } - as.mu.RUnlock() - if seq > 0 { - list[string(sub.subject)] = seq - } - } + }) } type warner interface { @@ -3457,7 +3444,7 @@ func (sess *mqttSession) trackPublish(jsDur, jsAckSubject string) (uint16, bool) } // Get the stream sequence and duplicate flag from the ack reply subject. - sseq, _, dcount := ackReplyInfo(jsAckSubject) + sseq, _, dcount, _, _ := ackReplyInfo(jsAckSubject) if dcount > 1 { dup = true } @@ -3561,7 +3548,7 @@ func (sess *mqttSession) trackAsPubRel(pi uint16, jsAckSubject string) { return } - sseq, _, _ := ackReplyInfo(jsAckSubject) + sseq, _, _, _, _ := ackReplyInfo(jsAckSubject) if sess.cpending == nil { sess.cpending = make(map[string]map[uint64]uint16) @@ -4568,13 +4555,8 @@ func (s *Server) mqttCheckPubRetainedPerms() { } sm.mu.RUnlock() - type retainedMsg struct { - subj string - rmsg *mqttRetainedMsgRef - } - // For each session we will obtain a list of retained messages. - var _rms [128]retainedMsg + var _rms [128]uint64 rms := _rms[:0] for _, asm := range asms { // Get all of the retained messages. Then we will sort them so @@ -4582,19 +4564,20 @@ func (s *Server) mqttCheckPubRetainedPerms() { // store to not have to load out-of-order blocks so often. asm.mu.RLock() rms = rms[:0] // reuse slice - for subj, rf := range asm.retmsgs { - rms = append(rms, retainedMsg{ - subj: subj, - rmsg: rf, - }) - } + // Copy the sequence out of the tree. The tree entry itself can be + // updated concurrently by addRetainedMsg() after we release the lock, + // so keeping a pointer here would race with the later sort. + asm.retmsgs.IterOrdered(func(_ []byte, rm *mqttRetainedMsgRef) bool { + rms = append(rms, rm.sseq) + return true + }) jsaID := asm.jsa.id asm.mu.RUnlock() - slices.SortFunc(rms, func(i, j retainedMsg) int { return cmp.Compare(i.rmsg.sseq, j.rmsg.sseq) }) + slices.Sort(rms) - perms := map[string]*perm{} + perms := map[string]*mqttPerm{} for _, rf := range rms { - jsm, err := asm.jsa.loadMsg(mqttRetainedMsgsStreamName, rf.rmsg.sseq) + jsm, err := asm.jsa.loadMsg(mqttRetainedMsgsStreamName, rf) if err != nil || jsm == nil { continue } @@ -4617,7 +4600,7 @@ func (s *Server) mqttCheckPubRetainedPerms() { } // If there is permission and no longer allowed to publish in // the subject, remove the publish retained message from the map. - if p != nil && !pubAllowed(p, rf.subj) { + if p != nil && !pubAllowed(p, rm.Subject) { u = nil } } @@ -4636,7 +4619,12 @@ func (s *Server) mqttCheckPubRetainedPerms() { } // Helper to generate only pub permissions from a Permissions object -func generatePubPerms(perms *Permissions) *perm { +type mqttPerm struct { + allow *gsl.SimpleSublist + deny *gsl.SimpleSublist +} + +func generatePubPerms(perms *Permissions) *mqttPerm { // If given permissions is `nil`, then it means that permissions block // has been removed (so the user is now allowed to publish on everything) // or was never there in the first place. Returning `nil` will let the @@ -4644,39 +4632,38 @@ func generatePubPerms(perms *Permissions) *perm { if perms == nil { return nil } - var p *perm + var p *mqttPerm if perms.Publish.Allow != nil { - p = &perm{} - p.allow = NewSublistWithCache() + p = &mqttPerm{} + p.allow = gsl.NewSimpleSublist() for _, pubSubject := range perms.Publish.Allow { - sub := &subscription{subject: []byte(pubSubject)} - p.allow.Insert(sub) + _ = p.allow.Insert(pubSubject, struct{}{}) } } if len(perms.Publish.Deny) > 0 { if p == nil { - p = &perm{} + p = &mqttPerm{} } - p.deny = NewSublistWithCache() + p.deny = gsl.NewSimpleSublist() for _, pubSubject := range perms.Publish.Deny { - sub := &subscription{subject: []byte(pubSubject)} - p.deny.Insert(sub) + _ = p.deny.Insert(pubSubject, struct{}{}) } } return p } // Helper that checks if given `perms` allow to publish on the given `subject` -func pubAllowed(perms *perm, subject string) bool { +func pubAllowed(perms *mqttPerm, subject string) bool { + if perms == nil { + return true + } allowed := true if perms.allow != nil { - np, _ := perms.allow.NumInterest(subject) - allowed = np != 0 + allowed = perms.allow.HasInterest(subject) } // If we have a deny list and are currently allowed, check that as well. if allowed && perms.deny != nil { - np, _ := perms.deny.NumInterest(subject) - allowed = np == 0 + allowed = !perms.deny.HasInterest(subject) } return allowed } @@ -5729,6 +5716,12 @@ func mqttToNATSSubjectConversion(mt []byte, wcOk bool) ([]byte, error) { case ' ': // As of now, we cannot support ' ' in the MQTT topic/filter. return nil, errMQTTUnsupportedCharacters + case 0x7f: + // SubjectTree uses DEL as an internal pivot marker, so retained + // subjects containing it cannot be indexed safely, including + // legacy retained messages recovered from the retained-message + // stream. + return nil, errMQTTUnsupportedCharacters case btsep: if !cp { makeCopy(i) diff --git a/vendor/github.com/nats-io/nats-server/v2/server/msgtrace.go b/vendor/github.com/nats-io/nats-server/v2/server/msgtrace.go index 1cbb6dcbc..c51be8ee8 100644 --- a/vendor/github.com/nats-io/nats-server/v2/server/msgtrace.go +++ b/vendor/github.com/nats-io/nats-server/v2/server/msgtrace.go @@ -1,4 +1,4 @@ -// Copyright 2024-2025 The NATS Authors +// Copyright 2024-2026 The NATS Authors // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. // You may obtain a copy of the License at @@ -26,6 +26,7 @@ import ( const ( MsgTraceDest = "Nats-Trace-Dest" + MsgTraceDestDisabled = "trace disabled" // This must be an invalid NATS subject MsgTraceHop = "Nats-Trace-Hop" MsgTraceOriginAccount = "Nats-Trace-Origin-Account" MsgTraceOnly = "Nats-Trace-Only" @@ -33,10 +34,19 @@ const ( // External trace header. Note that this header is normally in lower // case (https://www.w3.org/TR/trace-context/#header-name). Vendors // MUST expect the header in any case (upper, lower, mixed), and - // SHOULD send the header name in lowercase. + // SHOULD send the header name in lowercase. We used to change it + // to lower case, but no longer do that in 2.14. traceParentHdr = "traceparent" ) +var ( + traceDestHdrAsBytes = stringToBytes(MsgTraceDest) + traceDestDisabledAsBytes = stringToBytes(MsgTraceDestDisabled) + traceParentHdrAsBytes = stringToBytes(traceParentHdr) + crLFAsBytes = stringToBytes(CR_LF) + dashAsBytes = stringToBytes("-") +) + type MsgTraceType string // Type of message trace events in the MsgTraceEvents list. @@ -352,7 +362,6 @@ func (c *client) initMsgTrace() *msgTrace { } return vv[0] } - ct := getCompressionType(getHdrVal(acceptEncodingHeader)) var ( dest string traceOnly bool @@ -454,9 +463,9 @@ func (c *client) initMsgTrace() *msgTrace { } // Check sampling, but only from origin server. if c.kind == CLIENT && !sample(sampling) { - // Need to desactivate the traceParentHdr so that if the message - // is routed, it does possibly trigger a trace there. - disableTraceHeaders(c, hdr) + // Need to disable tracing so that if the message is routed, it won't + // trigger a trace there. + c.msgBuf = c.setHeader(MsgTraceDest, MsgTraceDestDisabled, c.msgBuf) return nil } } @@ -465,7 +474,7 @@ func (c *client) initMsgTrace() *msgTrace { acc: acc, oan: oan, dest: dest, - ct: ct, + ct: getCompressionType(getHdrVal(acceptEncodingHeader)), hop: hop, event: &MsgTraceEvent{ Request: MsgTraceRequest{ @@ -503,9 +512,7 @@ func sample(sampling int) bool { // the headers have been lifted due to the presence of the external trace header // only. // Note that because of the traceParentHdr, the search is done in a case -// insensitive way, but if the header is found, it is rewritten in lower case -// as suggested by the spec, but also to make it easier to disable the header -// when needed. +// insensitive way. We used to rewrite it in lower case but no longer do since v2.14. func genHeaderMapIfTraceHeadersPresent(hdr []byte) (map[string][]string, bool) { var ( @@ -520,11 +527,6 @@ func genHeaderMapIfTraceHeadersPresent(hdr []byte) (map[string][]string, bool) { return nil, false } - traceDestHdrAsBytes := stringToBytes(MsgTraceDest) - traceParentHdrAsBytes := stringToBytes(traceParentHdr) - crLFAsBytes := stringToBytes(CR_LF) - dashAsBytes := stringToBytes("-") - keys := _keys[:0] vals := _vals[:0] @@ -537,46 +539,50 @@ func genHeaderMapIfTraceHeadersPresent(hdr []byte) (map[string][]string, bool) { keyStart := i key := hdr[keyStart : keyStart+del] i += del + 1 + for i < len(hdr) && (hdr[i] == ' ' || hdr[i] == '\t') { + i++ + } valStart := i nl := bytes.Index(hdr[valStart:], crLFAsBytes) if nl < 0 { break } - if len(key) > 0 { - val := bytes.Trim(hdr[valStart:valStart+nl], " \t") + valEnd := valStart + nl + for valEnd > valStart && (hdr[valEnd-1] == ' ' || hdr[valEnd-1] == '\t') { + valEnd-- + } + val := hdr[valStart:valEnd] + if len(key) > 0 && len(val) > 0 { vals = append(vals, val) + // We search for our special keys only if not already found. + // Check for the external trace header. - if bytes.EqualFold(key, traceParentHdrAsBytes) { - // Rewrite the header using lower case if needed. - if !bytes.Equal(key, traceParentHdrAsBytes) { - copy(hdr[keyStart:], traceParentHdrAsBytes) - } + // Search needs to be case insensitive. + if !traceParentHdrFound && bytes.EqualFold(key, traceParentHdrAsBytes) { // We will now check if the value has sampling or not. // TODO(ik): Not sure if this header can have multiple values // or not, and if so, what would be the rule to check for // sampling. What is done here is to check them all until we // found one with sampling. - if !traceParentHdrFound { - tk := bytes.Split(val, dashAsBytes) - if len(tk) == 4 && len([]byte(tk[3])) == 2 { - if hexVal, err := strconv.ParseInt(bytesToString(tk[3]), 16, 8); err == nil { - if hexVal&0x1 == 0x1 { - traceParentHdrFound = true - } + tk := bytes.Split(val, dashAsBytes) + if len(tk) == 4 && len([]byte(tk[3])) == 2 { + if hexVal, err := strconv.ParseInt(bytesToString(tk[3]), 16, 8); err == nil { + if hexVal&0x1 == 0x1 { + traceParentHdrFound = true } } } - // Add to the keys with the external trace header in lower case. - keys = append(keys, traceParentHdrAsBytes) - } else { - // Is the key the Nats-Trace-Dest header? - if bytes.EqualFold(key, traceDestHdrAsBytes) { - traceDestHdrFound = true + } else if !traceDestHdrFound && bytes.Equal(key, traceDestHdrAsBytes) { + // This is the Nats-Trace-Dest header, check the value to see + // if it indicates that the trace was disabled. + if bytes.Equal(val, traceDestDisabledAsBytes) { + return nil, false } - // Add to the keys and preserve the key's case - keys = append(keys, key) + traceDestHdrFound = true } + // Add to the keys and preserve the key's case + keys = append(keys, key) } i += nl + 2 } @@ -655,59 +661,6 @@ func (t *msgTrace) setHopHeader(c *client, msg []byte) []byte { return c.setHeader(MsgTraceHop, t.nhop, msg) } -// Will look for the MsgTraceSendTo and traceParentHdr headers and change the first -// character to an 'X' so that if this message is sent to a remote, the remote -// will not initialize tracing since it won't find the actual trace headers. -// The function returns the position of the headers so it can efficiently be -// re-enabled by calling enableTraceHeaders. -// Note that if `msg` can be either the header alone or the full message -// (header and payload). This function will use c.pa.hdr to limit the -// search to the header section alone. -func disableTraceHeaders(c *client, msg []byte) []int { - // Code largely copied from getHeader(), except that we don't need the value - if c.pa.hdr <= 0 { - return []int{-1, -1} - } - hdr := msg[:c.pa.hdr] - headers := [2]string{MsgTraceDest, traceParentHdr} - positions := [2]int{-1, -1} - for i := 0; i < 2; i++ { - key := stringToBytes(headers[i]) - pos := bytes.Index(hdr, key) - if pos < 0 { - continue - } - // Make sure this key does not have additional prefix. - if pos < 2 || hdr[pos-1] != '\n' || hdr[pos-2] != '\r' { - continue - } - index := pos + len(key) - if index >= len(hdr) { - continue - } - if hdr[index] != ':' { - continue - } - // Disable the trace by altering the first character of the header - hdr[pos] = 'X' - positions[i] = pos - } - // Return the positions of those characters so we can re-enable the headers. - return positions[:2] -} - -// Changes back the character at the given position `pos` in the `msg` -// byte slice to the first character of the MsgTraceSendTo header. -func enableTraceHeaders(msg []byte, positions []int) { - firstChar := [2]byte{MsgTraceDest[0], traceParentHdr[0]} - for i, pos := range positions { - if pos == -1 { - continue - } - msg[pos] = firstChar[i] - } -} - func (t *msgTrace) setIngressError(err string) { if i := t.event.Ingress(); i != nil { i.Error = err diff --git a/vendor/github.com/nats-io/nats-server/v2/server/opts.go b/vendor/github.com/nats-io/nats-server/v2/server/opts.go index 3828aa66d..3ef3a60d4 100644 --- a/vendor/github.com/nats-io/nats-server/v2/server/opts.go +++ b/vendor/github.com/nats-io/nats-server/v2/server/opts.go @@ -27,6 +27,7 @@ import ( "os" "path" "path/filepath" + "reflect" "regexp" "runtime" "strconv" @@ -108,6 +109,34 @@ type CompressionOpts struct { RTTThresholds []time.Duration } +func (c1 *CompressionOpts) equals(c2 *CompressionOpts) bool { + if c1 == c2 { + return true + } + if (c1 == nil && c2 != nil) || (c1 != nil && c2 == nil) { + return false + } + if c1.Mode != c2.Mode { + return false + } + // For s2_auto, if one has an empty RTTThresholds, it is equivalent + // to the defaultCompressionS2AutoRTTThresholds array, so compare with that. + if c1.Mode == CompressionS2Auto { + rtts1 := c1.RTTThresholds + if len(rtts1) == 0 { + rtts1 = defaultCompressionS2AutoRTTThresholds + } + rtts2 := c2.RTTThresholds + if len(rtts2) == 0 { + rtts2 = defaultCompressionS2AutoRTTThresholds + } + if !reflect.DeepEqual(rtts1, rtts2) { + return false + } + } + return true +} + // GatewayOpts are options for gateways. // NOTE: This structure is no longer used for monitoring endpoints // and json tags are deprecated and may be removed in the future. @@ -283,6 +312,48 @@ type RemoteLeafOpts struct { // existing connection will be closed and not solicited again (until it is changed // to `false` again. Disabled bool `json:"-"` + + // If this is set to true, this remote will ignore any server leafnode URLs + // returned by the hub, allowing the user to fully manage the servers this + // remote can connect to. + IgnoreDiscoveredServers bool `json:"-"` +} + +// Returns a string representation of this `RemoteLeafOpts` object, containing +// the URLs (unredacted), the account (or "$G" if none is specified) and, if present, +// the credentials filename. +func (r *RemoteLeafOpts) name() string { + return generateRemoteLeafOptsName(r, false) +} + +// Same than RemoteLeafOpts.name() but uses redacted URLs. This is to be used for logging. +func (r *RemoteLeafOpts) safeName() string { + return generateRemoteLeafOptsName(r, true) +} + +func generateRemoteLeafOptsName(r *RemoteLeafOpts, redacted bool) string { + acc := r.LocalAccount + if acc == _EMPTY_ { + acc = globalAccountName + } + var optional string + // There could be Credentials or NKey, not both (would be caught as a misconfig) + if c := r.Credentials; c != _EMPTY_ { + optional = fmt.Sprintf(", credentials=%q", c) + } else if nk := r.Nkey; nk != _EMPTY_ { + if redacted { + optional = ", nkey=\"[REDACTED]\"" + } else { + optional = fmt.Sprintf(", nkey=%q", nk) + } + } + var urls []*url.URL + if redacted { + urls = redactURLList(r.URLs) + } else { + urls = r.URLs + } + return fmt.Sprintf("urls=%q, account=%q%s", urls, acc, optional) } // JSLimitOpts are active limits for the meta cluster @@ -387,6 +458,7 @@ type Options struct { JetStreamTpm JSTpmOpts JetStreamMaxCatchup int64 JetStreamRequestQueueLimit int64 + JetStreamInfoQueueLimit int64 JetStreamMetaCompact uint64 JetStreamMetaCompactSize uint64 JetStreamMetaCompactSync bool @@ -478,6 +550,9 @@ type Options struct { // Metadata describing the server. They will be included in 'Z' responses. Metadata map[string]string `json:"-"` + // FeatureFlags the server opts-in to (or opts-out of). They will be included in 'Z' responses. + FeatureFlags map[string]bool `json:"-"` + // OCSPConfig enables OCSP Stapling in the server. OCSPConfig *OCSPConfig tlsConfigOpts *TLSConfigOpts @@ -1748,6 +1823,29 @@ func (o *Options) processConfigFileLine(k string, v any, errors *[]error, warnin *errors = append(*errors, err) return } + case "feature_flags": + var err error + switch v := v.(type) { + case map[string]any: + for mk, mv := range v { + tk, mv = unwrapValue(mv, <) + b, ok := mv.(bool) + if !ok { + err = &configErr{tk, fmt.Sprintf("error parsing feature flag %q: expected bool, got %T", mk, mv)} + break + } + if o.FeatureFlags == nil { + o.FeatureFlags = make(map[string]bool) + } + o.FeatureFlags[mk] = b + } + default: + err = &configErr{tk, fmt.Sprintf("error parsing feature flags: unsupported type %T", v)} + } + if err != nil { + *errors = append(*errors, err) + return + } case "default_js_domain": vv, ok := v.(map[string]any) if !ok { @@ -2641,6 +2739,12 @@ func parseJetStream(v any, opts *Options, errors *[]error, warnings *[]error) er return &configErr{tk, fmt.Sprintf("Expected a parseable size for %q, got %v", mk, mv)} } opts.JetStreamRequestQueueLimit = lim + case "info_queue_limit": + lim, ok := mv.(int64) + if !ok { + return &configErr{tk, fmt.Sprintf("Expected a parseable size for %q, got %v", mk, mv)} + } + opts.JetStreamInfoQueueLimit = lim case "meta_compact": thres, ok := mv.(int64) if !ok || thres < 0 { @@ -2936,6 +3040,7 @@ func parseRemoteLeafNodes(v any, errors *[]error, warnings *[]error) ([]*RemoteL if !ok { return nil, &configErr{tk, fmt.Sprintf("Expected remotes field to be an array, got %T", v)} } + names := make(map[string]struct{}) remotes := make([]*RemoteLeafOpts, 0, len(ra)) for _, r := range ra { tk, r = unwrapValue(r, <) @@ -3105,6 +3210,8 @@ func parseRemoteLeafNodes(v any, errors *[]error, warnings *[]error) ([]*RemoteL } } } + case "ignore_discovered_servers": + remote.IgnoreDiscoveredServers = v.(bool) default: if !tk.IsUsedVariable() { err := &unknownConfigFieldErr{ @@ -3128,6 +3235,12 @@ func parseRemoteLeafNodes(v any, errors *[]error, warnings *[]error) ([]*RemoteL *warnings = append(*warnings, &configErr{proxyToken, warn}) } } + rn := remote.name() + if _, dup := names[rn]; dup { + *errors = append(*errors, &configErr{tk, fmt.Sprintf("duplicate remote %s", remote.safeName())}) + continue + } + names[rn] = struct{}{} remotes = append(remotes, remote) } return remotes, nil @@ -6006,6 +6119,9 @@ func setBaselineOptions(opts *Options) { if opts.JetStreamRequestQueueLimit <= 0 { opts.JetStreamRequestQueueLimit = JSDefaultRequestQueueLimit } + if opts.JetStreamInfoQueueLimit <= 0 { + opts.JetStreamInfoQueueLimit = opts.JetStreamRequestQueueLimit + } } func getDefaultAuthTimeout(tls *tls.Config, tlsTimeout float64) float64 { @@ -6439,14 +6555,56 @@ func expandPath(p string) (string, error) { // RedactArgs redacts sensitive arguments from the command line. // For example, turns '--pass=secret' into '--pass=[REDACTED]'. func RedactArgs(args []string) { - secret := regexp.MustCompile("^-{1,2}(user|pass|auth)(=.*)?$") + secretArg := regexp.MustCompile("^-{1,2}(user|pass|auth)(=.*)?$") + routeURLArg := regexp.MustCompile("^-{1,2}(routes)(=.*)?$") + singleURLArg := regexp.MustCompile("^-{1,2}(cluster|cluster_listen)(=.*)?$") for i, arg := range args { - if secret.MatchString(arg) { - if idx := strings.Index(arg, "="); idx != -1 { - args[i] = arg[:idx] + "=[REDACTED]" - } else if i+1 < len(args) { - args[i+1] = "[REDACTED]" - } + switch { + case secretArg.MatchString(arg): + redactArgValue(args, i, func(_ string) string { return "[REDACTED]" }) + case routeURLArg.MatchString(arg): + redactArgValue(args, i, redactURLListUser) + case singleURLArg.MatchString(arg): + redactArgValue(args, i, redactURLUser) } } } + +func redactArgValue(args []string, i int, redact func(string) string) { + if flag, value, ok := strings.Cut(args[i], "="); ok { + args[i] = flag + "=" + redact(value) + } else if i+1 < len(args) { + args[i+1] = redact(args[i+1]) + } +} + +func redactURLUser(raw string) string { + if !strings.Contains(raw, "@") { + return raw + } + parseValue := strings.TrimSpace(raw) + restoreRandom := false + if prefix, ok := strings.CutSuffix(parseValue, ":-1"); ok { + parseValue = prefix + ":0" + restoreRandom = true + } + u, err := url.Parse(parseValue) + if err != nil || u.User == nil { + return raw + } + // url.String escapes brackets in userinfo, so use + // a placeholder here and rewrite it afterward. + u.User = url.User("_REDACTED_") + if restoreRandom { + u.Host = strings.TrimSuffix(u.Host, ":0") + ":-1" + } + return strings.Replace(u.String(), "_REDACTED_@", "[REDACTED]@", 1) +} + +func redactURLListUser(raw string) string { + parts := strings.Split(raw, ",") + for i, part := range parts { + parts[i] = redactURLUser(part) + } + return strings.Join(parts, ",") +} diff --git a/vendor/github.com/nats-io/nats-server/v2/server/parser.go b/vendor/github.com/nats-io/nats-server/v2/server/parser.go index ef25e0931..b91e1541e 100644 --- a/vendor/github.com/nats-io/nats-server/v2/server/parser.go +++ b/vendor/github.com/nats-io/nats-server/v2/server/parser.go @@ -166,32 +166,40 @@ func (c *client) parse(buf []byte) error { goto authErr } var ok bool - // Check here for NoAuthUser. If this is set allow non CONNECT protos as our first. - // E.g. telnet proto demos. - if noAuthUser := s.getOpts().NoAuthUser; noAuthUser != _EMPTY_ { - s.mu.Lock() - user, exists := s.users[noAuthUser] - s.mu.Unlock() - if exists { - c.RegisterUser(user) - c.mu.Lock() - c.clearAuthTimer() - c.flags.set(connectReceived) - c.mu.Unlock() - authSet, ok = false, true + switch c.kind { + case CLIENT: + // Check here for NoAuthUser. If this is set allow non CONNECT protos as our first. + // E.g. telnet proto demos. + opts := s.getOpts() + noAuthUser := opts.NoAuthUser + if c.ws != nil { + if noAuthUserWS := opts.Websocket.NoAuthUser; noAuthUserWS != _EMPTY_ { + noAuthUser = noAuthUserWS + } } + if noAuthUser != _EMPTY_ { + s.mu.Lock() + user, exists := s.users[noAuthUser] + s.mu.Unlock() + if exists { + c.RegisterUser(user) + c.mu.Lock() + c.clearAuthTimer() + c.flags.set(connectReceived) + c.mu.Unlock() + authSet, ok = false, true + } + } + case LEAF: + // Compressed inbound leaf-node negotiation may require INFO + // before CONNECT. Without compression, leaf connections must + // still start with CONNECT. + ok = (b == 'I' || b == 'i') && needsCompression(s.getOpts().LeafNode.Compression.Mode) } if !ok { goto authErr } } - // If the connection is a gateway connection, make sure that - // if this is an inbound, it starts with a CONNECT. - if c.kind == GATEWAY && !c.gw.outbound && !c.gw.connected { - // Use auth violation since no CONNECT was sent. - // It could be a parseErr too. - goto authErr - } } switch b { case 'P', 'p': @@ -1250,10 +1258,17 @@ func protoSnippet(start, max int, buf []byte) string { // If so, an error is sent to the client and the connection is closed. // The error ErrMaxControlLine is returned. func (c *client) overMaxControlLineLimit(arg []byte, mcl int32) error { + // Widen to int64 so mcl*16 cannot overflow for large configured values. + effective := int64(mcl) if c.kind != CLIENT { - return nil + // This is the upper bound on argBuf length for LEAF, ROUTER, and GATEWAY connections. + // These kinds need longer arg lines than CLIENT (which is capped at mcl=4096 by default) + // because cluster/leaf frames encode origin, account, reply, and queue groups. + // By default, this is 64 KB, which matches maxBufSize so a single oversized read + // is caught on the very next parse call. + effective *= 16 } - if len(arg) > int(mcl) { + if int64(len(arg)) > effective { err := NewErrorCtx(ErrMaxControlLine, "State %d, max_control_line %d, Buffer len %d (snip: %s...)", c.state, int(mcl), len(c.argBuf), protoSnippet(0, MAX_CONTROL_LINE_SNIPPET_SIZE, arg)) c.sendErr(err.Error()) diff --git a/vendor/github.com/nats-io/nats-server/v2/server/raft.go b/vendor/github.com/nats-io/nats-server/v2/server/raft.go index a437b9850..5055297e7 100644 --- a/vendor/github.com/nats-io/nats-server/v2/server/raft.go +++ b/vendor/github.com/nats-io/nats-server/v2/server/raft.go @@ -89,6 +89,7 @@ type RaftNode interface { RecreateInternalSubs() error IsSystemAccount() bool GetTrafficAccountName() string + GetWriteErr() error } // RaftNodeCheckpoint is used as an alternative to a direct InstallSnapshot. @@ -248,6 +249,9 @@ type raft struct { scaleUp bool // The node is part of a scale up, puts us in observer mode until the log contains data. deleted bool // If the node was deleted. snapshotting bool // Snapshot is in progress. + quorumPaused bool // Pause replication and quorum participation to prevent log growth during slow applies. + + overrunCount uint64 // Counter of how many times we were overrun, either as follower or as leader. } type proposedEntry struct { @@ -487,9 +491,12 @@ func (s *Server) initRaftNode(accName string, cfg *RaftConfig, labels pprofLabel n.papplied = 0 if _, ok := n.wal.(*memStore); ok { _ = os.RemoveAll(filepath.Join(n.sd, snapshotsDir)) - } else { - // See if we have any snapshots and if so load and process on startup. - n.setupLastSnapshot() + } else if err := n.setupLastSnapshot(); err != nil && err != errNoSnapAvailable { + // If we failed to recover from the snapshot, then we should surface + // the error upwards, otherwise we can complete recovery but have only + // a partial view of the world. + n.shutdown() + return nil, err } // We may have restored the peer state from the @@ -503,6 +510,7 @@ func (s *Server) initRaftNode(accName string, cfg *RaftConfig, labels pprofLabel // Make sure that the snapshots directory exists. if err := os.MkdirAll(filepath.Join(n.sd, snapshotsDir), defaultDirPerms); err != nil { + n.shutdown() return nil, fmt.Errorf("could not create snapshots directory - %v", err) } @@ -521,12 +529,6 @@ func (s *Server) initRaftNode(accName string, cfg *RaftConfig, labels pprofLabel if state.Msgs > 0 { n.debug("Replaying state of %d entries", state.Msgs) - if first, err := n.loadFirstEntry(); err == nil { - n.pterm, n.pindex = first.pterm, first.pindex - if first.commit > 0 && first.commit > n.commit { - n.commit = first.commit - } - } // This process will queue up entries on our applied queue but prior to the upper // state machine running. So we will monitor how much we have queued and if we @@ -537,6 +539,25 @@ func (s *Server) initRaftNode(accName string, cfg *RaftConfig, labels pprofLabel // yet. Replay them. for index, qsz := state.FirstSeq, 0; index <= state.LastSeq; index++ { ae, err := n.loadEntry(index) + // The first entry in our WAL initializes state but must align with our snapshot if we had one. + // Importantly, check this first, as we might need to truncate the WAL further than the index. + if index == state.FirstSeq { + // If the entry is missing, corrupt, or doesn't align with the snapshot, truncate the WAL. + if err != nil || ae == nil || ae.pindex != index-1 || n.pindex != ae.pindex { + if err != nil { + n.warn("Could not load %d from WAL [%+v]: %v", index, state, err) + } else { + n.warn("Misaligned WAL, will truncate") + } + // Truncate to the snapshot or beginning if there is none. + truncateAndErr(n.pindex) + break + } + n.pterm, n.pindex = ae.pterm, ae.pindex + if ae.commit > 0 && ae.commit > n.commit { + n.commit = ae.commit + } + } if err != nil { n.warn("Could not load %d from WAL [%+v]: %v", index, state, err) // Truncate to the previous correct entry. @@ -902,6 +923,16 @@ func (n *raft) Propose(data []byte) error { if werr := n.werr; werr != nil { return werr } + + if n.isLeaderOverrun() { + var state StreamState + n.wal.FastState(&state) + n.warn("Leader falling behind, stepping down: pindex %d, commit %d, applied %d, WAL size %s", n.pindex, n.commit, n.applied, friendlyBytes(state.Bytes)) + // Stepdown without leader transfer, likely all replicas will be overrun, and we need time to recover. + n.stepdownLocked(noLeader) + n.overrunCount++ + return errNotLeader + } n.prop.push(newProposedEntry(newEntry(EntryNormal, data), _EMPTY_)) return nil } @@ -921,12 +952,39 @@ func (n *raft) ProposeMulti(entries []*Entry) error { if werr := n.werr; werr != nil { return werr } + + if n.isLeaderOverrun() { + var state StreamState + n.wal.FastState(&state) + n.warn("Leader falling behind, stepping down: pindex %d, commit %d, applied %d, WAL size %s", n.pindex, n.commit, n.applied, friendlyBytes(state.Bytes)) + // Stepdown without leader transfer, likely all replicas will be overrun, and we need time to recover. + n.stepdownLocked(noLeader) + n.overrunCount++ + return errNotLeader + } for _, e := range entries { n.prop.push(newProposedEntry(e, _EMPTY_)) } return nil } +// isLeaderOverrun returns whether we are overrun and should step down due to continuously increasing +// uncommitted or unapplied entries. If triggered, this means we're being severely overrun by +// incoming proposals or the system is degraded such that it's too slow (or unable) to process them. +// Stepping down means the system gets to "breathe" for a bit, until a new leader can be elected. +// Lock should be held. +func (n *raft) isLeaderOverrun() bool { + applied := max(n.applied, n.papplied) + commit := max(n.commit, n.papplied) + // We only do this past a high threshold to protect ourselves. + // Worst-case we'll have 2x the threshold, once in uncommitted and once in unapplied entries. + // Either the number of uncommitted entries is over the threshold: we're not getting quorum from our followers. + uncommittedThreshold := n.pindex > commit && n.pindex-commit > pauseQuorumThreshold + // Or, the number of in-memory committed but not yet applied entries is over the threshold: we're slow to apply. + unappliedThreshold := commit > applied && commit-applied > pauseQuorumThreshold + return uncommittedThreshold || unappliedThreshold +} + // ForwardProposal will forward the proposal to the leader if known. // If we are the leader this is the same as calling propose. func (n *raft) ForwardProposal(entry []byte) error { @@ -1075,8 +1133,8 @@ func (n *raft) PauseApply() error { } func (n *raft) pauseApplyLocked() { - // If we are currently a candidate make sure we step down. - if n.State() == Candidate { + // If we are currently not a follower, make sure we step down. + if n.State() != Follower { n.stepdownLocked(noLeader) } @@ -1558,11 +1616,14 @@ func termAndIndexFromSnapFile(sn string) (term, index uint64, err error) { // setupLastSnapshot is called at startup to try and recover the last snapshot from // the disk if possible. We will try to recover the term, index and commit/applied // indices and then notify the upper layer what we found. Compacts the WAL if needed. -func (n *raft) setupLastSnapshot() { +func (n *raft) setupLastSnapshot() error { snapDir := filepath.Join(n.sd, snapshotsDir) psnaps, err := os.ReadDir(snapDir) if err != nil { - return + if os.IsNotExist(err) { + return errNoSnapAvailable + } + return err } var lterm, lindex uint64 @@ -1586,18 +1647,8 @@ func (n *raft) setupLastSnapshot() { os.Remove(sfile) } } - - // Now cleanup any old entries - for _, sf := range psnaps { - sfile := filepath.Join(snapDir, sf.Name()) - if sfile != latest { - n.debug("Removing old snapshot: %q", sfile) - os.Remove(sfile) - } - } - if latest == _EMPTY_ { - return + return nil } // Set latest snapshot we have. @@ -1607,13 +1658,7 @@ func (n *raft) setupLastSnapshot() { n.snapfile = latest snap, err := n.loadLastSnapshot() if err != nil { - // We failed to recover the last snapshot for some reason, so we will - // assume it has been corrupted and will try to delete it. - if n.snapfile != _EMPTY_ { - os.Remove(n.snapfile) - n.snapfile = _EMPTY_ - } - return + return err } // We successfully recovered the last snapshot from the disk. @@ -1627,8 +1672,8 @@ func (n *raft) setupLastSnapshot() { n.papplied = snap.lastIndex // Restore the peerState ps, err := decodePeerState(snap.peerstate) - if err == nil { - n.processPeerState(ps) + if err != nil { + return err } n.processPeerState(ps) n.extSt = ps.domainExt @@ -1636,7 +1681,19 @@ func (n *raft) setupLastSnapshot() { n.apply.push(newCommittedEntry(n.commit, []*Entry{{EntrySnapshot, snap.data}})) if _, err := n.wal.Compact(snap.lastIndex + 1); err != nil { n.setWriteErrLocked(err) + return err } + + // Now cleanup any old entries. We only do this once we know that the + // latest snapshot was OK. + for _, sf := range psnaps { + if sfile := filepath.Join(snapDir, sf.Name()); sfile != latest { + n.debug("Removing old snapshot: %q", sfile) + os.Remove(sfile) + } + } + + return nil } // loadLastSnapshot will load and return our last snapshot. @@ -1652,14 +1709,10 @@ func (n *raft) loadLastSnapshot() (*snapshot, error) { if err != nil { n.warn("Error reading snapshot: %v", err) - os.Remove(n.snapfile) - n.snapfile = _EMPTY_ return nil, err } if len(buf) < minSnapshotLen { n.warn("Snapshot corrupt, too short") - os.Remove(n.snapfile) - n.snapfile = _EMPTY_ return nil, errSnapshotCorrupt } @@ -1671,8 +1724,6 @@ func (n *raft) loadLastSnapshot() (*snapshot, error) { var hb [highwayhash.Size64]byte if !bytes.Equal(lchk[:], n.hh.Sum(hb[:0])) { n.warn("Snapshot corrupt, checksums did not match") - os.Remove(n.snapfile) - n.snapfile = _EMPTY_ return nil, errSnapshotCorrupt } @@ -1686,12 +1737,12 @@ func (n *raft) loadLastSnapshot() (*snapshot, error) { } // We had a bug in 2.9.12 that would allow snapshots on last index of 0. - // Detect that here and return err. + // Detect that and continue anyway, nothing else we can do about it. if snap.lastIndex == 0 { n.warn("Snapshot with last index 0 is invalid, cleaning up") os.Remove(n.snapfile) n.snapfile = _EMPTY_ - return nil, errSnapshotCorrupt + return nil, errNoSnapAvailable } return snap, nil @@ -2733,9 +2784,9 @@ func decodeAppendEntry(msg []byte, sub *subscription, reply string) (*appendEntr ae.reply, ae.sub = reply, sub // Decode Entries. - ne, ri := int(le.Uint16(msg[40:])), uint64(42) + ne, ri := int(le.Uint16(msg[40:])), uint64(appendEntryBaseLen) for i, max := 0, uint64(len(msg)); i < ne; i++ { - if ri >= max-1 { + if max-ri < 4 { return nil, errBadAppendEntry } ml := uint64(le.Uint32(msg[ri:])) @@ -2867,20 +2918,44 @@ func (n *raft) handleForwardedProposal(sub *subscription, c *client, _ *Account, msg = copyBytes(msg) n.RLock() + prop := n.prop // Check state under lock, we might not be leader anymore. if n.State() != Leader || !n.leaderState.Load() { n.debug("Ignoring forwarded proposal, not leader") n.RUnlock() return } - prop, werr := n.prop, n.werr - n.RUnlock() // Ignore if we have had a write error previous. - if werr != nil { + if n.werr != nil { + n.RUnlock() return } + if n.isLeaderOverrun() { + n.RUnlock() + n.Lock() + defer n.Unlock() + // Now that we've reacquired as write lock, we need to make sure that everything we + // believed before is still true. Otherwise we've either stepped down already from + // another goroutine or we've stopped being overrun and shouldn't drop the entry. + if n.State() != Leader || !n.leaderState.Load() { + return + } else if !n.isLeaderOverrun() { + prop.push(newProposedEntry(newEntry(EntryNormal, msg), reply)) + return + } + var state StreamState + n.wal.FastState(&state) + n.warn("Leader falling behind, stepping down: pindex %d, commit %d, applied %d, WAL size %s", n.pindex, n.commit, n.applied, friendlyBytes(state.Bytes)) + // Stepdown without leader transfer, likely all replicas will be overrun, and we need time to recover. + n.stepdownLocked(noLeader) + n.overrunCount++ + return + } + // Possible that we could fall through to here from multiple connections but if + // one does end up stepping down then the proposal queue gets drained anyway. + n.RUnlock() prop.push(newProposedEntry(newEntry(EntryNormal, msg), reply)) } @@ -3252,8 +3327,6 @@ func (n *raft) sendSnapshotToFollower(subject string) (uint64, error) { if err != nil { // We need to stepdown here when this happens. n.stepdownLocked(noLeader) - // We need to reset our state here as well. - n.resetWAL() return 0, err } // Go ahead and send the snapshot and peerstate here as first append entry to the catchup follower. @@ -4041,6 +4114,42 @@ func (n *raft) processAppendEntry(ae *appendEntry, sub *subscription) { } } + // If commits are outpacing our applies, temporarily stop accepting new entries to avoid falling further behind. + // This encourages the leader to sync us via a snapshot instead. We use max(applied, papplied) to avoid + // incorrectly triggering this pause immediately after receiving a snapshot. + applied := max(n.applied, n.papplied) + commit := max(n.commit, n.papplied) + if sub != nil && (commit > applied || n.quorumPaused) { + diff := commit - applied + if n.quorumPaused { + if diff > paeWarnThreshold { + if catchingUp { + n.cancelCatchup() + } + n.Unlock() + return + } + // Once we're sufficiently below the threshold, we continue again. We'll likely receive a snapshot + // from the leader. + n.quorumPaused = false + var state StreamState + n.wal.FastState(&state) + n.warn("Quorum resumed: commit %d, applied %d, WAL size %s", commit, applied, friendlyBytes(state.Bytes)) + } else if diff > pauseQuorumThreshold { + // It takes a while until we reach the pause threshold, but once we do we enter a "cooldown period". + n.quorumPaused = true + n.overrunCount++ + var state StreamState + n.wal.FastState(&state) + n.warn("Quorum paused, falling behind: commit %d != applied %d, WAL size %s", commit, applied, friendlyBytes(state.Bytes)) + if catchingUp { + n.cancelCatchup() + } + n.Unlock() + return + } + } + if ae.pterm != n.pterm || ae.pindex != n.pindex { // Check if this is a lower or equal index than what we were expecting. if ae.pindex <= n.pindex { @@ -4086,9 +4195,26 @@ func (n *raft) processAppendEntry(ae *appendEntry, sub *subscription) { } } else { // If terms mismatched, delete that entry and all others past it. - // Make sure to cancel any catchups in progress. - // Truncate will reset our pterm and pindex. Only do so if we have an entry. - n.truncateWAL(eae.pterm, eae.pindex) + // But only if we haven't already committed past this point. + if eae.pindex < n.commit { + success = true + assert.Unreachable("Truncate to earlier entry would lose commits", map[string]any{ + "n.accName": n.accName, + "n.group": n.group, + "n.id": n.id, + "n.term": n.term, + "n.pindex": n.pindex, + "n.commit": n.commit, + "n.applied": n.applied, + "ae.pindex": ae.pindex, + "ae.pterm": ae.pterm, + "ae.commit": ae.commit, + "eae.pterm": eae.pterm, + "eae.pindex": eae.pindex, + }) + } else { + n.truncateWAL(eae.pterm, eae.pindex) + } } // Cancel regardless if unsuccessful. if !success { @@ -4420,9 +4546,10 @@ func (n *raft) storeToWAL(ae *appendEntry) error { } const ( - paeDropThreshold = 20_000 - paeWarnThreshold = 10_000 - paeWarnModulo = 5_000 + pauseQuorumThreshold = 100_000 + paeDropThreshold = 20_000 + paeWarnThreshold = 10_000 + paeWarnModulo = 5_000 ) func (n *raft) sendAppendEntry(entries []*Entry) { @@ -4699,11 +4826,18 @@ func (n *raft) setWriteErrLocked(err error) { } // If this is a not found report but do not disable. if os.IsNotExist(err) { - n.error("Resource not found: %v", err) + n.warn("Resource not found: %v", err) return } n.error("Critical write error: %v", err) n.werr = err + n.shutdown() + assert.Unreachable("Raft encountered write error", map[string]any{ + "n.accName": n.accName, + "n.group": n.group, + "n.id": n.id, + "err": err, + }) if isPermissionError(err) { go n.s.handleWritePermissionError() @@ -4720,6 +4854,13 @@ func (n *raft) isClosed() bool { return n.State() == Closed } +// GetWriteErr returns the write error (if any). +func (n *raft) GetWriteErr() error { + n.RLock() + defer n.RUnlock() + return n.werr +} + // Capture our write error if any and hold. func (n *raft) setWriteErr(err error) { n.Lock() @@ -5033,6 +5174,8 @@ func (n *raft) switchToCandidate() { // Increment the term. n.term++ n.vote = noVote + // Reset quorum paused. If it was previously set, we checked above that we've applied all committed entries. + n.quorumPaused = false // Clear current Leader. n.updateLeader(noLeader) n.switchState(Candidate) diff --git a/vendor/github.com/nats-io/nats-server/v2/server/reload.go b/vendor/github.com/nats-io/nats-server/v2/server/reload.go index c2d467af6..5ef8e6f59 100644 --- a/vendor/github.com/nats-io/nats-server/v2/server/reload.go +++ b/vendor/github.com/nats-io/nats-server/v2/server/reload.go @@ -1,4 +1,4 @@ -// Copyright 2017-2025 The NATS Authors +// Copyright 2017-2026 The NATS Authors // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. // You may obtain a copy of the License at @@ -740,6 +740,35 @@ func (jso jetStreamOption) IsStatszChange() bool { return true } +type jetStreamLimitsOption struct { + noopOption + newMaxMemory int64 + newMaxStore int64 +} + +func (jso *jetStreamLimitsOption) Apply(s *Server) { + js := s.getJetStream() + if js == nil { + return + } + js.mu.Lock() + if jso.newMaxMemory > 0 { + js.config.MaxMemory = jso.newMaxMemory + atomic.StoreInt64(&js.memMax, js.config.MaxMemory) + s.Noticef("Reloaded: JetStream max_mem_store = %s", friendlyBytes(jso.newMaxMemory)) + } + if jso.newMaxStore > 0 { + js.config.MaxStore = jso.newMaxStore + atomic.StoreInt64(&js.storeMax, js.config.MaxStore) + s.Noticef("Reloaded: JetStream max_file_store = %s", friendlyBytes(jso.newMaxStore)) + } + js.mu.Unlock() +} + +func (jso *jetStreamLimitsOption) IsStatszChange() bool { + return true +} + type defaultSentinelOption struct { noopOption newValue string @@ -872,9 +901,207 @@ func (o *profBlockRateReload) Apply(s *Server) { type leafNodeOption struct { noopOption + tlsFirstChanged bool + compressionChanged bool + // These are for the remotes + added []*RemoteLeafOpts + changed map[*leafNodeCfg]*remoteLeafOption +} + +type remoteLeafOption struct { tlsFirstChanged bool compressionChanged bool disabledChanged bool + opts *RemoteLeafOpts +} + +// Given `old` and `new` Leafnode options, this function will return the structure +// used for applying the configuration, or an error is there are changes that +// are not supported. +func getLeafNodeOptionsChanges(s *Server, old, new *LeafNodeOpts) (*leafNodeOption, error) { + + // We can't use DeepEqual for `Users` field, so do custom check. + if usersHaveChanged(old.Users, new.Users) { + return nil, fmt.Errorf("field \"Users\": old=%v, new=%v", old.Users, new.Users) + } + + // Check the main leafnodes{} block to see if there are any changes that are + // not supported. We provide a list of fields to ignore (we already checked, + // allow them to be modified or will check later). + if err := checkConfigsEqual(old, new, []string{ + "Compression", + "Remotes", + "TLSHandshakeFirst", + "TLSHandshakeFirstFallback", + "TLSConfig", + "Users", + }); err != nil { + return nil, err + } + + const ( + remoteErrFormat = "remote %s: %s" + maxAttempts = 20 + ) + var ( + nlo *leafNodeOption + // Track whether any existing remote was not found (i.e. removed). + removed bool + ) + +forLoop: + for failed := range maxAttempts { + removed = false + if failed > 0 { + // If we failed once, we will wait a bit before trying again the remotes. + // This could give enough time for connections that were in progress to complete. + select { + case <-time.After(50 * time.Millisecond): + case <-s.quitCh: + return nil, ErrServerNotRunning + } + } + nlo = &leafNodeOption{ + tlsFirstChanged: (old.TLSHandshakeFirst != new.TLSHandshakeFirst || old.TLSHandshakeFirstFallback != new.TLSHandshakeFirstFallback), + compressionChanged: !old.Compression.equals(&new.Compression), + // Start with all, will update when processing existing ones. + // Since the list will be modified, we need to clone it. + added: slices.Clone(new.Remotes), + } + + s.mu.RLock() + // Go through the list of existing remote configurations. + for lrc := range s.leafRemoteCfgs { + var rlo *RemoteLeafOpts + // Look for the corresponding `*RemoteLeafOpts` in the `nlo.added` + // list. If it is found, that function returns an updated list + // with the element removed from it. + lrc.RLock() + rlo, nlo.added = getRemoteLeafOpts(lrc.name(), nlo.added) + if rlo == nil { + // Not found, will be removed in leafNodeOption.Apply(). + removed = true + lrc.RUnlock() + continue + } + // Now we need to make sure that there are no changes that we don't + // support for a RemoteLeafOpts. + err := checkConfigsEqual(lrc.RemoteLeafOpts, rlo, []string{ + "Compression", + "Disabled", + "TLS", + "TLSHandshakeFirst", + "TLSConfig", + }) + if err != nil { + lrc.RUnlock() + s.mu.RUnlock() + return nil, fmt.Errorf(remoteErrFormat, rlo.safeName(), err) + } + disabledChanged := lrc.Disabled != rlo.Disabled + // If this remote was disabled and is now enabled, we need to make sure + // that there is no connect in progress. If that is the case, either + // try again (if it is the first failure) or return an error. + if disabledChanged && lrc.Disabled && lrc.connInProgress { + lrc.RUnlock() + s.mu.RUnlock() + if failed < maxAttempts-1 { + continue forLoop + } + return nil, fmt.Errorf(remoteErrFormat, rlo.safeName(), + "cannot be enabled at the moment, try again") + } + // Since we will use the new `rlo.TLSConfig` later on, consider all + // existing remote configs as "changed" and store them in the + // `nlo.changed` map. + if nlo.changed == nil { + nlo.changed = make(map[*leafNodeCfg]*remoteLeafOption) + } + lnro := &remoteLeafOption{ + tlsFirstChanged: lrc.TLSHandshakeFirst != rlo.TLSHandshakeFirst, + compressionChanged: !lrc.Compression.equals(&rlo.Compression), + disabledChanged: disabledChanged, + opts: rlo, + } + lrc.RUnlock() + nlo.changed[lrc] = lnro + } + if len(nlo.added) > 0 { + // Go through the added list and check if an added was recently removed and, + // if that is the case, is it still in the `s.rmLeafRemoteCfgs` map, which + // may mean that there was a connect-in-progress that did not complete yet. + // Either try again (if it is the first failure) or return an error. + for _, rlo := range nlo.added { + if _, cip := s.rmLeafRemoteCfgs[rlo.name()]; cip { + s.mu.RUnlock() + if failed < maxAttempts-1 { + continue forLoop + } + return nil, fmt.Errorf(remoteErrFormat, rlo.safeName(), + "cannot be added at the moment, try again") + } + } + } + s.mu.RUnlock() + break + } + + // Now we want to make sure that there were actual changes, so that we don't + // cause a reload of leafnodes for nothing. However, if one has (or all have) + // been removed we still need to invoke leafNodeOption.Apply(). + if !nlo.tlsFirstChanged && !nlo.compressionChanged && !removed && len(nlo.added) == 0 && len(nlo.changed) == 0 { + return nil, nil + } + + return nlo, nil +} + +func usersHaveChanged(ousers, nusers []*User) bool { + if len(ousers) != len(nusers) { + return true + } + // We did not do a strict list order check in the past, so maintain this to + // avoid possible breaking changes. + oua := make(map[string]*User, len(ousers)) + nua := make(map[string]*User, len(nusers)) + for _, u := range ousers { + oua[u.Username] = u + } + for _, u := range nusers { + nua[u.Username] = u + } + for uname, u := range oua { + // If we can not find new one with same name, consider that they have changed. + nu, ok := nua[uname] + if !ok { + return true + } + // Same if password or account has changed. + if u.Password != nu.Password || u.Account.GetName() != nu.Account.GetName() { + return true + } + } + return false +} + +// Given the `search` remote leafnode options name, searches for a match in the `list`. +// If found, returns the `*RemoteLeafOpts` from the list, and the updated list +// without the element in it. If not found, returns `nil` and the unmodified list. +func getRemoteLeafOpts(search string, list []*RemoteLeafOpts) (*RemoteLeafOpts, []*RemoteLeafOpts) { + for i, rlo := range list { + if search == rlo.name() { + lastIdx := len(list) - 1 + if lastIdx == 0 { + return rlo, nil + } + if i < lastIdx { + list[i] = list[lastIdx] + } + list = list[:lastIdx] + return rlo, list + } + } + return nil, list } func (l *leafNodeOption) Apply(s *Server) { @@ -882,101 +1109,181 @@ func (l *leafNodeOption) Apply(s *Server) { if l.tlsFirstChanged { s.Noticef("Reloaded: LeafNode TLS HandshakeFirst value is: %v", opts.LeafNode.TLSHandshakeFirst) s.Noticef("Reloaded: LeafNode TLS HandshakeFirstFallback value is: %v", opts.LeafNode.TLSHandshakeFirstFallback) - for _, r := range opts.LeafNode.Remotes { - s.Noticef("Reloaded: LeafNode Remote to %v TLS HandshakeFirst value is: %v", r.URLs, r.TLSHandshakeFirst) - } } - if l.compressionChanged || l.disabledChanged { - var leafs []*client - var solicit []*leafNodeCfg - acceptSideCompOpts := &opts.LeafNode.Compression + if l.compressionChanged { + s.Noticef("Reloaded: LeafNode Compression value is: %v", opts.LeafNode.Compression) + } - s.mu.RLock() - // First, update our internal leaf remote configurations with the new - // compress options. - // Since changing the remotes (as in adding/removing) is currently not - // supported, we know that we should have the same number in Options - // than in leafRemoteCfgs, but to be sure, use the max size. - max := len(opts.LeafNode.Remotes) - if l := len(s.leafRemoteCfgs); l < max { - max = l - } - for i := range max { - lr := s.leafRemoteCfgs[i] - or := opts.LeafNode.Remotes[i] - lr.Lock() - lr.Compression = or.Compression - if lr.Disabled && !or.Disabled { - solicit = append(solicit, lr) + var close []*client + var enable []*leafNodeCfg + var removed bool + + s.mu.Lock() + acceptSideCompOpts := &opts.LeafNode.Compression + // First go over existing leafnode remote configurations and + // either remove if no longer present, or update the config. + for lrc := range s.leafRemoteCfgs { + rlo := l.changed[lrc] + if rlo == nil { + delete(s.leafRemoteCfgs, lrc) + removed = true + if s.rmLeafRemoteCfgs == nil { + s.rmLeafRemoteCfgs = make(map[string]*leafNodeCfg) } - lr.Disabled = or.Disabled - lr.Unlock() + s.rmLeafRemoteCfgs[lrc.name()] = lrc + lrc.markAsRemoved() + s.Noticef("Reloaded: LeafNode Remote %s removed", lrc.RemoteLeafOpts.safeName()) + // We will close the existing connection in the next for-loop. + continue } - - for _, l := range s.leafs { - var co *CompressionOpts - - l.mu.Lock() - if r := l.leaf.remote; r != nil { - // If newly marked as disabled, collect and ignore the rest. - if r.Disabled { - l.flags.set(noReconnect) - leafs = append(leafs, l) - l.mu.Unlock() - continue - } - co = &r.Compression + lrc.Lock() + // TLSConfig is always applied. + lrc.TLSConfig = rlo.opts.TLSConfig.Clone() + // Now update what has been detected has changed. + if rlo.tlsFirstChanged { + lrc.TLSHandshakeFirst = rlo.opts.TLSHandshakeFirst + s.Noticef("Reloaded: LeafNode Remote %s TLS HandshakeFirst value is: %v", + lrc.RemoteLeafOpts.safeName(), rlo.opts.TLSHandshakeFirst) + } + if rlo.compressionChanged { + lrc.Compression = rlo.opts.Compression + s.Noticef("Reloaded: LeafNode Remote %s Compression value is: %v", + lrc.RemoteLeafOpts.safeName(), rlo.opts.Compression) + } + if rlo.disabledChanged { + // Change to new value. + lrc.Disabled = rlo.opts.Disabled + if lrc.Disabled { + lrc.notifyQuitChannel() } else { - co = acceptSideCompOpts + enable = append(enable, lrc) } - newMode := co.Mode - // Skip leaf connections that are "not supported" (because they - // will never do compression) or the ones that have already the - // new compression mode. - if l.leaf.compression == CompressionNotSupported || l.leaf.compression == newMode { - l.mu.Unlock() + s.Noticef("Reloaded: LeafNode Remote %s Disabled value is: %v", + lrc.RemoteLeafOpts.safeName(), rlo.opts.Disabled) + } + lrc.Unlock() + } + // Second, go over existing leaf connections and apply compression + // changes (if applicable) and collect connections that need to be + // closed and/or disabled. + for _, c := range s.leafs { + var co *CompressionOpts + + c.mu.Lock() + if r := c.leaf.remote; r != nil { + rlo := l.changed[r] + // If the config is not in the `changed` map, or the new config says that + // the connection is disabled, collect so we can close it after the server + // lock is released. + if rlo == nil || (rlo.disabledChanged && rlo.opts.Disabled) { + c.flags.set(noReconnect) + close = append(close, c) + c.mu.Unlock() continue } - // We need to close the connections if it had compression "off" or the new - // mode is compression "off", or if the new mode is "accept", because - // these require negotiation. - if l.leaf.compression == CompressionOff || newMode == CompressionOff || newMode == CompressionAccept { - leafs = append(leafs, l) - } else if newMode == CompressionS2Auto { - // If the mode is "s2_auto", we need to check if there is really - // need to change, and at any rate, we want to save the actual - // compression level here, not s2_auto. - l.updateS2AutoCompressionLevel(co, &l.leaf.compression) - } else { - // Simply change the compression writer - l.out.cw = s2.NewWriter(nil, s2WriterOptions(newMode)...) - l.leaf.compression = newMode + if rlo.compressionChanged { + co = &r.Compression } - l.mu.Unlock() + } else if l.compressionChanged { + co = acceptSideCompOpts } - s.mu.RUnlock() - // Close the connections for which negotiation is required, or that - // have been disabled. - for _, l := range leafs { - l.closeConnection(ClientClosed) + if co != nil && applyCompressionChanges(c, co) { + close = append(close, c) } - if l.compressionChanged { - s.Noticef("Reloaded: LeafNode compression settings") - } - if l.disabledChanged { - if len(leafs) > 0 { - s.Noticef("Reloaded: LeafNode(s) disabled") - } - if len(solicit) > 0 { - for _, remote := range solicit { - s.startGoRoutine(func() { s.connectToRemoteLeafNode(remote, true) }) - } - s.Noticef("Reloaded: LeafNode(s) enabled") - } + c.mu.Unlock() + } + s.mu.Unlock() + + // Close the connections for which negotiation is required, have been disabled + // or simply removed. + for _, c := range close { + c.closeConnection(ClientClosed) + } + // Start the ones that have been enabled. + for _, r := range enable { + s.connectToRemoteLeafNodeAsynchronously(r, true) + } + // Finally, deal with the ones that have been added. + if len(l.added) > 0 { + s.solicitLeafNodeRemotes(l.added) + } + // Deal with removed configs. Make sure there are no connect-in-progress. + // If there are still some, have a go routine to check in the background. + if removed { + if checkAgain := checkRemovedLeafNodeCfgs(s); checkAgain { + checkRemovedLeafNodeCfgsAsync(s) } } } +// Go through the removed remote leafnode configs map to check if the +// connect-in-progress flag is set. If not, remove from the map. +// Returns `true` if there are still some that are in progress. +func checkRemovedLeafNodeCfgs(s *Server) bool { + var inProgress int + s.mu.Lock() + for rn, r := range s.rmLeafRemoteCfgs { + if r.isConnectInProgress() { + inProgress++ + } else { + delete(s.rmLeafRemoteCfgs, rn) + } + } + s.mu.Unlock() + // Needs to be called again if inProgress > 0 + return inProgress > 0 +} + +// Will start a go routine that will periodically call `checkRemovedLeafNodeCfgs`. +// When the removed map has been emptied, the go routine will end. It is ok for +// this function to be invoked multiple times and have multiple instances running +// concurrently. +func checkRemovedLeafNodeCfgsAsync(s *Server) { + s.startGoRoutine(func() { + defer s.grWG.Done() + tick := time.NewTicker(50 * time.Millisecond) + defer tick.Stop() + for { + select { + case <-tick.C: + if checkAgain := checkRemovedLeafNodeCfgs(s); !checkAgain { + return + } + case <-s.quitCh: + return + } + } + }) +} + +// The `co` compression options are applied to the given leaf connection `c`. +// If a "restart" of the connection is needed, will return true, false otherwise. +func applyCompressionChanges(c *client, co *CompressionOpts) bool { + newMode := co.Mode + // Skip leaf connections that are "not supported" (because they + // will never do compression) or the ones that have already the + // new compression mode. + if c.leaf.compression == CompressionNotSupported || c.leaf.compression == newMode { + return false + } + // We need to close the connections if it had compression "off" or the new + // mode is compression "off", or if the new mode is "accept", because + // these require negotiation. + if c.leaf.compression == CompressionOff || newMode == CompressionOff || newMode == CompressionAccept { + return true + } else if newMode == CompressionS2Auto { + // If the mode is "s2_auto", we need to check if there is really + // need to change, and at any rate, we want to save the actual + // compression level here, not s2_auto. + c.updateS2AutoCompressionLevel(co, &c.leaf.compression) + } else { + // Simply change the compression writer + c.out.cw = s2.NewWriter(nil, s2WriterOptions(newMode)...) + c.leaf.compression = newMode + } + return false +} + type noFastProdStallReload struct { noopOption noStall bool @@ -1031,7 +1338,7 @@ func (s *Server) recheckPinnedCerts(curOpts *Options, newOpts *Options) { } }) } - if s.gateway.enabled && reflect.DeepEqual(newOpts.Gateway.TLSPinnedCerts, curOpts.Gateway.TLSPinnedCerts) { + if s.gateway.enabled && !reflect.DeepEqual(newOpts.Gateway.TLSPinnedCerts, curOpts.Gateway.TLSPinnedCerts) { gw := s.gateway gw.RLock() for _, c := range gw.out { @@ -1115,11 +1422,6 @@ func (s *Server) ReloadOptions(newOpts *Options) error { curOpts := s.getOpts() - // Wipe trusted keys if needed when we have an operator. - if len(curOpts.TrustedOperators) > 0 && len(curOpts.TrustedKeys) > 0 { - curOpts.TrustedKeys = nil - } - clientOrgPort := curOpts.Port clusterOrgPort := curOpts.Cluster.Port gatewayOrgPort := curOpts.Gateway.Port @@ -1215,15 +1517,18 @@ func (s *Server) reloadOptions(curOpts, newOpts *Options) error { newOpts.CustomClientAuthentication = curOpts.CustomClientAuthentication newOpts.CustomRouterAuthentication = curOpts.CustomRouterAuthentication - changed, err := s.diffOptions(newOpts) - if err != nil { + // Do the validation before checking for differences. We need to ensure + // that the new options are valid. Note that there are possible side + // effects of calling validateOptions(), in that some default values + // may be set, etc... but that should be ok since the current options + // went through the same process on startup/previous reload. + if err := validateOptions(newOpts); err != nil { return err } - if len(changed) != 0 { - if err := validateOptions(newOpts); err != nil { - return err - } + changed, err := s.diffOptions(newOpts) + if err != nil { + return err } // Create a context that is used to pass special info that we may need @@ -1258,7 +1563,7 @@ func imposeOrder(value any) error { slices.Sort(value.AllowedOrigins) case string, bool, uint8, uint16, uint64, int, int32, int64, time.Duration, float64, nil, LeafNodeOpts, ClusterOpts, *tls.Config, PinnedCertSet, *URLAccResolver, *MemAccResolver, *DirAccResolver, *CacheDirAccResolver, Authentication, MQTTOpts, jwt.TagList, - *OCSPConfig, map[string]string, JSLimitOpts, StoreCipher, *OCSPResponseCacheConfig, *ProxiesConfig, WriteTimeoutPolicy: + *OCSPConfig, map[string]string, map[string]bool, JSLimitOpts, StoreCipher, *OCSPResponseCacheConfig, *ProxiesConfig, WriteTimeoutPolicy: // explicitly skipped types case *AuthCallout: case JSTpmOpts: @@ -1275,9 +1580,11 @@ func imposeOrder(value any) error { // error. func (s *Server) diffOptions(newOpts *Options) ([]option, error) { var ( - oldConfig = reflect.ValueOf(s.getOpts()).Elem() + oldOpts = s.getOpts() + oldConfig = reflect.ValueOf(oldOpts).Elem() newConfig = reflect.ValueOf(newOpts).Elem() diffOpts = []option{} + skipTKeys = len(oldOpts.TrustedOperators) > 0 && len(oldOpts.TrustedKeys) > 0 // Need to keep track of whether JS is being disabled // to prevent changing limits at runtime. @@ -1286,6 +1593,7 @@ func (s *Server) diffOptions(newOpts *Options) ([]option, error) { jsMemLimitsChanged bool jsFileLimitsChanged bool jsStoreDirChanged bool + jsLimitsUpdate *jetStreamLimitsOption ) for i := 0; i < oldConfig.NumField(); i++ { field := oldConfig.Type().Field(i) @@ -1294,6 +1602,17 @@ func (s *Server) diffOptions(newOpts *Options) ([]option, error) { if field.PkgPath != _EMPTY_ { continue } + optName := strings.ToLower(field.Name) + if skipTKeys && optName == "trustedkeys" { + // TrustedOperators and TrustedKeys change is not supported. During options + // validation, if they are both specified, a conflict error is returned. + // If only TrustedOperators is specified, the TrustedKeys is filled with + // the operators' signing keys. So here, if we detect that the current + // options have operators, we don't do the trusted keys comparison, so + // we can fail with the "not supported for TrustedOperators" config reload + // error instead of TrustedKeys (that the user would not have set). + continue + } var ( oldValue = oldConfig.Field(i).Interface() newValue = newConfig.Field(i).Interface() @@ -1305,7 +1624,6 @@ func (s *Server) diffOptions(newOpts *Options) ([]option, error) { return nil, err } - optName := strings.ToLower(field.Name) // accounts and users (referencing accounts) will always differ as accounts // contain internal state, say locks etc..., so we don't bother here. // This also avoids races with atomic stats counters @@ -1374,7 +1692,7 @@ func (s *Server) diffOptions(newOpts *Options) ([]option, error) { co := &clusterOption{ newValue: newClusterOpts, permsChanged: !reflect.DeepEqual(newClusterOpts.Permissions, oldClusterOpts.Permissions), - compressChanged: !compressOptsEqual(&oldClusterOpts.Compression, &newClusterOpts.Compression), + compressChanged: !oldClusterOpts.Compression.equals(&newClusterOpts.Compression), } co.diffPoolAndAccounts(&oldClusterOpts) // If there are added accounts, first make sure that we can look them up. @@ -1445,6 +1763,11 @@ func (s *Server) diffOptions(newOpts *Options) ([]option, error) { tmpOld.tlsConfigOpts = nil tmpNew.tlsConfigOpts = nil + // Allow TLSPinnedCerts through reload, existing connections + // are checked in recheckPinnedCerts + tmpOld.TLSPinnedCerts = nil + tmpNew.TLSPinnedCerts = nil + // Need to do the same for remote gateways' TLS configs. // But we can't just set remotes' TLSConfig to nil otherwise this // would lose the real TLS configuration. @@ -1458,149 +1781,19 @@ func (s *Server) diffOptions(newOpts *Options) ([]option, error) { field.Name, oldValue, newValue) } case "leafnode": - // Similar to gateways tmpOld := oldValue.(LeafNodeOpts) tmpNew := newValue.(LeafNodeOpts) - tmpOld.TLSConfig = nil - tmpNew.TLSConfig = nil - tmpOld.tlsConfigOpts = nil - tmpNew.tlsConfigOpts = nil - // We will allow TLSHandshakeFirst to be config reloaded. First, - // we just want to detect if there was a change in the leafnodes{} - // block, and if not, we will check the remotes. - handshakeFirstChanged := tmpOld.TLSHandshakeFirst != tmpNew.TLSHandshakeFirst || - tmpOld.TLSHandshakeFirstFallback != tmpNew.TLSHandshakeFirstFallback - // If changed, set them (in the temporary variables) to false so that the - // rest of the comparison does not fail. - if handshakeFirstChanged { - tmpOld.TLSHandshakeFirst, tmpNew.TLSHandshakeFirst = false, false - tmpOld.TLSHandshakeFirstFallback, tmpNew.TLSHandshakeFirstFallback = 0, 0 - } else if len(tmpOld.Remotes) == len(tmpNew.Remotes) { - // Since we don't support changes in the remotes, we will do a - // simple pass to see if there was a change of this field. - for i := 0; i < len(tmpOld.Remotes); i++ { - if tmpOld.Remotes[i].TLSHandshakeFirst != tmpNew.Remotes[i].TLSHandshakeFirst { - handshakeFirstChanged = true - break - } - } + + lno, err := getLeafNodeOptionsChanges(s, &tmpOld, &tmpNew) + // If there was an unsupported change, we will get an error with the name + // of the (first) field and its old and new value. + if err != nil { + return nil, fmt.Errorf("config reload not supported for %s: %v", field.Name, err) } - // We also support config reload for compression. Check if it changed before - // blanking them out for the deep-equal check at the end. - compressionChanged := !compressOptsEqual(&tmpOld.Compression, &tmpNew.Compression) - if compressionChanged { - tmpOld.Compression, tmpNew.Compression = CompressionOpts{}, CompressionOpts{} - } else if len(tmpOld.Remotes) == len(tmpNew.Remotes) { - // Same that for tls first check, do the remotes now. - for i := range len(tmpOld.Remotes) { - if !compressOptsEqual(&tmpOld.Remotes[i].Compression, &tmpNew.Remotes[i].Compression) { - compressionChanged = true - break - } - } + // If there was an actual change... + if lno != nil { + diffOpts = append(diffOpts, lno) } - // Check if the "disabled" option of each remote has changed. - var disabledChanged bool - for i := range len(tmpOld.Remotes) { - if tmpOld.Remotes[i].Disabled != tmpNew.Remotes[i].Disabled { - disabledChanged = true - break - } - } - - // Need to do the same for remote leafnodes' TLS configs. - // But we can't just set remotes' TLSConfig to nil otherwise this - // would lose the real TLS configuration. - tmpOld.Remotes = copyRemoteLNConfigForReloadCompare(tmpOld.Remotes) - tmpNew.Remotes = copyRemoteLNConfigForReloadCompare(tmpNew.Remotes) - - // Special check for leafnode remotes changes which are not supported right now. - leafRemotesChanged := func(a, b LeafNodeOpts) bool { - if len(a.Remotes) != len(b.Remotes) { - return true - } - - // Check whether all remotes URLs are still the same. - for _, oldRemote := range a.Remotes { - var found bool - - if oldRemote.LocalAccount == _EMPTY_ { - oldRemote.LocalAccount = globalAccountName - } - - for _, newRemote := range b.Remotes { - // Bind to global account in case not defined. - if newRemote.LocalAccount == _EMPTY_ { - newRemote.LocalAccount = globalAccountName - } - - if reflect.DeepEqual(oldRemote, newRemote) { - found = true - break - } - } - if !found { - return true - } - } - - return false - } - - // First check whether remotes changed at all. If they did not, - // skip them in the complete equal check. - if !leafRemotesChanged(tmpOld, tmpNew) { - tmpOld.Remotes = nil - tmpNew.Remotes = nil - } - - // Special check for auth users to detect changes. - // If anything is off will fall through and fail below. - // If we detect they are semantically the same we nil them out - // to pass the check below. - if tmpOld.Users != nil || tmpNew.Users != nil { - if len(tmpOld.Users) == len(tmpNew.Users) { - oua := make(map[string]*User, len(tmpOld.Users)) - nua := make(map[string]*User, len(tmpOld.Users)) - for _, u := range tmpOld.Users { - oua[u.Username] = u - } - for _, u := range tmpNew.Users { - nua[u.Username] = u - } - same := true - for uname, u := range oua { - // If we can not find new one with same name, drop through to fail. - nu, ok := nua[uname] - if !ok { - same = false - break - } - // If username or password or account different break. - if u.Username != nu.Username || u.Password != nu.Password || u.Account.GetName() != nu.Account.GetName() { - same = false - break - } - } - // We can nil out here. - if same { - tmpOld.Users, tmpNew.Users = nil, nil - } - } - } - - // If there is really a change prevents reload. - if !reflect.DeepEqual(tmpOld, tmpNew) { - // See TODO(ik) note below about printing old/new values. - return nil, fmt.Errorf("config reload not supported for %s: old=%v, new=%v", - field.Name, oldValue, newValue) - } - - diffOpts = append(diffOpts, &leafNodeOption{ - tlsFirstChanged: handshakeFirstChanged, - compressionChanged: compressionChanged, - disabledChanged: disabledChanged, - }) case "jetstream": new := newValue.(bool) old := oldValue.(bool) @@ -1636,26 +1829,35 @@ func (s *Server) diffOptions(newOpts *Options) ([]option, error) { fromSet = !fromUnset toUnset = new == -1 toSet = !toUnset + increased = fromSet && toSet && new > old ) if jsEnabled && modified { // Cannot change limits from dynamic storage at runtime. switch { + case increased: + // Allowed to increase, but not decrease. + if jsLimitsUpdate == nil { + jsLimitsUpdate = &jetStreamLimitsOption{} + diffOpts = append(diffOpts, jsLimitsUpdate) + } + if optName == "jetstreammaxmemory" { + jsLimitsUpdate.newMaxMemory = new + } else { + jsLimitsUpdate.newMaxStore = new + } case fromSet && toUnset: // Limits changed but it may mean that JS is being disabled, // keep track of the change and error in case it is not. - switch optName { - case "jetstreammaxmemory": + if optName == "jetstreammaxmemory" { jsMemLimitsChanged = true - case "jetstreammaxstore": + } else { jsFileLimitsChanged = true - default: - return nil, fmt.Errorf("config reload not supported for jetstream max memory and store") } case fromUnset && toSet: // Prevent changing from dynamic max memory / file at runtime. return nil, fmt.Errorf("config reload not supported for jetstream dynamic max memory and store") default: - return nil, fmt.Errorf("config reload not supported for jetstream max memory and store") + return nil, fmt.Errorf("config reload not supported for decreasing jetstream max memory and store") } } case "jetstreammetacompact", "jetstreammetacompactsize", "jetstreammetacompactsync": @@ -1801,32 +2003,6 @@ func copyRemoteGWConfigsWithoutTLSConfig(current []*RemoteGatewayOpts) []*Remote return rgws } -func copyRemoteLNConfigForReloadCompare(current []*RemoteLeafOpts) []*RemoteLeafOpts { - l := len(current) - if l == 0 { - return nil - } - rlns := make([]*RemoteLeafOpts, 0, l) - for _, rcfg := range current { - cp := *rcfg - cp.TLSConfig = nil - cp.tlsConfigOpts = nil - cp.TLSHandshakeFirst = false - // This is set only when processing a CONNECT, so reset here so that we - // don't fail the DeepEqual comparison. - cp.TLS = false - // For now, remove DenyImports/Exports since those get modified at runtime - // to add JS APIs. - cp.DenyImports, cp.DenyExports = nil, nil - // Remove compression mode - cp.Compression = CompressionOpts{} - // Reset disabled status - cp.Disabled = false - rlns = append(rlns, &cp) - } - return rlns -} - func (s *Server) applyOptions(ctx *reloadContext, opts []option) { var ( reloadLogging = false @@ -1896,15 +2072,12 @@ func (s *Server) applyOptions(ctx *reloadContext, opts []option) { s.sendStatszUpdate() } - // For remote gateways and leafnodes, make sure that their TLS configuration + // For remote gateways, make sure that their TLS configuration // is updated (since the config is "captured" early and changes would otherwise // not be visible). if s.gateway.enabled { s.gateway.updateRemotesTLSConfig(newOpts) } - if len(newOpts.LeafNode.Remotes) > 0 { - s.updateRemoteLeafNodesTLSConfig(newOpts) - } // Always restart OCSP monitoring on reload. if err := s.reloadOCSP(); err != nil { @@ -2650,3 +2823,38 @@ func diffProxiesTrustedKeys(old, new []*ProxyConfig) ([]string, []string) { } return add, del } + +// This function calls `reflect.DeepEqual` on all public fields that are +// not part of the `ignoreFields` list. If they are all equal, returns nil, +// otherwise returns an error that will contain the name of the first field +// that fails the comparison, along with its old and new values. +func checkConfigsEqual(c1, c2 any, ignoreFields []string) error { + oldConfig := reflect.ValueOf(c1).Elem() + newConfig := reflect.ValueOf(c2).Elem() + for i := 0; i < oldConfig.NumField(); i++ { + field := oldConfig.Type().Field(i) + // field.PkgPath is empty for exported fields, and is not for unexported ones. + // We skip the unexported fields. + if field.PkgPath != _EMPTY_ { + continue + } + // If it is in the set of fields to ignore, move to the next. + // We expect the number of ignore fields to be small. + var ignored bool + for _, f := range ignoreFields { + if f == field.Name { + ignored = true + break + } + } + if ignored { + continue + } + oldValue := oldConfig.Field(i).Interface() + newValue := newConfig.Field(i).Interface() + if !reflect.DeepEqual(oldValue, newValue) { + return fmt.Errorf("field %q: old=%v, new=%v", field.Name, oldValue, newValue) + } + } + return nil +} diff --git a/vendor/github.com/nats-io/nats-server/v2/server/scheduler.go b/vendor/github.com/nats-io/nats-server/v2/server/scheduler.go index d827c3945..69bf0155b 100644 --- a/vendor/github.com/nats-io/nats-server/v2/server/scheduler.go +++ b/vendor/github.com/nats-io/nats-server/v2/server/scheduler.go @@ -19,6 +19,7 @@ import ( "io" "math" "slices" + "strings" "time" "github.com/nats-io/nats-server/v2/server/thw" @@ -77,6 +78,18 @@ func (ms *MsgScheduling) init(seq uint64, subj string, ts int64) { delete(ms.inflight, subj) } +func (ms *MsgScheduling) update(subj string, ts int64) { + if sched, ok := ms.schedules[subj]; ok { + // Remove and add separately, it's for the same sequence, but if replicated + // this server could not know the previous timestamp yet. + ms.ttls.Remove(sched.seq, sched.ts) + ms.ttls.Add(sched.seq, ts) + sched.ts = ts + delete(ms.inflight, subj) + ms.resetTimer() + } +} + func (ms *MsgScheduling) markInflight(subj string) { if _, ok := ms.schedules[subj]; ok { ms.inflight[subj] = struct{}{} @@ -90,8 +103,7 @@ func (ms *MsgScheduling) isInflight(subj string) bool { func (ms *MsgScheduling) remove(seq uint64) { if subj, ok := ms.seqToSubj[seq]; ok { - delete(ms.seqToSubj, seq) - delete(ms.schedules, subj) + ms.removeSubject(subj) } } @@ -100,6 +112,7 @@ func (ms *MsgScheduling) removeSubject(subj string) { ms.ttls.Remove(sched.seq, sched.ts) delete(ms.schedules, subj) delete(ms.seqToSubj, sched.seq) + delete(ms.inflight, subj) } } @@ -142,11 +155,12 @@ func (ms *MsgScheduling) resetTimer() { } } -func (ms *MsgScheduling) getScheduledMessages(loadMsg func(seq uint64, smv *StoreMsg) *StoreMsg) []*inMsg { +func (ms *MsgScheduling) getScheduledMessages(loadMsg func(seq uint64, smv *StoreMsg) *StoreMsg, loadLast func(subj string, smv *StoreMsg) *StoreMsg) []*inMsg { var ( - smv StoreMsg - sm *StoreMsg - msgs []*inMsg + smv StoreMsg + srcSmv StoreMsg + sm *StoreMsg + msgs []*inMsg ) ms.ttls.ExpireTasks(func(seq uint64, ts int64) bool { // Need to grab the message for the specified sequence, and check @@ -155,10 +169,26 @@ func (ms *MsgScheduling) getScheduledMessages(loadMsg func(seq uint64, smv *Stor if sm != nil { // If already inflight, don't duplicate a scheduled message. The stream could // be replicated and the scheduled message could take some time to propagate. - if ms.isInflight(sm.subj) { + subj := sm.subj + if ms.isInflight(subj) { return false } // Validate the contents are correct if not, we just remove it from THW. + pattern := bytesToString(sliceHeader(JSSchedulePattern, sm.hdr)) + if pattern == _EMPTY_ { + ms.remove(seq) + return true + } + loc, apiErr := loadMessageScheduleLocation(sm.hdr) + if apiErr != nil { + ms.remove(seq) + return true + } + next, repeat, ok := parseMsgSchedule(pattern, loc, ts) + if !ok { + ms.remove(seq) + return true + } ttl, ok := getMessageScheduleTTL(sm.hdr) if !ok { ms.remove(seq) @@ -169,27 +199,43 @@ func (ms *MsgScheduling) getScheduledMessages(loadMsg func(seq uint64, smv *Stor ms.remove(seq) return true } + rollup := getMessageScheduleRollup(sm.hdr) + source := getMessageScheduleSource(sm.hdr) + if source != _EMPTY_ { + // Fall back to the scheduled message's own content if the source has no last message. + if srcSm := loadLast(source, &srcSmv); srcSm != nil { + sm = srcSm + } + } // Copy, as this is retrieved directly from storage, and we'll need to keep hold of this for some time. // And in the case of headers, we'll copy all of them, but make changes. hdr, msg := copyBytes(sm.hdr), copyBytes(sm.msg) - // Strip headers specific to the schedule. - hdr = removeHeaderIfPresent(hdr, JSSchedulePattern) - hdr = removeHeaderIfPrefixPresent(hdr, "Nats-Schedule-") + // Strip headers specific to message scheduling. + // Covers Nats-Schedule, Nats-Schedule-*, and Nats-Scheduler. + hdr = removeHeaderIfPrefixPresent(hdr, "Nats-Schedule") + // Strip headers that could prevent persisting this scheduled message. hdr = removeHeaderIfPrefixPresent(hdr, "Nats-Expected-") hdr = removeHeaderIfPresent(hdr, JSMsgId) hdr = removeHeaderIfPresent(hdr, JSMessageTTL) hdr = removeHeaderIfPresent(hdr, JSMsgRollup) // Add headers for the scheduled message. - hdr = genHeader(hdr, JSScheduler, sm.subj) - hdr = genHeader(hdr, JSScheduleNext, JSScheduleNextPurge) // Purge the schedule message itself. + hdr = genHeader(hdr, JSScheduler, subj) + if !repeat { + hdr = genHeader(hdr, JSScheduleNext, JSScheduleNextPurge) // Purge the schedule message itself. + } else { + hdr = genHeader(hdr, JSScheduleNext, next.Format(time.RFC3339)) // Next time the schedule fires. + } if ttl != _EMPTY_ { hdr = genHeader(hdr, JSMessageTTL, ttl) } + if rollup != _EMPTY_ { + hdr = genHeader(hdr, JSMsgRollup, rollup) + } msgs = append(msgs, &inMsg{seq: seq, subj: target, hdr: hdr, msg: msg}) - ms.markInflight(sm.subj) + ms.markInflight(subj) return false } ms.remove(seq) @@ -261,3 +307,70 @@ func (ms *MsgScheduling) decode(b []byte) (uint64, error) { } return stamp, nil } + +// parseMsgSchedule parses a message schedule pattern and returns the time +// to fire, whether it is a repeating schedule, and whether the pattern was valid. +func parseMsgSchedule(pattern string, loc *time.Location, ts int64) (time.Time, bool, bool) { + if pattern == _EMPTY_ { + return time.Time{}, false, true + } + // Exact time. + if strings.HasPrefix(pattern, "@at ") { + // Time zone is not supported for @at. + if loc != nil { + return time.Time{}, false, false + } + t, err := time.Parse(time.RFC3339, pattern[4:]) + return t, false, err == nil + } + // Repeating on a simple interval. + if strings.HasPrefix(pattern, "@every ") { + // Time zone is not supported for @every. + if loc != nil { + return time.Time{}, false, false + } + dur, err := time.ParseDuration(pattern[7:]) + if err != nil { + return time.Time{}, false, false + } + // Only allow intervals of at least a second. + if dur.Seconds() < 1 { + return time.Time{}, false, false + } + // If this schedule would trigger multiple times, for example after a restart, skip ahead and only fire once. + next := time.Unix(0, ts).UTC().Round(time.Second).Add(dur) + if now := time.Now().UTC(); next.Before(now) { + next = now.Round(time.Second).Add(dur) + } + return next, true, true + } + + // Predefined schedules for cron. + switch pattern { + case "@yearly", "@annually": + pattern = "0 0 0 1 1 *" + case "@monthly": + pattern = "0 0 0 1 * *" + case "@weekly": + pattern = "0 0 0 * * 0" + case "@daily", "@midnight": + pattern = "0 0 0 * * *" + case "@hourly": + pattern = "0 0 * * * *" + } + + // Parse the cron pattern. + next, err := parseCron(pattern, loc, ts) + if err != nil { + return time.Time{}, false, false + } + // If this schedule would trigger multiple times, for example after a restart, skip ahead and only fire once. + if now := time.Now().UTC(); next.Before(now) { + ts = now.Round(time.Second).UnixNano() + next, err = parseCron(pattern, loc, ts) + if err != nil { + return time.Time{}, false, false + } + } + return next, true, true +} diff --git a/vendor/github.com/nats-io/nats-server/v2/server/server.go b/vendor/github.com/nats-io/nats-server/v2/server/server.go index aa28534dc..9612c868c 100644 --- a/vendor/github.com/nats-io/nats-server/v2/server/server.go +++ b/vendor/github.com/nats-io/nats-server/v2/server/server.go @@ -31,7 +31,6 @@ import ( "os" "path" "path/filepath" - "reflect" "regexp" "runtime" "runtime/pprof" @@ -234,7 +233,8 @@ type Server struct { resolver netResolver dialTimeout time.Duration } - leafRemoteCfgs []*leafNodeCfg + leafRemoteCfgs map[*leafNodeCfg]struct{} + rmLeafRemoteCfgs map[string]*leafNodeCfg leafRemoteAccounts sync.Map leafNodeEnabled bool leafDisableConnect bool // Used in test only @@ -367,7 +367,8 @@ type Server struct { syncOutSem chan struct{} // Queue to process JS API requests that come from routes (or gateways) - jsAPIRoutedReqs *ipQueue[*jsAPIRoutedReq] + jsAPIRoutedReqs *ipQueue[*jsAPIRoutedReq] + jsAPIRoutedInfoReqs *ipQueue[*jsAPIRoutedReq] // Delayed API responses. delayedAPIResponses *ipQueue[*delayedAPIResponse] @@ -645,32 +646,6 @@ func selectS2AutoModeBasedOnRTT(rtt time.Duration, rttThresholds []time.Duration return CompressionS2Best } -func compressOptsEqual(c1, c2 *CompressionOpts) bool { - if c1 == c2 { - return true - } - if (c1 == nil && c2 != nil) || (c1 != nil && c2 == nil) { - return false - } - if c1.Mode != c2.Mode { - return false - } - // For s2_auto, if one has an empty RTTThresholds, it is equivalent - // to the defaultCompressionS2AutoRTTThresholds array, so compare with that. - if c1.Mode == CompressionS2Auto { - if len(c1.RTTThresholds) == 0 && !reflect.DeepEqual(c2.RTTThresholds, defaultCompressionS2AutoRTTThresholds) { - return false - } - if len(c2.RTTThresholds) == 0 && !reflect.DeepEqual(c1.RTTThresholds, defaultCompressionS2AutoRTTThresholds) { - return false - } - if !reflect.DeepEqual(c1.RTTThresholds, c2.RTTThresholds) { - return false - } - } - return true -} - // Returns an array of s2 WriterOption based on the route compression mode. // So far we return a single option, but this way we can call s2.NewWriter() // with a nil []s2.WriterOption, but not with a nil s2.WriterOption, so @@ -1956,12 +1931,7 @@ func (s *Server) registerAccount(acc *Account) *Account { // Helper to set the sublist based on preferences. func (s *Server) setAccountSublist(acc *Account) { if acc != nil && acc.sl == nil { - opts := s.getOpts() - if opts != nil && opts.NoSublistCache { - acc.sl = NewSublistNoCache() - } else { - acc.sl = NewSublistWithCache() - } + acc.sl = NewSublistForServer(s) } } @@ -2293,6 +2263,7 @@ func (s *Server) Start() { s.Noticef(" Node: %s", getHash(s.info.Name)) } s.Noticef(" ID: %s", s.info.ID) + s.printFeatureFlags(opts) defer s.Noticef("Server is ready") @@ -3586,7 +3557,7 @@ func (s *Server) saveClosedClient(c *client, nc net.Conn, subs map[string]*subsc if c.acc != nil && c.acc.Name != globalAccountName { cc.acc = c.acc.Name } - cc.JWT = c.opts.JWT + cc.JWT = redactBearerJWT(c.opts.JWT) cc.IssuerKey = issuerForClient(c) cc.Tags = c.tags cc.NameTag = c.nameTag diff --git a/vendor/github.com/nats-io/nats-server/v2/server/store.go b/vendor/github.com/nats-io/nats-server/v2/server/store.go index 35b469670..31a834efa 100644 --- a/vendor/github.com/nats-io/nats-server/v2/server/store.go +++ b/vendor/github.com/nats-io/nats-server/v2/server/store.go @@ -92,15 +92,15 @@ type ProcessJetStreamMsgHandler func(*inMsg) type StreamStore interface { StoreMsg(subject string, hdr, msg []byte, ttl int64) (uint64, int64, error) - StoreRawMsg(subject string, hdr, msg []byte, seq uint64, ts int64, ttl int64) error + StoreRawMsg(subject string, hdr, msg []byte, seq uint64, ts int64, ttl int64, discardNewCheck bool) error SkipMsg(seq uint64) (uint64, error) SkipMsgs(seq uint64, num uint64) error - FlushAllPending() + FlushAllPending() error LoadMsg(seq uint64, sm *StoreMsg) (*StoreMsg, error) LoadNextMsg(filter string, wc bool, start uint64, smp *StoreMsg) (sm *StoreMsg, skip uint64, err error) LoadNextMsgMulti(sl *gsl.SimpleSublist, start uint64, smp *StoreMsg) (sm *StoreMsg, skip uint64, err error) LoadLastMsg(subject string, sm *StoreMsg) (*StoreMsg, error) - LoadPrevMsg(start uint64, smp *StoreMsg) (sm *StoreMsg, err error) + LoadPrevMsg(filter string, wc bool, start uint64, smp *StoreMsg) (sm *StoreMsg, skip uint64, err error) LoadPrevMsgMulti(sl *gsl.SimpleSublist, start uint64, smp *StoreMsg) (sm *StoreMsg, skip uint64, err error) RemoveMsg(seq uint64) (bool, error) EraseMsg(seq uint64) (bool, error) @@ -109,7 +109,7 @@ type StreamStore interface { Compact(seq uint64) (uint64, error) Truncate(seq uint64) error GetSeqFromTime(t time.Time) uint64 - FilteredState(seq uint64, subject string) SimpleState + FilteredState(seq uint64, subject string) (SimpleState, error) SubjectsState(filterSubject string) map[string]SimpleState SubjectsTotals(filterSubject string) map[string]uint64 AllLastSeqs() ([]uint64, error) @@ -120,7 +120,7 @@ type StreamStore interface { State() StreamState FastState(*StreamState) EncodedStreamState(failed uint64) (enc []byte, err error) - SyncDeleted(dbs DeleteBlocks) + SyncDeleted(dbs DeleteBlocks) error Type() StorageType RegisterStorageUpdates(StorageUpdateHandler) RegisterStorageRemoveMsg(StorageRemoveMsgHandler) @@ -360,11 +360,13 @@ func (dbs DeleteBlocks) NumDeleted() (total uint64) { type ConsumerStore interface { SetStarting(sseq uint64) error UpdateStarting(sseq uint64) + Reset(sseq uint64) error HasState() bool UpdateDelivered(dseq, sseq, dc uint64, ts int64) error UpdateAcks(dseq, sseq uint64) error UpdateConfig(cfg *ConsumerConfig) error Update(*ConsumerState) error + ForceUpdate(*ConsumerState) error State() (*ConsumerState, error) BorrowState() (*ConsumerState, error) EncodedState() ([]byte, error) @@ -464,13 +466,6 @@ type Pending struct { Timestamp int64 } -// TemplateStore stores templates. -// Deprecated: stream templates are deprecated and will be removed in a future version. -type TemplateStore interface { - Store(*streamTemplate) error - Delete(*streamTemplate) error -} - const ( limitsPolicyJSONString = `"limits"` interestPolicyJSONString = `"interest"` @@ -602,15 +597,17 @@ func (st *StorageType) UnmarshalJSON(data []byte) error { } const ( - ackNonePolicyJSONString = `"none"` - ackAllPolicyJSONString = `"all"` - ackExplicitPolicyJSONString = `"explicit"` + ackNonePolicyJSONString = `"none"` + ackAllPolicyJSONString = `"all"` + ackExplicitPolicyJSONString = `"explicit"` + ackFlowControlPolicyJSONString = `"flow_control"` ) var ( - ackNonePolicyJSONBytes = []byte(ackNonePolicyJSONString) - ackAllPolicyJSONBytes = []byte(ackAllPolicyJSONString) - ackExplicitPolicyJSONBytes = []byte(ackExplicitPolicyJSONString) + ackNonePolicyJSONBytes = []byte(ackNonePolicyJSONString) + ackAllPolicyJSONBytes = []byte(ackAllPolicyJSONString) + ackExplicitPolicyJSONBytes = []byte(ackExplicitPolicyJSONString) + ackFlowControlPolicyJSONBytes = []byte(ackFlowControlPolicyJSONString) ) func (ap AckPolicy) MarshalJSON() ([]byte, error) { @@ -621,6 +618,8 @@ func (ap AckPolicy) MarshalJSON() ([]byte, error) { return ackAllPolicyJSONBytes, nil case AckExplicit: return ackExplicitPolicyJSONBytes, nil + case AckFlowControl: + return ackFlowControlPolicyJSONBytes, nil default: return nil, fmt.Errorf("can not marshal %v", ap) } @@ -634,6 +633,8 @@ func (ap *AckPolicy) UnmarshalJSON(data []byte) error { *ap = AckAll case ackExplicitPolicyJSONString: *ap = AckExplicit + case ackFlowControlPolicyJSONString: + *ap = AckFlowControl default: return fmt.Errorf("can not unmarshal %q", data) } @@ -741,7 +742,7 @@ func isOutOfSpaceErr(err error) bool { var errFirstSequenceMismatch = errors.New("first sequence mismatch") func isClusterResetErr(err error) bool { - return err == errLastSeqMismatch || err == ErrStoreEOF || err == errFirstSequenceMismatch || errors.Is(err, errCatchupAbortedNoLeader) || err == errCatchupTooManyRetries + return err == errLastSeqMismatch || err == ErrStoreEOF || err == errFirstSequenceMismatch || errors.Is(err, errCatchupAbortedNoLeader) || err == errCatchupTooManyRetries || err == errAlreadyLeader } // Copy all fields. diff --git a/vendor/github.com/nats-io/nats-server/v2/server/stream.go b/vendor/github.com/nats-io/nats-server/v2/server/stream.go index 43df7fc56..5698f3cb2 100644 --- a/vendor/github.com/nats-io/nats-server/v2/server/stream.go +++ b/vendor/github.com/nats-io/nats-server/v2/server/stream.go @@ -33,6 +33,7 @@ import ( "sync/atomic" "time" + "github.com/antithesishq/antithesis-sdk-go/assert" "github.com/klauspost/compress/s2" "github.com/nats-io/nats-server/v2/server/gsl" "github.com/nats-io/nuid" @@ -63,7 +64,6 @@ type StreamConfig struct { Storage StorageType `json:"storage"` Replicas int `json:"num_replicas"` NoAck bool `json:"no_ack,omitempty"` - Template string `json:"template_owner,omitempty"` // Deprecated: stream templates are deprecated and will be removed in a future version. Duplicates time.Duration `json:"duplicate_window,omitempty"` Placement *Placement `json:"placement,omitempty"` Mirror *StreamSource `json:"mirror,omitempty"` @@ -122,6 +122,9 @@ type StreamConfig struct { // PersistMode allows to opt-in to different persistence mode settings. PersistMode PersistModeType `json:"persist_mode,omitempty"` + // AllowBatchPublish allows fast batch publishing into the stream. + AllowBatchPublish bool `json:"allow_batched,omitempty"` + // Metadata is additional metadata for the Stream. Metadata map[string]string `json:"metadata,omitempty"` } @@ -274,6 +277,68 @@ type CounterValue struct { // e.g. {"stream":{"subject":"123"}} type CounterSources map[string]map[string]string +// BatchFlowAck is used for flow control when fast batch publishing into a stream. +// This message is vital to handling acknowledgements and flow control. +// These may technically be lost without the client receiving it. The client can retrieve +// these by using the "ping" operation if it's expecting acks but not receiving any. +type BatchFlowAck struct { + // Type: "ack" + Type string `json:"type"` + // Sequence is the sequence of the message that triggered the ack. + // If "gap: fail" this means the messages up to and including Sequence were persisted. + // If "gap: ok" this means _some_ of the messages up to and including Sequence were persisted. + // But there could have been gaps. + Sequence uint64 `json:"seq"` + // Messages indicates acknowledgements will be sent every N messages. + Messages uint16 `json:"msgs"` +} + +func (ack BatchFlowAck) MarshalJSON() ([]byte, error) { + type Alias BatchFlowAck + a := Alias(ack) + a.Type = "ack" + return json.Marshal(a) +} + +// BatchFlowGap is used for reporting gaps when fast batch publishing into a stream. +// This message is purely informational and could technically be lost without the client receiving it. +type BatchFlowGap struct { + // Type: "gap" + Type string `json:"type"` + // ExpectedLastSequence is the sequence expected to be received next. + // Messages starting from ExpectedLastSequence up to (but not including) CurrentSequence were lost. + ExpectedLastSequence uint64 `json:"last_seq"` + // CurrentSequence is the sequence of the message that just came in and detected the gap. + CurrentSequence uint64 `json:"seq"` +} + +func (gap BatchFlowGap) MarshalJSON() ([]byte, error) { + type Alias BatchFlowGap + a := Alias(gap) + a.Type = "gap" + return json.Marshal(a) +} + +// BatchFlowErr is used for reporting errors when fast batch publishing into a stream. +// This message is purely informational and could technically be lost without the client receiving it. +type BatchFlowErr struct { + // Type: "err" + Type string `json:"type"` + // Sequence is the sequence of the message that triggered the error. + // There are no (relative) guarantees whatsoever about whether the messages up to this sequence were persisted. + // Such guarantees require the use of "gap: fail" and listening for BatchFlowAck and PubAck. + Sequence uint64 `json:"seq"` + // Error is used to return the error for the Sequence. + Error *ApiError `json:"error"` +} + +func (err BatchFlowErr) MarshalJSON() ([]byte, error) { + type Alias BatchFlowErr + a := Alias(err) + a.Type = "err" + return json.Marshal(a) +} + // StreamInfo shows config and current state for this stream. type StreamInfo struct { Config StreamConfig `json:"config"` @@ -345,11 +410,18 @@ type StreamSource struct { FilterSubject string `json:"filter_subject,omitempty"` SubjectTransforms []SubjectTransformConfig `json:"subject_transforms,omitempty"` External *ExternalStream `json:"external,omitempty"` + Consumer *StreamConsumerSource `json:"consumer,omitempty"` // Internal iname string // For indexing when stream names are the same for multiple sources. } +// StreamConsumerSource dictates a durable consumer with a specific name is used for sourcing. +type StreamConsumerSource struct { + Name string `json:"name,omitempty"` + DeliverSubject string `json:"deliver_subject,omitempty"` +} + // ExternalStream allows you to qualify access to a stream source in another account or domain. type ExternalStream struct { ApiPrefix string `json:"api"` @@ -372,17 +444,25 @@ const ( // For managing stream batches. const ( - streamDefaultMaxBatchInflightPerStream = 50 - streamDefaultMaxBatchInflightTotal = 1000 - streamDefaultMaxBatchSize = 1000 - streamDefaultMaxBatchTimeout = 10 * time.Second + streamDefaultMaxBatchTimeout = 10 * time.Second + // Atomic batches. + streamDefaultMaxAtomicBatchInflightPerStream = 50 + streamDefaultMaxAtomicBatchInflightTotal = 1000 + streamDefaultMaxAtomicBatchSize = 1000 + // Fast batches. + streamDefaultMaxFastBatchInflightPerStream = 1000 + streamDefaultMaxFastBatchInflightTotal = 50_000 ) var ( - streamMaxBatchInflightPerStream = streamDefaultMaxBatchInflightPerStream - streamMaxBatchInflightTotal = streamDefaultMaxBatchInflightTotal - streamMaxBatchSize = streamDefaultMaxBatchSize - streamMaxBatchTimeout = streamDefaultMaxBatchTimeout + streamMaxBatchTimeout = streamDefaultMaxBatchTimeout + // Atomic batches. + streamMaxAtomicBatchInflightPerStream = streamDefaultMaxAtomicBatchInflightPerStream + streamMaxAtomicBatchInflightTotal = streamDefaultMaxAtomicBatchInflightTotal + streamMaxAtomicBatchSize = streamDefaultMaxAtomicBatchSize + // Fast batches. + streamMaxFastBatchInflightPerStream = streamDefaultMaxFastBatchInflightPerStream + streamMaxFastBatchInflightTotal = streamDefaultMaxFastBatchInflightTotal ) // Stream is a jetstream stream of messages. When we receive a message internally destined @@ -437,8 +517,8 @@ type stream struct { sourcesConsumerSetup *time.Timer smsgs *ipQueue[*inMsg] // Intra-process queue for all incoming sourced messages. - // Indicates we have direct consumers. - directs int + // Indicates we have direct/sourcing consumers. + sourcingConsumers int // For input subject transform. itr *subjectTransform @@ -475,8 +555,10 @@ type stream struct { lqsent time.Time // The time at which the last lost quorum advisory was sent. Used to rate limit. uch chan struct{} // The channel to signal updates to the monitor routine. inMonitor bool // True if the monitor routine has been started. + werr error // If a write error was encountered, and if so what error. inflight map[string]*inflightSubjectRunningTotal // Inflight message sizes per subject. + inflightTransform map[uint64]string // Inflight message's optional transformed subject. clusteredCounterTotal map[string]*msgCounterRunningTotal // Inflight counter totals. expectedPerSubjectSequence map[uint64]string // Inflight 'expected per subject' subjects per clseq. expectedPerSubjectInProcess map[string]struct{} // Current 'expected per subject' subjects in process. @@ -563,8 +645,11 @@ const ( JSBatchSeq = "Nats-Batch-Sequence" JSBatchCommit = "Nats-Batch-Commit" JSSchedulePattern = "Nats-Schedule" + JSScheduleTimeZone = "Nats-Schedule-Time-Zone" JSScheduleTTL = "Nats-Schedule-TTL" + JSScheduleRollup = "Nats-Schedule-Rollup" JSScheduleTarget = "Nats-Schedule-Target" + JSScheduleSource = "Nats-Schedule-Source" ) // Headers for published KV messages. @@ -738,13 +823,6 @@ func (a *Account) addStreamWithAssignment(config *StreamConfig, fsConfig *FileSt js.mu.RUnlock() jsa.mu.Lock() } - // Check for template ownership if present. - if cfg.Template != _EMPTY_ && jsa.account != nil { - if !jsa.checkTemplateOwnership(cfg.Template, cfg.Name) { - jsa.mu.Unlock() - return nil, fmt.Errorf("stream not owned by template") - } - } // If mirror, check if the transforms (if any) are valid. if cfg.Mirror != nil { @@ -978,7 +1056,7 @@ func (a *Account) addStreamWithAssignment(config *StreamConfig, fsConfig *FileSt suppress = true } } else if sa != nil { - suppress = sa.responded + suppress = sa.hasResponded() } if !suppress { mset.sendCreateAdvisory() @@ -1002,6 +1080,9 @@ func (ssi *StreamSource) composeIName() string { if ssi.External != nil { iName = iName + ":" + getHash(ssi.External.ApiPrefix) } + if ssi.Consumer != nil { + iName = iName + ":C=" + getHash(ssi.Consumer.Name) + } source := ssi.FilterSubject destination := fwcs @@ -1040,6 +1121,23 @@ func (ssi *StreamSource) setIndexName() { ssi.iname = ssi.composeIName() } +// Composes the consumer index name. Contains the stream name and consumer name used for durable sourcing (if any). +// When the stream is external we will use the api prefix as part of the index name +// (as the same stream and consumer names could be used in multiple JS domains) +func (ssi *StreamSource) composeCName() string { + var iName = ssi.Name + + if ssi.External != nil { + iName = iName + ":" + getHash(ssi.External.ApiPrefix) + } + var c string + if ssi.Consumer != nil { + c = ssi.Consumer.Name + } + + return strings.Join([]string{iName, c}, " ") +} + func (mset *stream) streamAssignment() *streamAssignment { mset.mu.RLock() defer mset.mu.RUnlock() @@ -1171,6 +1269,16 @@ func (mset *stream) setLeader(isLeader bool) error { mset.mu.Unlock() return err } + + // Reset any inflight fast batches. We were likely a follower before and need + // to send an ack to the publishers so they know we're still there. + if mset.batches != nil { + mset.batches.mu.Lock() + for batchId, b := range mset.batches.fast { + mset.batches.fastBatchReset(mset, batchId, b) + } + mset.batches.mu.Unlock() + } } else { // cancel timer to create the source consumers if not fired yet if mset.sourcesConsumerSetup != nil { @@ -1307,8 +1415,13 @@ func (mset *stream) autoTuneFileStorageBlockSize(fsCfg *FileStoreConfig) { // headers and msgId in them. Would need signaling from the storage layer. // mset.mu and mset.ddMu locks should be held. func (mset *stream) rebuildDedupe() { + duplicates := mset.cfg.Duplicates + if duplicates <= 0 { + return + } + // We have some messages. Lookup starting sequence by duplicate time window. - sseq := mset.store.GetSeqFromTime(time.Now().Add(-mset.cfg.Duplicates)) + sseq := mset.store.GetSeqFromTime(time.Now().Add(-duplicates)) if sseq == 0 { return } @@ -1360,16 +1473,9 @@ func (mset *stream) lastSeq() uint64 { return mset.lseq } -// Set last seq. -// Write lock should be held. -func (mset *stream) setLastSeq(lseq uint64) { - mset.lseq = lseq -} - func (mset *stream) sendCreateAdvisory() { mset.mu.RLock() name := mset.cfg.Name - template := mset.cfg.Template outq := mset.outq srv := mset.srv mset.mu.RUnlock() @@ -1385,10 +1491,9 @@ func (mset *stream) sendCreateAdvisory() { ID: nuid.Next(), Time: time.Now().UTC(), }, - Stream: name, - Action: CreateEvent, - Template: template, - Domain: srv.getOpts().JetStreamDomain, + Stream: name, + Action: CreateEvent, + Domain: srv.getOpts().JetStreamDomain, } j, err := json.Marshal(m) @@ -1411,10 +1516,9 @@ func (mset *stream) sendDeleteAdvisoryLocked() { ID: nuid.Next(), Time: time.Now().UTC(), }, - Stream: mset.cfg.Name, - Action: DeleteEvent, - Template: mset.cfg.Template, - Domain: mset.srv.getOpts().JetStreamDomain, + Stream: mset.cfg.Name, + Action: DeleteEvent, + Domain: mset.srv.getOpts().JetStreamDomain, } j, err := json.Marshal(m) @@ -1518,8 +1622,8 @@ func (s *Server) checkStreamCfg(config *StreamConfig, acc *Account, pedantic boo if config == nil { return StreamConfig{}, NewJSStreamInvalidConfigError(fmt.Errorf("stream configuration invalid")) } - if !isValidName(config.Name) { - return StreamConfig{}, NewJSStreamInvalidConfigError(fmt.Errorf("stream name is required and can not contain '.', '*', '>'")) + if !isValidAssetName(config.Name) { + return StreamConfig{}, NewJSStreamInvalidConfigError(fmt.Errorf("stream name is required and can not contain '.', '*', '>', '\\', '/'")) } if len(config.Name) > JSMaxNameLen { return StreamConfig{}, NewJSStreamInvalidConfigError(fmt.Errorf("stream name is too long, maximum allowed is %d", JSMaxNameLen)) @@ -1601,7 +1705,8 @@ func (s *Server) checkStreamCfg(config *StreamConfig, acc *Account, pedantic boo if cfg.MaxAge != 0 && cfg.MaxAge < 100*time.Millisecond { return StreamConfig{}, NewJSStreamInvalidConfigError(fmt.Errorf("max age needs to be >= 100ms")) } - if cfg.Duplicates == 0 && cfg.Mirror == nil { + + if cfg.Duplicates == 0 && cfg.Mirror == nil && len(cfg.Sources) == 0 { maxWindow := StreamDefaultDuplicatesWindow if lim.Duplicates > 0 && maxWindow > lim.Duplicates { if pedantic { @@ -1746,9 +1851,26 @@ func (s *Server) checkStreamCfg(config *StreamConfig, acc *Account, pedantic boo if cfg.AllowAtomicPublish { return StreamConfig{}, NewJSMirrorWithAtomicPublishError() } + if cfg.AllowBatchPublish { + return StreamConfig{}, NewJSMirrorWithBatchPublishError() + } if cfg.AllowMsgSchedules { return StreamConfig{}, NewJSMirrorWithMsgSchedulesError() } + if c := cfg.Mirror.Consumer; c != nil { + if !isValidAssetName(c.Name) { + return StreamConfig{}, NewJSMirrorDurableConsumerCfgInvalidError() + } + if !subjectIsLiteral(c.DeliverSubject) || !IsValidSubject(c.DeliverSubject) { + return StreamConfig{}, NewJSMirrorDurableConsumerCfgInvalidError() + } + if cfg.Mirror.OptStartSeq != 0 || cfg.Mirror.OptStartTime != nil { + return StreamConfig{}, NewJSMirrorDurableConsumerCfgInvalidError() + } + if cfg.Mirror.FilterSubject != _EMPTY_ { + return StreamConfig{}, NewJSMirrorDurableConsumerCfgInvalidError() + } + } if cfg.Mirror.FilterSubject != _EMPTY_ && len(cfg.Mirror.SubjectTransforms) != 0 { return StreamConfig{}, NewJSMirrorMultipleFiltersNotAllowedError() } @@ -1778,7 +1900,7 @@ func (s *Server) checkStreamCfg(config *StreamConfig, acc *Account, pedantic boo // Do not perform checks if External is provided, as it could lead to // checking against itself (if sourced stream name is the same on different JetStream) if cfg.Mirror.External == nil { - if !isValidName(cfg.Mirror.Name) { + if !isValidAssetName(cfg.Mirror.Name) { return StreamConfig{}, NewJSMirrorInvalidStreamNameError() } // We do not require other stream to exist anymore, but if we can see it check payloads. @@ -1832,8 +1954,9 @@ func (s *Server) checkStreamCfg(config *StreamConfig, acc *Account, pedantic boo // check sources for duplicates var iNames = make(map[string]struct{}) + var cNames = make(map[string]struct{}) for _, src := range cfg.Sources { - if src == nil || !isValidName(src.Name) { + if src == nil || !isValidAssetName(src.Name) { return StreamConfig{}, NewJSSourceInvalidStreamNameError() } if _, ok := iNames[src.composeIName()]; !ok { @@ -1865,6 +1988,27 @@ func (s *Server) checkStreamCfg(config *StreamConfig, acc *Account, pedantic boo } } + if c := src.Consumer; c != nil { + if !isValidAssetName(c.Name) { + return StreamConfig{}, NewJSSourceDurableConsumerCfgInvalidError() + } + if !subjectIsLiteral(c.DeliverSubject) || !IsValidSubject(c.DeliverSubject) { + return StreamConfig{}, NewJSSourceDurableConsumerCfgInvalidError() + } + if src.OptStartSeq != 0 || src.OptStartTime != nil { + return StreamConfig{}, NewJSSourceDurableConsumerCfgInvalidError() + } + if src.FilterSubject != _EMPTY_ { + return StreamConfig{}, NewJSSourceDurableConsumerCfgInvalidError() + } + // Reusing the same consumer for multiple sources of the same stream isn't allowed. + if _, ok := cNames[src.composeCName()]; !ok { + cNames[src.composeCName()] = struct{}{} + } else { + return StreamConfig{}, NewJSSourceDurableConsumerDuplicateDetectedError() + } + } + // Do not perform checks if External is provided, as it could lead to // checking against itself (if sourced stream name is the same on different JetStream) if src.External == nil { @@ -2126,13 +2270,6 @@ func (jsa *jsAccount) configUpdateCheck(old, new *StreamConfig, s *Server, pedan return nil, NewJSStreamInvalidConfigError(fmt.Errorf("stream configuration update can not change retention policy to/from workqueue")) } } - // Can not have a template owner for now. - if old.Template != _EMPTY_ { - return nil, NewJSStreamInvalidConfigError(fmt.Errorf("stream configuration update not allowed on template owned stream")) - } - if cfg.Template != _EMPTY_ { - return nil, NewJSStreamInvalidConfigError(fmt.Errorf("stream configuration update can not be owned by a template")) - } // Can not change from true to false. if !cfg.Sealed && old.Sealed { return nil, NewJSStreamInvalidConfigError(fmt.Errorf("stream configuration update can not unseal a sealed stream")) @@ -2313,9 +2450,13 @@ func (mset *stream) updateWithAdvisory(config *StreamConfig, sendAdvisory bool, jsa.mu.RUnlock() mset.mu.Lock() - if mset.isLeader() { + if mset.active { // Check for mirror promotion. if ocfg.Mirror != nil && cfg.Mirror == nil { + // Only try deleting the sourcing consumer if one wasn't provided to us. + if ocfg.Mirror.Consumer == nil { + mset.tryDeleteMirrorConsumer(ocfg.Mirror) + } mset.cancelMirrorConsumer() mset.mirror = nil } @@ -2357,10 +2498,22 @@ func (mset *stream) updateWithAdvisory(config *StreamConfig, sendAdvisory bool, // Check for Sources. if len(cfg.Sources) > 0 || len(ocfg.Sources) > 0 { currentIName := make(map[string]struct{}) + currentConsumers := make(map[string]*StreamSource) needsStartingSeqNum := make(map[string]struct{}) + getSourcingConsumerIName := func(ssi *StreamSource, sources []*StreamSource) string { + var iName = ssi.Name + if ssi.External != nil { + iName = iName + ":" + getHash(ssi.External.ApiPrefix) + } + return fmt.Sprintf("%s %s", iName, mset.createSourcingConsumerHash(ssi, sources)) + } for _, s := range ocfg.Sources { currentIName[s.iname] = struct{}{} + // Only track the sourcing consumer for deletion if one wasn't provided to us. + if s.Consumer == nil { + currentConsumers[getSourcingConsumerIName(s, ocfg.Sources)] = s + } } for _, s := range cfg.Sources { s.setIndexName() @@ -2397,6 +2550,16 @@ func (mset *stream) updateWithAdvisory(config *StreamConfig, sendAdvisory bool, // source already exists delete(currentIName, s.iname) } + + // Remove the source if it still exists, but only if not using a pre-existing consumer. + if s.Consumer == nil { + delete(currentConsumers, getSourcingConsumerIName(s, cfg.Sources)) + } + } + // Delete source consumers if any aren't used anymore. + for _, s := range currentConsumers { + id := mset.createSourcingConsumerHash(s, ocfg.Sources) + mset.tryDeleteSourceConsumer(id, s) } // What is left in currentIName needs to be deleted. for iName := range currentIName { @@ -2503,9 +2666,16 @@ func (mset *stream) updateWithAdvisory(config *StreamConfig, sendAdvisory bool, // If atomic publish is disabled, delete any in-progress batches. if !cfg.AllowAtomicPublish { - mset.deleteInflightBatches(false) + mset.deleteAtomicBatches(false) mset.deleteBatchApplyState() } + // If fast batch publish is disabled, delete any in-progress batches. + if !cfg.AllowBatchPublish { + mset.deleteFastBatches() + } + if !cfg.AllowAtomicPublish && !cfg.AllowBatchPublish { + mset.batches = nil + } // Now update config and store's version of our config. // Although we are under the stream write lock, we will also assign the new @@ -2568,6 +2738,80 @@ func (mset *stream) updateWithAdvisory(config *StreamConfig, sendAdvisory bool, return nil } +// tryDeleteMirrorConsumer is a best-effort single try to delete a consumer used for stream mirroring. +// Lock should be held. +func (mset *stream) tryDeleteMirrorConsumer(mirror *StreamSource) { + id := mset.createStableConsumerHash() + consumerName := fmt.Sprintf("JS_MIRROR_%s", id) + log := mset.mirror != nil && mset.mirror.cname == consumerName + mset.tryDeleteSourcingConsumer("mirror", mirror, consumerName, log) +} + +// tryDeleteSourceConsumer is a best-effort single try to delete a consumer used for stream sourcing. +// Lock should be held. +func (mset *stream) tryDeleteSourceConsumer(id string, source *StreamSource) { + consumerName := fmt.Sprintf("JS_SRC_%s", id) + si := mset.sources[source.iname] + log := si != nil && si.cname == consumerName + mset.tryDeleteSourcingConsumer("source", source, consumerName, log) +} + +// tryDeleteSourcingConsumer is a best-effort single try to delete a sourcing consumer. +// Lock should be held. +func (mset *stream) tryDeleteSourcingConsumer(kind string, source *StreamSource, consumerName string, log bool) { + acc := mset.acc + accName, streamName, sourceName := acc.Name, mset.cfg.Name, source.Name + subject := fmt.Sprintf(JSApiConsumerDeleteT, sourceName, consumerName) + if source.External != nil { + subject = strings.Replace(subject, JSApiPrefix, source.External.ApiPrefix, 1) + subject = strings.ReplaceAll(subject, "..", ".") + } + s := mset.srv + go func() { + warn := func(err error) { + if log { + s.Warnf("Cleanup of %s consumer '%s > %s' failed for stream '%s > %s': %v", kind, sourceName, consumerName, accName, streamName, err) + } + } + + respCh := make(chan *JSApiConsumerDeleteResponse, 1) + reply := infoReplySubject() + cdSub, err := acc.subscribeInternal(reply, func(sub *subscription, c *client, _ *Account, subject, reply string, rmsg []byte) { + _, msg := c.msgParts(rmsg) + + var cdr JSApiConsumerDeleteResponse + if err := json.Unmarshal(msg, &cdr); err != nil { + warn(err) + return + } + select { + case respCh <- &cdr: + default: + } + }) + if err != nil { + warn(err) + return + } + defer acc.unsubscribeInternal(cdSub) + + // Send the delete request. + err = s.sendInternalAccountMsgWithReply(acc, subject, reply, nil, nil, false) + if err != nil { + warn(err) + return + } + select { + case cdr := <-respCh: + if cdr.Error != nil { + warn(cdr.Error) + } + case <-time.After(sourceHealthCheckInterval): + warn(errors.New("timed out")) + } + }() +} + // Small helper to return the Name field from mset.cfg, protected by // the mset.cfgMu mutex. This is simply because we have several places // in consumer.go where we need it. @@ -2611,7 +2855,7 @@ func (mset *stream) purgeLocked(preq *JSApiStreamPurgeRequest, needLock bool) (p // Check if our last has moved past what our original last sequence was, if so reset. if lseq > mlseq { - mset.setLastSeq(lseq) + mset.lseq = lseq } // Clear any pending acks below first seq. @@ -2620,7 +2864,10 @@ func (mset *stream) purgeLocked(preq *JSApiStreamPurgeRequest, needLock bool) (p // Purge consumers. // Check for filtered purge. if preq != nil && preq.Subject != _EMPTY_ { - ss := store.FilteredState(fseq, preq.Subject) + ss, err := store.FilteredState(fseq, preq.Subject) + if err != nil { + return purged, err + } fseq = ss.First } @@ -2767,9 +3014,17 @@ func (mset *stream) retryDisconnectedSyncConsumers() { return } + // Not client.isClosed(): internal account clients have nil nc, which would make isClosed always true here. + clientClosed := func(c *client) bool { + return c != nil && (c.flags.isSet(closeConnection) || c.flags.isSet(connMarkedClosed)) + } + // Stale sources need to be reset: we expect a heartbeat every sourceHealthHB, so missing a couple + // is a strong signal the remote delivery is no longer reaching us and a retry is warranted. + stale := func(si *sourceInfo) bool { + return time.Since(time.Unix(0, si.last.Load())) > 2*sourceHealthHB + } shouldRetry := func(si *sourceInfo) bool { - if si != nil && (si.sip || si.sub == nil || (si.sub.client != nil && si.sub.client.isClosed())) { - // Need to reset + if si != nil && (si.sip || si.sub == nil || clientClosed(si.sub.client) || stale(si)) { si.fails, si.sip = 0, false mset.cancelSourceInfo(si) return true @@ -2875,8 +3130,8 @@ func (mset *stream) processMirrorMsgs(mirror *sourceInfo, ready *sync.WaitGroup) // Checks that the message is from our current direct consumer. We can not depend on sub comparison // since cross account imports break. -func (si *sourceInfo) isCurrentSub(reply string) bool { - return si.cname != _EMPTY_ && strings.HasPrefix(reply, jsAckPre) && si.cname == tokenAt(reply, 4) +func (si *sourceInfo) isCurrentSub(cname string) bool { + return si.cname != _EMPTY_ && si.cname == cname } // processInboundMirrorMsg handles processing messages bound for a stream. @@ -2893,10 +3148,11 @@ func (mset *stream) processInboundMirrorMsg(m *inMsg) bool { } isControl := m.isControlMsg() + cname := consumerFromAckReply(m.rply) // Ignore from old subscriptions. // The reason we can not just compare subs is that on cross account imports they will not match. - if !mset.mirror.isCurrentSub(m.rply) && !isControl { + if !mset.mirror.isCurrentSub(cname) && !isControl { mset.mu.Unlock() return false } @@ -2906,12 +3162,12 @@ func (mset *stream) processInboundMirrorMsg(m *inMsg) bool { var needsRetry bool // Flow controls have reply subjects. if m.rply != _EMPTY_ { - mset.handleFlowControl(m) + mset.handleFlowControl(m, mset.mirror.dseq, mset.mirror.sseq) } else { // For idle heartbeats make sure we did not miss anything and check if we are considered stalled. - if ldseq := parseInt64(getHeader(JSLastConsumerSeq, m.hdr)); ldseq > 0 && uint64(ldseq) != mset.mirror.dseq { + if ldseq := parseInt64(sliceHeader(JSLastConsumerSeq, m.hdr)); ldseq > 0 && uint64(ldseq) != mset.mirror.dseq { needsRetry = true - } else if fcReply := getHeader(JSConsumerStalled, m.hdr); len(fcReply) > 0 { + } else if fcReply := sliceHeader(JSConsumerStalled, m.hdr); len(fcReply) > 0 { // Other side thinks we are stalled, so send flow control reply. mset.outq.sendMsg(string(fcReply), nil) } @@ -2923,7 +3179,7 @@ func (mset *stream) processInboundMirrorMsg(m *inMsg) bool { return !needsRetry } - sseq, dseq, dc, ts, pending := replyInfo(m.rply) + sseq, dseq, dc, ts, pending := ackReplyInfo(m.rply) if dc > 1 { mset.mu.Unlock() @@ -2932,15 +3188,19 @@ func (mset *stream) processInboundMirrorMsg(m *inMsg) bool { // Mirror info tracking. olag, osseq, odseq := mset.mirror.lag, mset.mirror.sseq, mset.mirror.dseq - if sseq == mset.mirror.sseq+1 { - mset.mirror.dseq = dseq - mset.mirror.sseq++ - } else if sseq <= mset.mirror.sseq { + if sseq <= mset.mirror.sseq { // Ignore older messages. + // If the deliver sequence matches, we only update delivered accounting. + if dseq == mset.mirror.dseq+1 { + mset.mirror.dseq++ + } mset.mu.Unlock() return true + } else if sseq == mset.mirror.sseq+1 { + mset.mirror.dseq = dseq + mset.mirror.sseq++ } else if mset.mirror.cname == _EMPTY_ { - mset.mirror.cname = tokenAt(m.rply, 4) + mset.mirror.cname = cname mset.mirror.dseq, mset.mirror.sseq = dseq, sseq } else { // If the deliver sequence matches then the upstream stream has expired or deleted messages. @@ -3014,10 +3274,10 @@ func (mset *stream) processInboundMirrorMsg(m *inMsg) bool { accName, sname, err) } else { // We may have missed messages, restart. - if sseq <= mset.lastSeq() { + if lseq := mset.lastSeq(); sseq <= lseq { mset.mu.Lock() mset.mirror.lag = olag - mset.mirror.sseq = osseq + mset.mirror.sseq = lseq mset.mirror.dseq = odseq mset.mu.Unlock() return false @@ -3073,8 +3333,13 @@ func (mset *stream) skipMsgs(start, end uint64) { return } - // FIXME (dlc) - We should allow proposals of DeleteRange, but would need to make sure all peers support. - // With syncRequest was easy to add bool into request. + // Must only be enabled once every peer in the cluster supports receiving + // deleteRangeOp in the normal apply path; older peers panic on unknown ops. + if mset.srv.getOpts().getFeatureFlag(FeatureFlagJsRaftDeleteRange) { + node.Propose(encodeDeleteRange(&DeleteRange{First: start, Num: end - start + 1})) + return + } + var entries []*Entry for seq := start; seq <= end; seq++ { entries = append(entries, newEntry(EntryNormal, encodeStreamMsg(_EMPTY_, _EMPTY_, nil, nil, seq-1, 0, false))) @@ -3185,9 +3450,12 @@ func (mset *stream) setupMirrorConsumer() error { // Determine subjects etc. var deliverSubject string + var durableDeliverSubject string ext := mset.cfg.Mirror.External - - if ext != nil && ext.DeliverPrefix != _EMPTY_ { + if mset.cfg.Mirror.Consumer != nil { + durableDeliverSubject = mset.cfg.Mirror.Consumer.DeliverSubject + mirror.cname = mset.cfg.Mirror.Consumer.Name + } else if ext != nil && ext.DeliverPrefix != _EMPTY_ { deliverSubject = strings.ReplaceAll(ext.DeliverPrefix+syncSubject(".M"), "..", ".") } else { deliverSubject = syncSubject("$JS.M") @@ -3199,9 +3467,18 @@ func (mset *stream) setupMirrorConsumer() error { var state StreamState mset.store.FastState(&state) + id := mset.createStableConsumerHash() + metadata := map[string]string{} + metadata["_nats.mirror.stream"] = mset.cfg.Name + metadata["_nats.mirror.acc"] = mset.acc.Name + if domain := mset.srv.getOpts().JetStreamDomain; domain != _EMPTY_ { + metadata["_nats.mirror.domain"] = domain + } + req := &CreateConsumerRequest{ Stream: mset.cfg.Mirror.Name, Config: ConsumerConfig{ + Name: fmt.Sprintf("JS_MIRROR_%s", id), DeliverSubject: deliverSubject, DeliverPolicy: DeliverByStartSequence, OptStartSeq: state.LastSeq + 1, @@ -3211,7 +3488,9 @@ func (mset *stream) setupMirrorConsumer() error { Heartbeat: sourceHealthHB, FlowControl: true, Direct: true, + Sourcing: true, InactiveThreshold: sourceHealthCheckInterval, + Metadata: metadata, }, } @@ -3264,7 +3543,6 @@ func (mset *stream) setupMirrorConsumer() error { respCh := make(chan *JSApiConsumerCreateResponse, 1) reply := infoReplySubject() crSub, err := mset.subscribeInternal(reply, func(sub *subscription, c *client, _ *Account, subject, reply string, rmsg []byte) { - mset.unsubscribe(sub) _, msg := c.msgParts(rmsg) var ccr JSApiConsumerCreateResponse @@ -3284,28 +3562,40 @@ func (mset *stream) setupMirrorConsumer() error { return nil } - var subject string - if req.Config.FilterSubject != _EMPTY_ { - req.Config.Name = fmt.Sprintf("mirror-%s", createConsumerName()) - subject = fmt.Sprintf(JSApiConsumerCreateExT, mset.cfg.Mirror.Name, req.Config.Name, req.Config.FilterSubject) - } else { - subject = fmt.Sprintf(JSApiConsumerCreateT, mset.cfg.Mirror.Name) + generateSubject := func() (subject string) { + if durableDeliverSubject != _EMPTY_ { + // If we're using a pre-existing consumer, we'll send a consumer reset request instead. + subject = fmt.Sprintf(JSApiConsumerResetT, mset.cfg.Mirror.Name, mirror.cname) + } else if req.Config.FilterSubject != _EMPTY_ { + subject = fmt.Sprintf(JSApiConsumerCreateExT, mset.cfg.Mirror.Name, req.Config.Name, req.Config.FilterSubject) + } else { + subject = fmt.Sprintf(JSApiConsumerCreateT, mset.cfg.Mirror.Name) + } + if ext != nil { + subject = strings.Replace(subject, JSApiPrefix, ext.ApiPrefix, 1) + subject = strings.ReplaceAll(subject, "..", ".") + } + return subject } - if ext != nil { - subject = strings.Replace(subject, JSApiPrefix, ext.ApiPrefix, 1) - subject = strings.ReplaceAll(subject, "..", ".") - } - - // Marshal now that we are done with `req`. - b, _ := json.Marshal(req) + subject := generateSubject() // Reset mirror.msgs = nil mirror.err = nil mirror.sip = true - // Send the consumer create request - mset.outq.send(newJSPubMsg(subject, _EMPTY_, reply, nil, b, nil, 0)) + if durableDeliverSubject != _EMPTY_ { + // Send the consumer reset request + mset.outq.send(newJSPubMsg(subject, _EMPTY_, reply, nil, nil, nil, 0)) + } else { + // Marshal now that we are done with `req`. + b, _ := json.Marshal(req) + + // Send the consumer create request + // Confirm the server supports API level 4, which contains durable sourcing, AckFlowControl, and consumer reset. + hdr := genHeader(nil, JSRequiredApiLevel, "4") + mset.outq.send(newJSPubMsg(subject, _EMPTY_, reply, hdr, b, nil, 0)) + } go func() { @@ -3335,94 +3625,127 @@ func (mset *stream) setupMirrorConsumer() error { mset.mu.Lock() if mset.mirror == nil { // Mirror config has been removed. + mset.unsubscribe(crSub) mset.mu.Unlock() return - } else { - wg := &mset.mirror.wg - mset.mu.Unlock() - wg.Wait() } + wg := &mset.mirror.wg + mset.mu.Unlock() + wg.Wait() + SELECT: select { case ccr := <-respCh: mset.mu.Lock() // Mirror config has been removed. if mset.mirror == nil { + mset.unsubscribe(crSub) mset.mu.Unlock() return } ready := sync.WaitGroup{} mirror := mset.mirror mirror.err = nil + if ccr.Error != nil || ccr.ConsumerInfo == nil { + // If the responding server doesn't support sourcing consumers, retry without it. + if req.Config.Sourcing && ccr.Error != nil && + (ccr.Error.ErrCode == uint16(JSRequiredApiLevelErr) || ccr.Error.ErrCode == uint16(JSInvalidJSONErr)) { + // Unset for retry. + req.Config.Sourcing = false + // Specify a unique consumer name, as the other end will not know to do this. + req.Config.Name = fmt.Sprintf("JS_MIRROR_%s_%s", id, createConsumerName()) + b, _ := json.Marshal(req) + // Regenerate subject since the previous name could've been included in it. + subject = generateSubject() + mset.outq.send(newJSPubMsg(subject, _EMPTY_, reply, nil, b, nil, 0)) + mset.mu.Unlock() + goto SELECT + } + mset.unsubscribe(crSub) mset.srv.Warnf("JetStream error response for create mirror consumer: %+v", ccr.Error) mirror.err = ccr.Error // Let's retry as soon as possible, but we are gated by sourceConsumerRetryThreshold retry = true mset.mu.Unlock() return + } + + // If using durable sourcing, we need the consumer to use acks based on flow control. + if durableDeliverSubject != _EMPTY_ && ccr.ConsumerInfo.Config.AckPolicy != AckFlowControl { + mset.unsubscribe(crSub) + mirror.err = NewJSMirrorConsumerRequiresAckFCError() + retry = true + mset.mu.Unlock() + return + } + + // We can now unsubscribe. + mset.unsubscribe(crSub) + + // Setup actual subscription to process messages from our source. + qname := fmt.Sprintf("[ACC:%s] stream mirror '%s' of '%s' msgs", mset.acc.Name, mset.cfg.Name, mset.cfg.Mirror.Name) + // Create a new queue each time + mirror.msgs = newIPQueue[*inMsg](mset.srv, qname) + msgs := mirror.msgs + if durableDeliverSubject != _EMPTY_ { + deliverSubject = durableDeliverSubject } else { - // Setup actual subscription to process messages from our source. - qname := fmt.Sprintf("[ACC:%s] stream mirror '%s' of '%s' msgs", mset.acc.Name, mset.cfg.Name, mset.cfg.Mirror.Name) - // Create a new queue each time - mirror.msgs = newIPQueue[*inMsg](mset.srv, qname) - msgs := mirror.msgs - sub, err := mset.subscribeInternal(deliverSubject, func(sub *subscription, c *client, _ *Account, subject, reply string, rmsg []byte) { - hdr, msg := c.msgParts(copyBytes(rmsg)) // Need to copy. - if len(hdr) > 0 { - // Remove any Nats-Expected- headers as we don't want to validate them. - hdr = removeHeaderIfPrefixPresent(hdr, "Nats-Expected-") - // Remove any Nats-Batch- headers, batching is not supported when mirroring. - hdr = removeHeaderIfPrefixPresent(hdr, "Nats-Batch-") - } - mset.queueInbound(msgs, subject, reply, hdr, msg, nil, nil) - mirror.last.Store(time.Now().UnixNano()) - }) - if err != nil { - mirror.err = NewJSMirrorConsumerSetupFailedError(err, Unless(err)) - retry = true - mset.mu.Unlock() - return + deliverSubject = ccr.ConsumerInfo.Config.DeliverSubject + } + sub, err := mset.subscribeInternal(deliverSubject, func(sub *subscription, c *client, _ *Account, subject, reply string, rmsg []byte) { + hdr, msg := c.msgParts(copyBytes(rmsg)) // Need to copy. + if len(hdr) > 0 { + // Remove any Nats-Expected- headers as we don't want to validate them. + hdr = removeHeaderIfPrefixPresent(hdr, "Nats-Expected-") + // Remove any Nats-Batch- headers, batching is not supported when mirroring. + hdr = removeHeaderIfPrefixPresent(hdr, "Nats-Batch-") } - // Save our sub. - mirror.sub = sub + mset.queueInbound(msgs, subject, reply, hdr, msg, nil, nil) + mirror.last.Store(time.Now().UnixNano()) + }) + if err != nil { + mirror.err = NewJSMirrorConsumerSetupFailedError(err, Unless(err)) + retry = true + mset.mu.Unlock() + return + } + // Save our sub. + mirror.sub = sub - // When an upstream stream expires messages or in general has messages that we want - // that are no longer available we need to adjust here. - var state StreamState - mset.store.FastState(&state) - - // Check if we need to skip messages. - if state.LastSeq != ccr.ConsumerInfo.Delivered.Stream { - // Check to see if delivered is past our last and we have no msgs. This will help the - // case when mirroring a stream that has a very high starting sequence number. - if state.Msgs == 0 && ccr.ConsumerInfo.Delivered.Stream > state.LastSeq { - mset.store.PurgeEx(_EMPTY_, ccr.ConsumerInfo.Delivered.Stream+1, 0) - mset.lseq = ccr.ConsumerInfo.Delivered.Stream - } else { - mset.skipMsgs(state.LastSeq+1, ccr.ConsumerInfo.Delivered.Stream) - } + // Check if we need to skip messages. + // Re-capture state since the previous may be stale. + state = StreamState{} + mset.store.FastState(&state) + if state.LastSeq < ccr.ConsumerInfo.Delivered.Stream { + // Check to see if delivered is past our last and we have no msgs. This will help the + // case when mirroring a stream that has a very high starting sequence number. + if state.Msgs == 0 && ccr.ConsumerInfo.Delivered.Stream > state.LastSeq { + mset.store.PurgeEx(_EMPTY_, ccr.ConsumerInfo.Delivered.Stream+1, 0) + mset.lseq = ccr.ConsumerInfo.Delivered.Stream + } else { + mset.skipMsgs(state.LastSeq+1, ccr.ConsumerInfo.Delivered.Stream) } + } - // Capture consumer name. - mirror.cname = ccr.ConsumerInfo.Name - mirror.dseq = 0 - mirror.sseq = ccr.ConsumerInfo.Delivered.Stream - mirror.qch = make(chan struct{}) - mirror.wg.Add(1) - ready.Add(1) - if !mset.srv.startGoRoutine( - func() { mset.processMirrorMsgs(mirror, &ready) }, - pprofLabels{ - "type": "mirror", - "account": mset.acc.Name, - "stream": mset.cfg.Name, - "consumer": mirror.cname, - }, - ) { - mirror.wg.Done() - ready.Done() - } + // Capture consumer name. + mirror.cname = ccr.ConsumerInfo.Name + mirror.dseq = 0 + mirror.sseq = max(ccr.ConsumerInfo.Delivered.Stream, state.LastSeq) + mirror.qch = make(chan struct{}) + mirror.wg.Add(1) + ready.Add(1) + if !mset.srv.startGoRoutine( + func() { mset.processMirrorMsgs(mirror, &ready) }, + pprofLabels{ + "type": "mirror", + "account": mset.acc.Name, + "stream": mset.cfg.Name, + "consumer": mirror.cname, + }, + ) { + mirror.wg.Done() + ready.Done() } mset.mu.Unlock() ready.Wait() @@ -3563,17 +3886,29 @@ func (mset *stream) trySetupSourceConsumer(iname string, seq uint64, startTime t // Determine subjects etc. var deliverSubject string + var durableDeliverSubject string ext := ssi.External - - if ext != nil && ext.DeliverPrefix != _EMPTY_ { + if ssi.Consumer != nil { + durableDeliverSubject = ssi.Consumer.DeliverSubject + si.cname = ssi.Consumer.Name + } else if ext != nil && ext.DeliverPrefix != _EMPTY_ { deliverSubject = strings.ReplaceAll(ext.DeliverPrefix+syncSubject(".S"), "..", ".") } else { deliverSubject = syncSubject("$JS.S") } + id := mset.createSourcingConsumerHash(ssi, mset.cfg.Sources) + metadata := map[string]string{} + metadata["_nats.src.stream"] = mset.cfg.Name + metadata["_nats.src.acc"] = mset.acc.Name + if domain := mset.srv.getOpts().JetStreamDomain; domain != _EMPTY_ { + metadata["_nats.src.domain"] = domain + } + req := &CreateConsumerRequest{ Stream: si.name, Config: ConsumerConfig{ + Name: fmt.Sprintf("JS_SRC_%s", id), DeliverSubject: deliverSubject, AckPolicy: AckNone, AckWait: 22 * time.Hour, @@ -3581,7 +3916,9 @@ func (mset *stream) trySetupSourceConsumer(iname string, seq uint64, startTime t Heartbeat: sourceHealthHB, FlowControl: true, Direct: true, + Sourcing: true, InactiveThreshold: sourceHealthCheckInterval, + Metadata: metadata, }, } @@ -3628,7 +3965,6 @@ func (mset *stream) trySetupSourceConsumer(iname string, seq uint64, startTime t respCh := make(chan *JSApiConsumerCreateResponse, 1) reply := infoReplySubject() crSub, err := mset.subscribeInternal(reply, func(sub *subscription, c *client, _ *Account, subject, reply string, rmsg []byte) { - mset.unsubscribe(sub) _, msg := c.msgParts(rmsg) var ccr JSApiConsumerCreateResponse if err := json.Unmarshal(msg, &ccr); err != nil { @@ -3646,35 +3982,46 @@ func (mset *stream) trySetupSourceConsumer(iname string, seq uint64, startTime t return } - var subject string - if req.Config.FilterSubject != _EMPTY_ { - req.Config.Name = fmt.Sprintf("src-%s", createConsumerName()) - subject = fmt.Sprintf(JSApiConsumerCreateExT, si.name, req.Config.Name, req.Config.FilterSubject) - } else if len(req.Config.FilterSubjects) == 1 { - req.Config.Name = fmt.Sprintf("src-%s", createConsumerName()) - // It is necessary to switch to using FilterSubject here as the extended consumer - // create API checks for it, so as to not accidentally allow multiple filtered subjects. - req.Config.FilterSubject = req.Config.FilterSubjects[0] - req.Config.FilterSubjects = nil - subject = fmt.Sprintf(JSApiConsumerCreateExT, si.name, req.Config.Name, req.Config.FilterSubject) - } else { - subject = fmt.Sprintf(JSApiConsumerCreateT, si.name) + generateSubject := func() (subject string) { + if durableDeliverSubject != _EMPTY_ { + // If we're using a pre-existing consumer, we'll send a consumer reset request instead. + subject = fmt.Sprintf(JSApiConsumerResetT, si.name, si.cname) + } else if req.Config.FilterSubject != _EMPTY_ { + subject = fmt.Sprintf(JSApiConsumerCreateExT, si.name, req.Config.Name, req.Config.FilterSubject) + } else if len(req.Config.FilterSubjects) == 1 { + // It is necessary to switch to using FilterSubject here as the extended consumer + // create API checks for it, so as to not accidentally allow multiple filtered subjects. + req.Config.FilterSubject = req.Config.FilterSubjects[0] + req.Config.FilterSubjects = nil + subject = fmt.Sprintf(JSApiConsumerCreateExT, si.name, req.Config.Name, req.Config.FilterSubject) + } else { + subject = fmt.Sprintf(JSApiConsumerCreateT, si.name) + } + if ext != nil { + subject = strings.Replace(subject, JSApiPrefix, ext.ApiPrefix, 1) + subject = strings.ReplaceAll(subject, "..", ".") + } + return subject } - if ext != nil { - subject = strings.Replace(subject, JSApiPrefix, ext.ApiPrefix, 1) - subject = strings.ReplaceAll(subject, "..", ".") - } - - // Marshal request. - b, _ := json.Marshal(req) + subject := generateSubject() // Reset si.msgs = nil si.err = nil si.sip = true - // Send the consumer create request - mset.outq.send(newJSPubMsg(subject, _EMPTY_, reply, nil, b, nil, 0)) + if durableDeliverSubject != _EMPTY_ { + // Send the consumer reset request + mset.outq.send(newJSPubMsg(subject, _EMPTY_, reply, nil, nil, nil, 0)) + } else { + // Marshal request. + b, _ := json.Marshal(req) + + // Send the consumer create request + // Confirm the server supports API level 4, which contains durable sourcing, AckFlowControl, and consumer reset. + hdr := genHeader(nil, JSRequiredApiLevel, "4") + mset.outq.send(newJSPubMsg(subject, _EMPTY_, reply, hdr, b, nil, 0)) + } go func() { @@ -3699,13 +4046,32 @@ func (mset *stream) trySetupSourceConsumer(iname string, seq uint64, startTime t mset.mu.Unlock() }() + SELECT: select { case ccr := <-respCh: mset.mu.Lock() // Check that it has not been removed or canceled (si.sub would be nil) - if si := mset.sources[iname]; si != nil { + if si := mset.sources[iname]; si == nil { + mset.unsubscribe(crSub) + } else { si.err = nil + if ccr.Error != nil || ccr.ConsumerInfo == nil { + // If the responding server doesn't support sourcing consumers, retry without it. + if req.Config.Sourcing && ccr.Error != nil && + (ccr.Error.ErrCode == uint16(JSRequiredApiLevelErr) || ccr.Error.ErrCode == uint16(JSInvalidJSONErr)) { + // Unset for retry. + req.Config.Sourcing = false + // Specify a unique consumer name, as the other end will not know to do this. + req.Config.Name = fmt.Sprintf("JS_SRC_%s_%s", id, createConsumerName()) + b, _ := json.Marshal(req) + // Regenerate subject since the previous name could've been included in it. + subject = generateSubject() + mset.outq.send(newJSPubMsg(subject, _EMPTY_, reply, nil, b, nil, 0)) + mset.mu.Unlock() + goto SELECT + } + mset.unsubscribe(crSub) // Note: this warning can happen a few times when starting up the server when sourcing streams are // defined, this is normal as the streams are re-created in no particular order and it is possible // that a stream sourcing another could come up before all of its sources have been recreated. @@ -3715,48 +4081,65 @@ func (mset *stream) trySetupSourceConsumer(iname string, seq uint64, startTime t retry = true mset.mu.Unlock() return - } else { - // Check if our shared msg queue and go routine is running or not. - if mset.smsgs == nil { - qname := fmt.Sprintf("[ACC:%s] stream sources '%s' msgs", mset.acc.Name, mset.cfg.Name) - mset.smsgs = newIPQueue[*inMsg](mset.srv, qname) - mset.srv.startGoRoutine(func() { mset.processAllSourceMsgs() }, - pprofLabels{ - "type": "source", - "account": mset.acc.Name, - "stream": mset.cfg.Name, - }, - ) - } - - // Setup actual subscription to process messages from our source. - if si.sseq != ccr.ConsumerInfo.Delivered.Stream { - si.sseq = ccr.ConsumerInfo.Delivered.Stream + 1 - } - // Capture consumer name. - si.cname = ccr.ConsumerInfo.Name - - // Do not set si.sseq to seq here. si.sseq will be set in processInboundSourceMsg - si.dseq = 0 - si.qch = make(chan struct{}) - // Set the last seen as now so that we don't fail at the first check. - si.last.Store(time.Now().UnixNano()) - - msgs := mset.smsgs - sub, err := mset.subscribeInternal(deliverSubject, func(sub *subscription, c *client, _ *Account, subject, reply string, rmsg []byte) { - hdr, msg := c.msgParts(copyBytes(rmsg)) // Need to copy. - mset.queueInbound(msgs, subject, reply, hdr, msg, si, nil) - si.last.Store(time.Now().UnixNano()) - }) - if err != nil { - si.err = NewJSSourceConsumerSetupFailedError(err, Unless(err)) - retry = true - mset.mu.Unlock() - return - } - // Save our sub. - si.sub = sub } + + // If using durable sourcing, we need the consumer to use acks based on flow control. + if durableDeliverSubject != _EMPTY_ && ccr.ConsumerInfo.Config.AckPolicy != AckFlowControl { + mset.unsubscribe(crSub) + si.err = NewJSSourceConsumerRequiresAckFCError() + retry = true + mset.mu.Unlock() + return + } + + // We can now unsubscribe. + mset.unsubscribe(crSub) + + // Check if our shared msg queue and go routine is running or not. + if mset.smsgs == nil { + qname := fmt.Sprintf("[ACC:%s] stream sources '%s' msgs", mset.acc.Name, mset.cfg.Name) + mset.smsgs = newIPQueue[*inMsg](mset.srv, qname) + mset.srv.startGoRoutine(func() { mset.processAllSourceMsgs() }, + pprofLabels{ + "type": "source", + "account": mset.acc.Name, + "stream": mset.cfg.Name, + }, + ) + } + + // Setup actual subscription to process messages from our source. + if si.sseq < ccr.ConsumerInfo.Delivered.Stream { + si.sseq = ccr.ConsumerInfo.Delivered.Stream + } + // Capture consumer name. + si.cname = ccr.ConsumerInfo.Name + + // Do not set si.sseq to seq here. si.sseq will be set in processInboundSourceMsg + si.dseq = 0 + si.qch = make(chan struct{}) + // Set the last seen as now so that we don't fail at the first check. + si.last.Store(time.Now().UnixNano()) + + msgs := mset.smsgs + if durableDeliverSubject != _EMPTY_ { + deliverSubject = durableDeliverSubject + } else { + deliverSubject = ccr.ConsumerInfo.Config.DeliverSubject + } + sub, err := mset.subscribeInternal(deliverSubject, func(sub *subscription, c *client, _ *Account, subject, reply string, rmsg []byte) { + hdr, msg := c.msgParts(copyBytes(rmsg)) // Need to copy. + mset.queueInbound(msgs, subject, reply, hdr, msg, si, nil) + si.last.Store(time.Now().UnixNano()) + }) + if err != nil { + si.err = NewJSSourceConsumerSetupFailedError(err, Unless(err)) + retry = true + mset.mu.Unlock() + return + } + // Save our sub. + si.sub = sub } mset.mu.Unlock() case <-time.After(srcConsumerWaitTime): @@ -3860,20 +4243,39 @@ func (m *inMsg) isControlMsg() bool { // Sends a reply to a flow control request. // Lock should be held. -func (mset *stream) sendFlowControlReply(reply string) { +func (mset *stream) sendFlowControlReply(reply string, hdr []byte) { if mset.isLeader() && mset.outq != nil { - mset.outq.sendMsg(reply, nil) + dseq := parseInt64(sliceHeader(JSLastConsumerSeq, hdr)) + sseq := parseInt64(sliceHeader(JSLastStreamSeq, hdr)) + + // If we're responding to flow control without being delivered messages (for example after a restart), + // we'll only have the stream sequence. + if sseq > 0 { + if dseq < 0 { + dseq = 0 + } + const t = "NATS/1.0\r\n%s: %d\r\n%s: %d\r\n\r\n" + hdr = fmt.Appendf(nil, t, JSLastConsumerSeq, dseq, JSLastStreamSeq, sseq) + mset.outq.send(newJSPubMsg(reply, _EMPTY_, _EMPTY_, hdr, nil, nil, 0)) + } else { + mset.outq.sendMsg(reply, nil) + } } } // handleFlowControl will properly handle flow control messages for both R==1 and R>1. // Lock should be held. -func (mset *stream) handleFlowControl(m *inMsg) { +func (mset *stream) handleFlowControl(m *inMsg, dseq, sseq uint64) { // If we are clustered we will send the flow control message through the replication stack. if mset.isClustered() { + // Append the current delivery and stream sequences, to be sent after replication. + m.hdr = genHeader(m.hdr, JSLastConsumerSeq, strconv.FormatUint(dseq, 10)) + m.hdr = genHeader(m.hdr, JSLastStreamSeq, strconv.FormatUint(sseq, 10)) mset.node.Propose(encodeStreamMsg(_EMPTY_, m.rply, m.hdr, nil, 0, 0, false)) } else { - mset.outq.sendMsg(m.rply, nil) + const t = "NATS/1.0\r\n%s: %d\r\n%s: %d\r\n\r\n" + hdr := fmt.Appendf(nil, t, JSLastConsumerSeq, dseq, JSLastStreamSeq, sseq) + mset.outq.send(newJSPubMsg(m.rply, _EMPTY_, _EMPTY_, hdr, nil, nil, 0)) } } @@ -3888,9 +4290,10 @@ func (mset *stream) processInboundSourceMsg(si *sourceInfo, m *inMsg) bool { } isControl := m.isControlMsg() + cname := consumerFromAckReply(m.rply) // Ignore from old subscriptions. - if !si.isCurrentSub(m.rply) && !isControl { + if !si.isCurrentSub(cname) && !isControl { mset.mu.Unlock() return false } @@ -3900,13 +4303,13 @@ func (mset *stream) processInboundSourceMsg(si *sourceInfo, m *inMsg) bool { var needsRetry bool // Flow controls have reply subjects. if m.rply != _EMPTY_ { - mset.handleFlowControl(m) + mset.handleFlowControl(m, si.dseq, si.sseq) } else { // For idle heartbeats make sure we did not miss anything. - if ldseq := parseInt64(getHeader(JSLastConsumerSeq, m.hdr)); ldseq > 0 && uint64(ldseq) != si.dseq { + if ldseq := parseInt64(sliceHeader(JSLastConsumerSeq, m.hdr)); ldseq > 0 && uint64(ldseq) != si.dseq { needsRetry = true mset.retrySourceConsumerAtSeq(si.iname, si.sseq+1) - } else if fcReply := getHeader(JSConsumerStalled, m.hdr); len(fcReply) > 0 { + } else if fcReply := sliceHeader(JSConsumerStalled, m.hdr); len(fcReply) > 0 { // Other side thinks we are stalled, so send flow control reply. mset.outq.sendMsg(string(fcReply), nil) } @@ -3915,7 +4318,7 @@ func (mset *stream) processInboundSourceMsg(si *sourceInfo, m *inMsg) bool { return !needsRetry } - sseq, dseq, dc, _, pending := replyInfo(m.rply) + sseq, dseq, dc, _, pending := ackReplyInfo(m.rply) if dc > 1 { mset.mu.Unlock() @@ -3923,12 +4326,21 @@ func (mset *stream) processInboundSourceMsg(si *sourceInfo, m *inMsg) bool { } // Tracking is done here. - if dseq == si.dseq+1 { + osseq, odseq := si.sseq, si.dseq + if sseq <= si.sseq { + // Ignore older messages. + // If the deliver sequence matches, we only update delivered accounting. + if dseq == si.dseq+1 { + si.dseq++ + } + mset.mu.Unlock() + return true + } else if dseq == si.dseq+1 { si.dseq++ si.sseq = sseq } else if dseq > si.dseq { if si.cname == _EMPTY_ { - si.cname = tokenAt(m.rply, 4) + si.cname = cname si.dseq, si.sseq = dseq, sseq } else { mset.retrySourceConsumerAtSeq(si.iname, si.sseq+1) @@ -3995,34 +4407,27 @@ func (mset *stream) processInboundSourceMsg(si *sourceInfo, m *inMsg) bool { // Can happen temporarily all the time during normal operations when the sourcing stream is discard new // (example use case is for sourcing into a work queue) // TODO - Maybe improve sourcing to WQ with limit and new to use flow control rather than re-creating the consumer. - if errors.Is(err, ErrMaxMsgs) || errors.Is(err, ErrMaxBytes) || errors.Is(err, ErrMaxMsgsPerSubject) { - // Do not need to do a full retry that includes finding the last sequence in the stream - // for that source. Just re-create starting with the seq we couldn't store instead. - mset.mu.Lock() - mset.retrySourceConsumerAtSeq(iName, si.sseq) - mset.mu.Unlock() - } else { - // Log some warning for errors other than errLastSeqMismatch. - if !errors.Is(err, errLastSeqMismatch) && !errors.Is(err, errMsgIdDuplicate) { - s.RateLimitWarnf("Error processing inbound source %q for '%s' > '%s': %v", - iName, accName, sname, err) - } - // Retry in all type of errors we do not want to skip if we are still leader. - if mset.isLeader() { - if !errors.Is(err, errMsgIdDuplicate) { - // This will make sure the source is still in mset.sources map, - // find the last sequence and then call setupSourceConsumer. - iNameMap := map[string]struct{}{iName: {}} - mset.setStartingSequenceForSources(iNameMap) - mset.mu.Lock() - mset.retrySourceConsumerAtSeq(iName, si.sseq+1) - mset.mu.Unlock() - } else { - // skipping the message but keep processing the rest of the batch - return true - } - } + discardNew := errors.Is(err, ErrMaxMsgs) || errors.Is(err, ErrMaxBytes) || errors.Is(err, ErrMaxMsgsPerSubject) + + // Log some warning for errors. + if !discardNew && !errors.Is(err, errLastSeqMismatch) && !errors.Is(err, errMsgIdDuplicate) { + s.RateLimitWarnf("Error processing inbound source %q for '%s' > '%s': %v", + iName, accName, sname, err) } + + // Duplicates can be skipped, continue to the next message. + if errors.Is(err, errMsgIdDuplicate) { + return true + } + + // Do not need to do a full retry that includes finding the last sequence in the stream + // for that source. Just re-create starting with the seq we couldn't store instead. + // Especially if we're replicated, we could have inflight proposals that will not be in our store yet. + mset.mu.Lock() + si.dseq = odseq + si.sseq = osseq + mset.retrySourceConsumerAtSeq(iName, sseq) + mset.mu.Unlock() } return false } @@ -4038,7 +4443,7 @@ func (si *sourceInfo) genSourceHeader(orig, reply string) string { b.WriteString(iNameParts[0]) b.WriteByte(' ') // Grab sequence as text here from reply subject. - var tsa [expectedNumReplyTokens]string + var tsa [expectedNumReplyTokensV2]string start, tokens := 0, tsa[:0] for i := 0; i < len(reply); i++ { if reply[i] == btsep { @@ -4047,8 +4452,12 @@ func (si *sourceInfo) genSourceHeader(orig, reply string) string { } tokens = append(tokens, reply[start:]) seq := "1" // Default - if len(tokens) == expectedNumReplyTokens && tokens[0] == "$JS" && tokens[1] == "ACK" { - seq = tokens[5] + if tokens[0] == "$JS" && tokens[1] == "ACK" { + if len(tokens) == expectedNumReplyTokensV1 { + seq = tokens[5] + } else if len(tokens) >= expectedNumReplyTokensV2 { + seq = tokens[7] + } } b.WriteString(seq) @@ -4063,7 +4472,7 @@ func (si *sourceInfo) genSourceHeader(orig, reply string) string { // Original version of header that stored ack reply direct. func streamAndSeqFromAckReply(reply string) (string, string, uint64) { - tsa := [expectedNumReplyTokens]string{} + tsa := [expectedNumReplyTokensV2]string{} start, tokens := 0, tsa[:0] for i := 0; i < len(reply); i++ { if reply[i] == btsep { @@ -4071,10 +4480,33 @@ func streamAndSeqFromAckReply(reply string) (string, string, uint64) { } } tokens = append(tokens, reply[start:]) - if len(tokens) != expectedNumReplyTokens || tokens[0] != "$JS" || tokens[1] != "ACK" { + if (len(tokens) != expectedNumReplyTokensV1 && len(tokens) < expectedNumReplyTokensV2) || tokens[0] != "$JS" || tokens[1] != "ACK" { return _EMPTY_, _EMPTY_, 0 } - return tokens[2], _EMPTY_, uint64(parseAckReplyNum(tokens[5])) + offset := 2 + if len(tokens) >= expectedNumReplyTokensV2 { + offset = 4 + } + return tokens[offset], _EMPTY_, uint64(parseAckReplyNum(tokens[offset+3])) +} + +func consumerFromAckReply(reply string) string { + tsa := [expectedNumReplyTokensV2]string{} + start, tokens := 0, tsa[:0] + for i := 0; i < len(reply); i++ { + if reply[i] == btsep { + tokens, start = append(tokens, reply[start:i]), i+1 + } + } + tokens = append(tokens, reply[start:]) + if (len(tokens) != expectedNumReplyTokensV1 && len(tokens) < expectedNumReplyTokensV2) || tokens[0] != "$JS" || tokens[1] != "ACK" { + return _EMPTY_ + } + offset := 3 + if len(tokens) >= expectedNumReplyTokensV2 { + offset = 5 + } + return tokens[offset] } // Extract the stream name, the source index name and the message sequence number from the source header. @@ -4535,9 +4967,21 @@ func (mset *stream) unsubscribeToStream(stopping, shuttingDown bool) error { if len(mset.sources) > 0 { mset.stopSourceConsumers() + mset.sources = nil } // Clear batching state. - mset.deleteInflightBatches(shuttingDown) + mset.deleteAtomicBatches(shuttingDown) + if stopping || shuttingDown { + mset.deleteFastBatches() + } + if mset.batches != nil { + mset.batches.mu.Lock() + reset := len(mset.batches.atomic) == 0 && len(mset.batches.fast) == 0 + mset.batches.mu.Unlock() + if reset { + mset.batches = nil + } + } if stopping { // In case we had a direct get subscriptions. @@ -4556,10 +5000,10 @@ func (mset *stream) unsubscribeToStream(stopping, shuttingDown bool) error { } // Lock should be held. -func (mset *stream) deleteInflightBatches(shuttingDown bool) { +func (mset *stream) deleteAtomicBatches(shuttingDown bool) { if mset.batches != nil { mset.batches.mu.Lock() - for batchId, b := range mset.batches.group { + for batchId, b := range mset.batches.atomic { // If shutting down, do fixup during startup. In-memory batches don't require manual cleanup. if shuttingDown { b.stopLocked() @@ -4567,8 +5011,8 @@ func (mset *stream) deleteInflightBatches(shuttingDown bool) { b.cleanupLocked(batchId, mset.batches) } } + mset.batches.atomic = nil mset.batches.mu.Unlock() - mset.batches = nil } } @@ -4583,6 +5027,18 @@ func (mset *stream) deleteBatchApplyState() { } } +// Lock should be held. +func (mset *stream) deleteFastBatches() { + if mset.batches != nil { + mset.batches.mu.Lock() + for batchId, b := range mset.batches.fast { + b.cleanupLocked(batchId, mset.batches) + } + mset.batches.fast = nil + mset.batches.mu.Unlock() + } +} + // Lock does NOT need to be held, we set the client on setup and never change it at this point. func (mset *stream) subscribeInternal(subject string, cb msgHandler) (*subscription, error) { if mset.closed.Load() { @@ -4636,7 +5092,6 @@ func (mset *stream) unsubscribeInternal(subject string) error { return nil } -// Lock should be held. func (mset *stream) unsubscribe(sub *subscription) { if sub == nil || mset.closed.Load() { return @@ -4688,10 +5143,10 @@ func (mset *stream) setupStore(fsCfg *FileStoreConfig) error { mset.store.RegisterProcessJetStreamMsg(func(im *inMsg) { if mset.IsClustered() { if mset.IsLeader() { - mset.processClusteredInboundMsg(im.subj, im.rply, im.hdr, im.msg, im.mt, false) + mset.processClusteredInboundMsg(im.subj, im.rply, im.hdr, im.msg, im.mt, true) } } else { - mset.processJetStreamMsg(im.subj, im.rply, im.hdr, im.msg, 0, 0, im.mt, false, true) + mset.processJetStreamMsg(im.subj, im.rply, im.hdr, im.msg, 0, 0, im.mt, true, true) } }) mset.mu.Unlock() @@ -4807,6 +5262,11 @@ func (mset *stream) storeMsgId(dde *ddentry) { // storeMsgIdLocked will store the message id for duplicate detection. // mset.ddMu lock should be held. func (mset *stream) storeMsgIdLocked(dde *ddentry) { + // Zero means disabled. + if mset.cfg.Duplicates <= 0 { + return + } + if mset.ddmap == nil { mset.ddmap = make(map[string]*ddentry) } @@ -4913,19 +5373,46 @@ func getMessageIncr(hdr []byte) (*big.Int, bool) { } // Fast lookup of message schedule. -func getMessageSchedule(hdr []byte) (time.Time, bool) { +func getMessageSchedule(hdr []byte) (time.Time, *ApiError) { if len(hdr) == 0 { - return time.Time{}, true + return time.Time{}, nil + } + return nextMessageSchedule(hdr, time.Now().UTC().UnixNano()) +} + +// Fast lookup and calculation of next message schedule. +func nextMessageSchedule(hdr []byte, ts int64) (time.Time, *ApiError) { + if len(hdr) == 0 { + return time.Time{}, nil + } + loc, apiErr := loadMessageScheduleLocation(hdr) + if apiErr != nil { + return time.Time{}, apiErr } val := bytesToString(sliceHeader(JSSchedulePattern, hdr)) - if val == _EMPTY_ { - return time.Time{}, true + schedule, _, ok := parseMsgSchedule(val, loc, ts) + if !ok { + return time.Time{}, NewJSMessageSchedulesPatternInvalidError() } - if !strings.HasPrefix(val, "@at ") { - return time.Time{}, false + return schedule, nil +} + +// loadMessageScheduleLocation returns the *time.Location for the schedule's +// time zone header. Returns nil loc when the header is absent. A header that +// is present but empty or names an unknown zone yields a TimeZoneInvalid error. +func loadMessageScheduleLocation(hdr []byte) (*time.Location, *ApiError) { + tz := sliceHeader(JSScheduleTimeZone, hdr) + if tz == nil { + return nil, nil } - t, err := time.Parse(time.RFC3339, val[4:]) - return t, err == nil + if len(tz) == 0 { + return nil, NewJSMessageSchedulesTimeZoneInvalidError() + } + loc, err := time.LoadLocation(bytesToString(tz)) + if err != nil { + return nil, NewJSMessageSchedulesTimeZoneInvalidError() + } + return loc, nil } // Fast lookup of the message schedule TTL from headers. @@ -4941,6 +5428,11 @@ func getMessageScheduleTTL(hdr []byte) (string, bool) { return string(ttl), true } +// Fast lookup of the message schedule rollup from headers. +func getMessageScheduleRollup(hdr []byte) string { + return string(sliceHeader(JSScheduleRollup, hdr)) +} + // Fast lookup of message schedule target. func getMessageScheduleTarget(hdr []byte) string { if len(hdr) == 0 { @@ -4949,6 +5441,14 @@ func getMessageScheduleTarget(hdr []byte) string { return string(getHeader(JSScheduleTarget, hdr)) } +// Fast lookup of message schedule source. +func getMessageScheduleSource(hdr []byte) string { + if len(hdr) == 0 { + return _EMPTY_ + } + return string(getHeader(JSScheduleSource, hdr)) +} + // Fast lookup of message scheduler. func getMessageScheduler(hdr []byte) string { if len(hdr) == 0 { @@ -4962,7 +5462,149 @@ func getBatchId(hdr []byte) string { if len(hdr) == 0 { return _EMPTY_ } - return string(getHeader(JSBatchId, hdr)) + if atomicBatchId := sliceHeader(JSBatchId, hdr); atomicBatchId != nil { + return string(atomicBatchId) + } + return _EMPTY_ +} + +type FastBatch struct { + id string + seq uint64 + flow uint16 + ping bool + gapOk bool + commit bool + commitEob bool +} + +const ( + FastBatchSuffix = ".$FI" + FastBatchGapFail = "fail" + FastBatchGapOk = "ok" +) + +const ( + FastBatchOpStart = iota + FastBatchOpAppend + FastBatchOpCommit + FastBatchOpCommitEob + FastBatchOpPing +) + +var fastBatchPool sync.Pool + +func getFastBatchFromPool() *FastBatch { + idx := fastBatchPool.Get() + if idx != nil { + return idx.(*FastBatch) + } + return new(FastBatch) +} + +func (b *FastBatch) returnToPool() { + if b == nil { + return + } + // Nil out all values. + *b = FastBatch{} + fastBatchPool.Put(b) +} + +// getFastBatch gets fast batch info from the reply subject in the form: +// ......$FI +func getFastBatch(reply string, hdr []byte) (*FastBatch, bool) { + lreply := len(reply) + if lreply <= 4 || reply[lreply-4:] != FastBatchSuffix { + if !isServiceReply(stringToBytes(reply)) { + return nil, false + } + // If account imports/exports are used, the reply might be internal. + // Check the client header for the original reply subject. + ci := sliceHeader(ClientInfoHdr, hdr) + if ci == nil { + return nil, false + } + var cis ClientInfo + if err := json.Unmarshal(ci, &cis); err != nil || cis.Reply == _EMPTY_ { + return nil, false + } + reply = cis.Reply + lreply = len(reply) + if lreply <= 4 || reply[lreply-4:] != FastBatchSuffix { + return nil, false + } + } + + n := lreply - 4 // Move to just before the dot + o := strings.LastIndexByte(reply[:n], '.') + if o == -1 { + return nil, true + } + // Batch operation. + ops := reply[o+1 : n] + op := parseInt64(stringToBytes(ops)) + if op < FastBatchOpStart || op > FastBatchOpPing { + return nil, true + } + + b := getFastBatchFromPool() + b.ping = op == FastBatchOpPing + b.commitEob = op == FastBatchOpCommitEob + b.commit = b.commitEob || op == FastBatchOpCommit + p := o + + // Batch seq. + if o = strings.LastIndexByte(reply[:o], '.'); o == -1 { + return nil, true + } + a := parseInt64(stringToBytes(reply[o+1 : p])) + if a < 1 { + return nil, true + } + b.seq = uint64(a) + p = o + if b.seq <= 0 { + return nil, true + } else if b.seq == 1 && b.commitEob { + return nil, true + } + if op == FastBatchOpStart && b.seq != 1 { + return nil, true + } else if op == FastBatchOpAppend && b.seq <= 1 { + return nil, true + } + + // Gap mode. + if o = strings.LastIndexByte(reply[:o], '.'); o == -1 { + return nil, true + } + gapMode := reply[o+1 : p] + if gapMode != FastBatchGapFail && gapMode != FastBatchGapOk { + return nil, true // Not recognized. + } + b.gapOk = gapMode == FastBatchGapOk + p = o + + // Ack flow. + if o = strings.LastIndexByte(reply[:o], '.'); o == -1 { + return nil, true + } + a = parseInt64(stringToBytes(reply[o+1 : p])) + if a <= 0 { + a = 10 + } else if a > math.MaxUint16 { + a = math.MaxUint16 + } + b.flow = uint16(a) + p = o + + // Batch id. + if o = strings.LastIndexByte(reply[:o], '.'); o == -1 { + return nil, true + } + b.id = reply[o+1 : p] + return b, false } // Fast lookup of batch sequence. @@ -5421,7 +6063,7 @@ func (mset *stream) processInboundJetStreamMsg(_ *subscription, c *client, _ *Ac // to prevent a trace event to be generated when a stored message // is delivered to a consumer and routed. if !traceOnly { - disableTraceHeaders(c, hdr) + hdr = setHeader(MsgTraceDest, MsgTraceDestDisabled, hdr) } // This will add the jetstream event while in the client read loop. // Since the event will be updated in a different go routine, the @@ -5442,7 +6084,11 @@ var ( ) // processJetStreamMsg is where we try to actually process the stream msg. -func (mset *stream) processJetStreamMsg(subject, reply string, hdr, msg []byte, lseq uint64, ts int64, mt *msgTrace, sourced bool, needLock bool) (retErr error) { +func (mset *stream) processJetStreamMsg(subject, reply string, hdr, msg []byte, lseq uint64, ts int64, mt *msgTrace, sourced bool, needLock bool) error { + return mset.processJetStreamMsgWithBatch(subject, reply, hdr, msg, lseq, ts, mt, sourced, needLock, nil) +} + +func (mset *stream) processJetStreamMsgWithBatch(subject, reply string, hdr, msg []byte, lseq uint64, ts int64, mt *msgTrace, sourced bool, needLock bool, fastBatch *FastBatch) (retErr error) { if mt != nil { // Only the leader/standalone will have mt!=nil. On exit, send the // message trace event. @@ -5495,19 +6141,35 @@ func (mset *stream) processJetStreamMsg(subject, reply string, hdr, msg []byte, numConsumers := len(mset.consumers) interestRetention := mset.cfg.Retention == InterestPolicy allowMsgCounter, allowMsgSchedules := mset.cfg.AllowMsgCounter, mset.cfg.AllowMsgSchedules + allowRollupPurge := mset.cfg.AllowRollup && !mset.cfg.DenyPurge // Snapshot if we are the leader and if we can respond. isLeader, isSealed := mset.isLeaderNodeState(), mset.cfg.Sealed - isClustered := mset.isClustered() + isClustered, isMirror := mset.isClustered(), mset.cfg.Mirror != nil canConsistencyCheck := !isClustered || traceOnly canRespond := doAck && len(reply) > 0 && isLeader outq := mset.outq var resp = &JSPubAckResponse{} - var batchId string - var batchSeq uint64 - if len(hdr) > 0 { - // Populate batch details. + var ( + batchId string + batchSeq uint64 + ) + // Populate batch details. + if fastBatch != nil { + // For R1 we can reuse without regenerating. + batchId, batchSeq = fastBatch.id, fastBatch.seq + // Disable consistency checking if this was already done + // earlier as part of the batch consistency check. + canConsistencyCheck = traceOnly + } else if fastBatch, _ = getFastBatch(reply, hdr); fastBatch != nil { + defer fastBatch.returnToPool() + batchId, batchSeq = fastBatch.id, fastBatch.seq + // Disable consistency checking if this was already done + // earlier as part of the batch consistency check. + canConsistencyCheck = traceOnly + } + if len(hdr) > 0 && batchId == _EMPTY_ { if batchId = getBatchId(hdr); batchId != _EMPTY_ { batchSeq, _ = getBatchSequence(hdr) // Disable consistency checking if this was already done @@ -5543,11 +6205,13 @@ func (mset *stream) processJetStreamMsg(subject, reply string, hdr, msg []byte, isMisMatch := true // We may be able to recover here if we have no state whatsoever, or we are a mirror. // See if we have to adjust our starting sequence. - if mset.lseq == 0 || mset.cfg.Mirror != nil { + if mset.lseq == 0 || isMirror { var state StreamState mset.store.FastState(&state) if state.FirstSeq == 0 { - mset.store.Compact(lseq + 1) + if _, err := mset.store.Compact(lseq + 1); err != nil { + return err + } mset.lseq = lseq isMisMatch = false } @@ -5715,8 +6379,9 @@ func (mset *stream) processJetStreamMsg(subject, reply string, hdr, msg []byte, } // Message scheduling. - if schedule, ok := getMessageSchedule(hdr); !ok { - apiErr := NewJSMessageSchedulesPatternInvalidError() + if sourced { + // noop, sourced messages were already validated by the origin stream. + } else if schedule, apiErr := getMessageSchedule(hdr); apiErr != nil { if !allowMsgSchedules { apiErr = NewJSMessageSchedulesDisabledError() } @@ -5746,6 +6411,15 @@ func (mset *stream) processJetStreamMsg(subject, reply string, hdr, msg []byte, outq.sendMsg(reply, b) } return apiErr + } else if scheduleRollup := getMessageScheduleRollup(hdr); scheduleRollup != _EMPTY_ && scheduleRollup != JSMsgRollupSubject { + apiErr := NewJSMessageSchedulesRollupInvalidError() + if canRespond { + resp.PubAck = &PubAck{Stream: name} + resp.Error = apiErr + b, _ := json.Marshal(resp) + outq.sendMsg(reply, b) + } + return apiErr } else if scheduleTtl != _EMPTY_ && !mset.cfg.AllowMsgTTL { if canRespond { resp.PubAck = &PubAck{Stream: name} @@ -5755,7 +6429,7 @@ func (mset *stream) processJetStreamMsg(subject, reply string, hdr, msg []byte, } return errMsgTTLDisabled } else if scheduleTarget := getMessageScheduleTarget(hdr); scheduleTarget == _EMPTY_ || - !IsValidPublishSubject(scheduleTarget) || SubjectsCollide(scheduleTarget, subject) { + !IsValidPublishSubject(scheduleTarget) || scheduleTarget == subject { apiErr := NewJSMessageSchedulesTargetInvalidError() if canRespond { resp.PubAck = &PubAck{Stream: name} @@ -5764,6 +6438,16 @@ func (mset *stream) processJetStreamMsg(subject, reply string, hdr, msg []byte, outq.sendMsg(reply, b) } return apiErr + } else if scheduleSource := getMessageScheduleSource(hdr); scheduleSource != _EMPTY_ && + (scheduleSource == scheduleTarget || scheduleSource == subject || !IsValidPublishSubject(scheduleSource)) { + apiErr := NewJSMessageSchedulesSourceInvalidError() + if canRespond { + resp.PubAck = &PubAck{Stream: name} + resp.Error = apiErr + b, _ := json.Marshal(resp) + outq.sendMsg(reply, b) + } + return apiErr } else { match := slices.ContainsFunc(mset.cfg.Subjects, func(subj string) bool { return SubjectsCollide(subj, scheduleTarget) @@ -5778,6 +6462,21 @@ func (mset *stream) processJetStreamMsg(subject, reply string, hdr, msg []byte, } return apiErr } + if scheduleSource != _EMPTY_ { + match = slices.ContainsFunc(mset.cfg.Subjects, func(subj string) bool { + return SubjectsCollide(subj, scheduleSource) + }) + if !match { + apiErr := NewJSMessageSchedulesSourceInvalidError() + if canRespond { + resp.PubAck = &PubAck{Stream: name} + resp.Error = apiErr + b, _ := json.Marshal(resp) + outq.sendMsg(reply, b) + } + return apiErr + } + } // Add a rollup sub header if it doesn't already exist. // Otherwise, it must exist already as a rollup on the subject. @@ -5795,13 +6494,60 @@ func (mset *stream) processJetStreamMsg(subject, reply string, hdr, msg []byte, } } } + if scheduleNext := sliceHeader(JSScheduleNext, hdr); len(scheduleNext) > 0 && !sourced { + // Clients may only use Nats-Schedule-Next to purge a schedule. + if bytesToString(scheduleNext) != JSScheduleNextPurge { + apiErr := NewJSMessageSchedulesSchedulerInvalidError() + if canRespond { + resp.PubAck = &PubAck{Stream: name} + resp.Error = apiErr + b, _ := json.Marshal(resp) + outq.sendMsg(reply, b) + } + return apiErr + } + // Nats-Scheduler must accompany the purge and: + // - it must NOT be empty. + // - it must NOT match the publish subject. + if scheduler := sliceHeader(JSScheduler, hdr); len(scheduler) == 0 || + bytesToString(scheduler) == subject || !IsValidPublishSubject(bytesToString(scheduler)) { + apiErr := NewJSMessageSchedulesSchedulerInvalidError() + if canRespond { + resp.PubAck = &PubAck{Stream: name} + resp.Error = apiErr + b, _ := json.Marshal(resp) + outq.sendMsg(reply, b) + } + return apiErr + } else if !allowMsgSchedules { + apiErr := NewJSMessageSchedulesDisabledError() + if canRespond { + resp.PubAck = &PubAck{Stream: name} + resp.Error = apiErr + b, _ := json.Marshal(resp) + outq.sendMsg(reply, b) + } + return apiErr + } + } else if !sourced && len(sliceHeader(JSScheduler, hdr)) > 0 { + // Clients may only use Nats-Scheduler alongside Nats-Schedule-Next. + apiErr := NewJSMessageSchedulesSchedulerInvalidError() + if canRespond { + resp.PubAck = &PubAck{Stream: name} + resp.Error = apiErr + b, _ := json.Marshal(resp) + outq.sendMsg(reply, b) + } + return apiErr + } } // Dedupe detection. This is done at the cluster level for dedupe detection above the // lower layers. But we still need to pull out the msgId. if msgId = getMsgId(hdr); msgId != _EMPTY_ { // Do real check only if not clustered or traceOnly flag is set. - if canConsistencyCheck { + // If we're mirroring we can't deduplicate on our own. + if canConsistencyCheck && !isMirror { var seq uint64 mset.ddMu.Lock() dde := mset.checkMsgId(msgId) @@ -5836,7 +6582,7 @@ func (mset *stream) processJetStreamMsg(subject, reply string, hdr, msg []byte, } // Check for any rollups. if rollup := getRollup(hdr); rollup != _EMPTY_ { - if canConsistencyCheck && (!mset.cfg.AllowRollup || mset.cfg.DenyPurge) { + if canConsistencyCheck && !allowRollupPurge && !sourced { err := errors.New("rollup not permitted") if canRespond { resp.PubAck = &PubAck{Stream: name} @@ -6058,6 +6804,26 @@ func (mset *stream) processJetStreamMsg(subject, reply string, hdr, msg []byte, if msgId != _EMPTY_ { mset.storeMsgId(&ddentry{msgId, mset.lseq, ts}) } + if allowRollupPurge { + if err = mset.processJetStreamMsgWithRollup(subject, rollupSub, rollupAll, hdr, 0); err != nil { + return err + } + } + // If using fast batch publish, we occasionally send flow control messages. + // And, we need to ensure a PubAck is sent if the commit happens through EOB. + if fastBatch != nil { + if mset.batches == nil { + mset.batches = &batching{} + } + mset.batches.mu.Lock() + // Check full leader state so we only send the client an update once we're caught up. + commit := mset.batches.fastBatchRegisterSequences(mset, reply, mset.lseq, mset.isLeader(), fastBatch) + mset.batches.mu.Unlock() + if !commit { + reply = _EMPTY_ + canRespond = false + } + } if canRespond { response = append(pubAck, strconv.FormatUint(mset.lseq, 10)...) if batchId != _EMPTY_ { @@ -6137,11 +6903,7 @@ func (mset *stream) processJetStreamMsg(subject, reply string, hdr, msg []byte, } else { // Make sure to take into account any message assignments that we had to skip (clfs). seq = lseq + 1 - clfs - // Check for preAcks and the need to clear it. - if mset.hasAllPreAcks(seq, subject) { - mset.clearAllPreAcks(seq) - } - err = store.StoreRawMsg(subject, hdr, msg, seq, ts, ttl) + err = store.StoreRawMsg(subject, hdr, msg, seq, ts, ttl, canConsistencyCheck) } if err != nil { @@ -6152,17 +6914,22 @@ func (mset *stream) processJetStreamMsg(subject, reply string, hdr, msg []byte, mset.srv.Warnf("Filesystem permission denied while writing msg, disabling JetStream: %v", err) return err } - // If we did not succeed increment clfs in case we are clustered. - bumpCLFS() switch err { case ErrMaxMsgs, ErrMaxBytes, ErrMaxMsgsPerSubject, ErrMsgTooLarge: s.RateLimitDebugf("JetStream failed to store a msg on stream '%s > %s': %v", accName, name, err) case ErrStoreClosed: default: - s.Errorf("JetStream failed to store a msg on stream '%s > %s': %v", accName, name, err) + // We don't want to respond back to the user, and definitely not up CLFS either. + // This was likely an IO issue, so only log and return the error. This will stop + // the stream if it was replicated. + s.RateLimitErrorf("JetStream failed to store a msg on stream '%s > %s': %v", accName, name, err) + mset.setWriteErrLocked(err) + return err } + // If we did not succeed increment clfs in case we are clustered. + bumpCLFS() if canRespond { resp.PubAck = &PubAck{Stream: name} resp.Error = NewJSStreamStoreFailedError(err, Unless(err)) @@ -6172,6 +6939,18 @@ func (mset *stream) processJetStreamMsg(subject, reply string, hdr, msg []byte, return err } + // Check for preAcks and the need to clear it. + if mset.hasAllPreAcks(seq, subject) { + mset.clearAllPreAcks(seq) + // If we're clustered and the stream leader, we can now propose deleting this message. + // We still store it below, so we remain properly synchronized with our followers. + // If this proposal fails, we retry out-of-band. + if isClustered && isLeader { + md := streamMsgDelete{Seq: seq, NoErase: true, Stream: mset.cfg.Name} + _ = mset.node.Propose(encodeMsgDelete(&md)) + } + } + // If here we succeeded in storing the message. mset.lmsgId = msgId mset.lseq = seq @@ -6194,15 +6973,9 @@ func (mset *stream) processJetStreamMsg(subject, reply string, hdr, msg []byte, } // No errors, this is the normal path. - if rollupSub { - mset.purgeLocked(&JSApiStreamPurgeRequest{Subject: subject, Keep: 1}, false) - } else if rollupAll { - mset.purgeLocked(&JSApiStreamPurgeRequest{Keep: 1}, false) - } else if scheduleNext := sliceHeader(JSScheduleNext, hdr); len(scheduleNext) > 0 && bytesToString(scheduleNext) == JSScheduleNextPurge { - // Purge the message schedule. - scheduler := getMessageScheduler(hdr) - if scheduler != _EMPTY_ { - mset.purgeLocked(&JSApiStreamPurgeRequest{Subject: scheduler}, false) + if allowRollupPurge { + if err = mset.processJetStreamMsgWithRollup(subject, rollupSub, rollupAll, hdr, 1); err != nil { + return err } } @@ -6235,6 +7008,22 @@ func (mset *stream) processJetStreamMsg(subject, reply string, hdr, msg []byte, outq.send(newJSPubMsg(tsubj, _EMPTY_, _EMPTY_, hdr, rpMsg, nil, seq)) } + // If using fast batch publish, we occasionally send flow control messages. + // And, we need to ensure a PubAck is sent if the commit happens through EOB. + if fastBatch != nil { + if mset.batches == nil { + mset.batches = &batching{} + } + mset.batches.mu.Lock() + // Check full leader state so we only send the client an update once we're caught up. + commit := mset.batches.fastBatchRegisterSequences(mset, reply, mset.lseq, mset.isLeader(), fastBatch) + mset.batches.mu.Unlock() + if !commit { + reply = _EMPTY_ + canRespond = false + } + } + // Send response here. if canRespond { response = append(pubAck, strconv.FormatUint(seq, 10)...) @@ -6262,17 +7051,37 @@ func (mset *stream) processJetStreamMsg(subject, reply string, hdr, msg []byte, return nil } -// processJetStreamBatchMsg processes a JetStream message that's part of an atomic batch publish. -// Handles constraints around the batch, storing messages, doing consistency checks, and performing the commit. -func (mset *stream) processJetStreamBatchMsg(batchId, subject, reply string, hdr, msg []byte, mt *msgTrace) (retErr error) { - // For possible error response. - var response []byte +// Lock should be held. +func (mset *stream) processJetStreamMsgWithRollup(subject string, rollupSub, rollupAll bool, hdr []byte, keep uint64) error { + if rollupSub { + if _, err := mset.purgeLocked(&JSApiStreamPurgeRequest{Subject: subject, Keep: keep}, false); err != nil { + return err + } + } else if rollupAll { + if _, err := mset.purgeLocked(&JSApiStreamPurgeRequest{Keep: keep}, false); err != nil { + return err + } + } + if scheduleNext := sliceHeader(JSScheduleNext, hdr); len(scheduleNext) > 0 && bytesToString(scheduleNext) == JSScheduleNextPurge { + // Purge the message schedule. + scheduler := getMessageScheduler(hdr) + if scheduler != _EMPTY_ { + if _, err := mset.purgeLocked(&JSApiStreamPurgeRequest{Subject: scheduler}, false); err != nil { + return err + } + } + } + return nil +} +// processJetStreamAtomicBatchMsg processes a JetStream message that's part of an atomic batch publish. +// Handles constraints around the batch, storing messages, doing consistency checks, and performing the commit. +func (mset *stream) processJetStreamAtomicBatchMsg(batchId, subject, reply string, hdr, msg []byte, mt *msgTrace) (retErr error) { mset.mu.RLock() canRespond := !mset.cfg.NoAck && len(reply) > 0 name, stype := mset.cfg.Name, mset.cfg.Storage discard, discardNewPer, maxMsgs, maxMsgsPer, maxBytes := mset.cfg.Discard, mset.cfg.DiscardNewPer, mset.cfg.MaxMsgs, mset.cfg.MaxMsgsPer, mset.cfg.MaxBytes - s, js, jsa, st, r, tierName, outq, node := mset.srv, mset.js, mset.jsa, mset.cfg.Storage, mset.cfg.Replicas, mset.tier, mset.outq, mset.node + s, js, jsa, r, tierName, outq, node := mset.srv, mset.js, mset.jsa, mset.cfg.Replicas, mset.tier, mset.outq, mset.node maxMsgSize, lseq := int(mset.cfg.MaxMsgSize), mset.lseq isLeader, isClustered, isSealed, allowRollup, denyPurge, allowTTL, allowMsgCounter, allowMsgSchedules, allowAtomicPublish := mset.isLeader(), mset.isClustered(), mset.cfg.Sealed, mset.cfg.AllowRollup, mset.cfg.DenyPurge, mset.cfg.AllowMsgTTL, mset.cfg.AllowMsgCounter, mset.cfg.AllowMsgSchedules, mset.cfg.AllowAtomicPublish mset.mu.RUnlock() @@ -6294,41 +7103,36 @@ func (mset *stream) processJetStreamBatchMsg(batchId, subject, reply string, hdr return NewJSClusterNotLeaderError() } + respondError := func(apiErr *ApiError) error { + if canRespond { + buf, _ := json.Marshal(&JSPubAckResponse{PubAck: &PubAck{Stream: name}, Error: apiErr}) + outq.sendMsg(reply, buf) + } + return apiErr + } + // Bail here if sealed. if isSealed { - var resp = JSPubAckResponse{PubAck: &PubAck{Stream: mset.name()}, Error: NewJSStreamSealedError()} - b, _ := json.Marshal(resp) - mset.outq.sendMsg(reply, b) - return NewJSStreamSealedError() + return respondError(NewJSStreamSealedError()) } // Check here pre-emptively if we have exceeded this server limits. if js.limitsExceeded(stype) { s.resourcesExceededError(stype) - if canRespond { - b, _ := json.Marshal(&JSPubAckResponse{PubAck: &PubAck{Stream: name}, Error: NewJSInsufficientResourcesError()}) - outq.send(newJSPubMsg(reply, _EMPTY_, _EMPTY_, nil, b, nil, 0)) - } // Stepdown regardless. if node := mset.raftNode(); node != nil { node.StepDown() } - return NewJSInsufficientResourcesError() + return respondError(NewJSInsufficientResourcesError()) } // Check here pre-emptively if we have exceeded our account limits. - if exceeded, err := jsa.wouldExceedLimits(st, tierName, r, subject, hdr, msg); exceeded { + if exceeded, err := jsa.wouldExceedLimits(stype, tierName, r, subject, hdr, msg); exceeded { if err == nil { err = NewJSAccountResourcesExceededError() } s.RateLimitWarnf("JetStream account limits exceeded for '%s': %s", jsa.acc().GetName(), err.Error()) - if canRespond { - var resp = &JSPubAckResponse{PubAck: &PubAck{Stream: name}} - resp.Error = err - response, _ = json.Marshal(resp) - outq.send(newJSPubMsg(reply, _EMPTY_, _EMPTY_, nil, response, nil, 0)) - } - return err + return respondError(err) } // Check msgSize if we have a limit set there. Again this works if it goes through but better to be pre-emptive. @@ -6336,87 +7140,63 @@ func (mset *stream) processJetStreamBatchMsg(batchId, subject, reply string, hdr if maxMsgSize >= 0 && (len(hdr) > maxMsgSize || len(msg) > maxMsgSize-len(hdr)) { err := fmt.Errorf("JetStream message size exceeds limits for '%s > %s'", jsa.acc().Name, mset.cfg.Name) s.RateLimitWarnf("%s", err.Error()) - if canRespond { - var resp = &JSPubAckResponse{PubAck: &PubAck{Stream: name}} - resp.Error = NewJSStreamMessageExceedsMaximumError() - response, _ = json.Marshal(resp) - outq.send(newJSPubMsg(reply, _EMPTY_, _EMPTY_, nil, response, nil, 0)) - } + _ = respondError(NewJSStreamMessageExceedsMaximumError()) return err } if !allowAtomicPublish { - err := NewJSAtomicPublishDisabledError() - if canRespond { - b, _ := json.Marshal(&JSPubAckResponse{PubAck: &PubAck{Stream: name}, Error: err}) - outq.send(newJSPubMsg(reply, _EMPTY_, _EMPTY_, nil, b, nil, 0)) - } - return err + return respondError(NewJSAtomicPublishDisabledError()) } // Batch ID is too long. if len(batchId) > 64 { - err := NewJSAtomicPublishInvalidBatchIDError() - if canRespond { - b, _ := json.Marshal(&JSPubAckResponse{PubAck: &PubAck{Stream: name}, Error: err}) - outq.send(newJSPubMsg(reply, _EMPTY_, _EMPTY_, nil, b, nil, 0)) - } - return err + return respondError(NewJSAtomicPublishInvalidBatchIDError()) } batchSeq, exists := getBatchSequence(hdr) if !exists { - err := NewJSAtomicPublishMissingSeqError() - if canRespond { - b, _ := json.Marshal(&JSPubAckResponse{PubAck: &PubAck{Stream: name}, Error: err}) - outq.send(newJSPubMsg(reply, _EMPTY_, _EMPTY_, nil, b, nil, 0)) - } - return err + return respondError(NewJSAtomicPublishMissingSeqError()) } + jsa.mu.RLock() + storeDir := jsa.storeDir + jsa.mu.RUnlock() + mset.mu.Lock() if mset.batches == nil { - mset.batches = &batching{ - group: make(map[string]*batchGroup, 1), - } + mset.batches = &batching{} } batches := mset.batches - mset.mu.Unlock() + // Acquire the batches lock. + // Can't release the stream lock now, we need to keep holding it while we hold the batches lock. + // Re-acquiring the stream lock with the batches lock already held would be a lock inversion. + batches.mu.Lock() respondIncompleteBatch := func() error { - err := NewJSAtomicPublishIncompleteBatchError() - if canRespond { - buf, _ := json.Marshal(&JSPubAckResponse{PubAck: &PubAck{Stream: name}, Error: err}) - outq.send(newJSPubMsg(reply, _EMPTY_, _EMPTY_, nil, buf, nil, 0)) - } - return err + return respondError(NewJSAtomicPublishIncompleteBatchError()) } // Get batch. - batches.mu.Lock() - b, ok := batches.group[batchId] + b, ok := batches.atomic[batchId] if !ok { if batchSeq != 1 { batches.mu.Unlock() - maxBatchSize := streamMaxBatchSize + mset.mu.Unlock() + maxBatchSize := streamMaxAtomicBatchSize opts := s.getOpts() if opts.JetStreamLimits.MaxBatchSize > 0 { maxBatchSize = opts.JetStreamLimits.MaxBatchSize } if batchSeq > uint64(maxBatchSize) { err := NewJSAtomicPublishTooLargeBatchError(maxBatchSize) - if canRespond { - buf, _ := json.Marshal(&JSPubAckResponse{PubAck: &PubAck{Stream: name}, Error: err}) - outq.send(newJSPubMsg(reply, _EMPTY_, _EMPTY_, nil, buf, nil, 0)) - } - return err + return respondError(err) } return respondIncompleteBatch() } // Limits. - maxInflightPerStream := streamMaxBatchInflightPerStream - maxInflightTotal := streamMaxBatchInflightTotal + maxInflightPerStream := streamMaxAtomicBatchInflightPerStream + maxInflightTotal := streamMaxAtomicBatchInflightTotal opts := s.getOpts() if opts.JetStreamLimits.MaxBatchInflightPerStream > 0 { maxInflightPerStream = opts.JetStreamLimits.MaxBatchInflightPerStream @@ -6426,39 +7206,44 @@ func (mset *stream) processJetStreamBatchMsg(batchId, subject, reply string, hdr } // Confirm we can facilitate an additional batch. - if len(batches.group)+1 > maxInflightPerStream { + if len(batches.atomic)+1 > maxInflightPerStream { batches.mu.Unlock() - return respondIncompleteBatch() + mset.mu.Unlock() + return respondError(NewJSAtomicPublishTooManyInflightError()) } // Confirm we'll not exceed the server limit. - if globalInflightBatches.Add(1) > int32(maxInflightTotal) { - globalInflightBatches.Add(-1) + if globalInflightAtomicBatches.Add(1) > int64(maxInflightTotal) { + globalInflightAtomicBatches.Add(-1) batches.mu.Unlock() - return respondIncompleteBatch() + mset.mu.Unlock() + return respondError(NewJSAtomicPublishTooManyInflightError()) } var err error - if b, err = batches.newBatchGroup(mset, batchId); err != nil { - globalInflightBatches.Add(-1) + b, err = batches.newAtomicBatch(mset, batchId, r, stype, storeDir, name) + if err != nil { + globalInflightAtomicBatches.Add(-1) batches.mu.Unlock() + mset.mu.Unlock() return respondIncompleteBatch() } - batches.group[batchId] = b + if batches.atomic == nil { + batches.atomic = make(map[string]*atomicBatch, 1) + } + batches.atomic[batchId] = b } - var commit bool + var commit, commitEob bool if c := sliceHeader(JSBatchCommit, hdr); c != nil { + commitEob = bytes.Equal(c, []byte("eob")) // Reject the batch if the commit is not recognized. - if !bytes.Equal(c, []byte("1")) { + if !commitEob && !bytes.Equal(c, []byte("1")) { b.cleanupLocked(batchId, batches) batches.mu.Unlock() + mset.mu.Unlock() err := NewJSAtomicPublishInvalidBatchCommitError() - if canRespond { - b, _ := json.Marshal(&JSPubAckResponse{PubAck: &PubAck{Stream: name}, Error: err}) - outq.send(newJSPubMsg(reply, _EMPTY_, _EMPTY_, nil, b, nil, 0)) - } - return err + return respondError(err) } commit = true } @@ -6468,40 +7253,39 @@ func (mset *stream) processJetStreamBatchMsg(batchId, subject, reply string, hdr if errorOnRequiredApiLevel(hdr) { b.cleanupLocked(batchId, batches) batches.mu.Unlock() + mset.mu.Unlock() + mset.sendStreamBatchAbandonedAdvisory(batchId, BatchRequirementsNotMet) err := NewJSRequiredApiLevelError() - if canRespond { - b, _ := json.Marshal(&JSPubAckResponse{PubAck: &PubAck{Stream: name}, Error: err}) - outq.send(newJSPubMsg(reply, _EMPTY_, _EMPTY_, nil, b, nil, 0)) - } - return err + return respondError(err) } hdr = removeHeaderIfPresent(hdr, JSRequiredApiLevel) } + // If cleanup has already happened, we can't continue. + cleanup := !b.resetCleanupTimer(mset) + // Detect gaps. b.lseq++ - if b.lseq != batchSeq { + if b.lseq != batchSeq || cleanup || (batchSeq == 1 && commitEob) { b.cleanupLocked(batchId, batches) batches.mu.Unlock() + mset.mu.Unlock() mset.sendStreamBatchAbandonedAdvisory(batchId, BatchIncomplete) return respondIncompleteBatch() } // Confirm the batch doesn't exceed the allowed size. - maxSize := streamMaxBatchSize + maxSize := streamMaxAtomicBatchSize if maxBatchSize := s.getOpts().JetStreamLimits.MaxBatchSize; maxBatchSize > 0 { maxSize = maxBatchSize } if batchSeq > uint64(maxSize) { b.cleanupLocked(batchId, batches) batches.mu.Unlock() + mset.mu.Unlock() mset.sendStreamBatchAbandonedAdvisory(batchId, BatchLarge) err := NewJSAtomicPublishTooLargeBatchError(maxSize) - if canRespond { - buf, _ := json.Marshal(&JSPubAckResponse{PubAck: &PubAck{Stream: name}, Error: err}) - outq.send(newJSPubMsg(reply, _EMPTY_, _EMPTY_, nil, buf, nil, 0)) - } - return err + return respondError(err) } // Persist, but optimize if we're committing because we already know last. @@ -6511,24 +7295,27 @@ func (mset *stream) processJetStreamBatchMsg(batchId, subject, reply string, hdr if err != nil || seq != batchSeq { b.cleanupLocked(batchId, batches) batches.mu.Unlock() + mset.mu.Unlock() mset.sendStreamBatchAbandonedAdvisory(batchId, BatchIncomplete) return respondIncompleteBatch() } } if !commit { batches.mu.Unlock() + mset.mu.Unlock() // Send empty ack to let them know we've persisted the data prior to commit. if canRespond { - outq.send(newJSPubMsg(reply, _EMPTY_, _EMPTY_, nil, nil, nil, 0)) + outq.sendMsg(reply, nil) } return nil } // Ensure the batch is prepared for the commit and will not be cleaned up while committing. - if !b.readyForCommit() { + if abandonReason := b.readyForCommit(); abandonReason != nil { // Don't do cleanup, this is already done. batches.mu.Unlock() - mset.sendStreamBatchAbandonedAdvisory(batchId, BatchTimeout) + mset.mu.Unlock() + mset.sendStreamBatchAbandonedAdvisory(batchId, *abandonReason) return respondIncompleteBatch() } @@ -6547,45 +7334,26 @@ func (mset *stream) processJetStreamBatchMsg(batchId, subject, reply string, hdr // We only use mset.clseq for clustering and in case we run ahead of actual commits. // Check if we need to set initial value here if isClustered && (mset.clseq == 0 || mset.clseq < lseq+mset.clfs) { - // Need to unlock and re-acquire the locks in the proper order. - mset.clMu.Unlock() - // Locking order is stream -> batchMu -> clMu - mset.mu.RLock() - batch := mset.batchApply - var batchCount uint64 - if batch != nil { - batch.mu.Lock() - batchCount = batch.count - } - mset.clMu.Lock() - // Re-capture - lseq = mset.lseq - mset.clseq = lseq + mset.clfs + batchCount - // Keep hold of the mset.clMu, but unlock the others. - if batch != nil { - batch.mu.Unlock() - } - mset.mu.RUnlock() + lseq = recalculateClusteredSeq(mset, false) } - rollback := func(seq uint64) { + oclseq := mset.clseq + rollback := func() { if isClustered { // Only need to move the clustered sequence back if the batch fails to commit. // Other changes were staged but not applied, so this is the only thing we need to do. - mset.clseq -= seq - 1 + mset.clseq = oclseq } mset.clMu.Unlock() } - errorOnUnsupported := func(seq uint64, header string) *ApiError { + errorOnUnsupported := func(header string) *ApiError { apiErr := NewJSAtomicPublishUnsupportedHeaderBatchError(header) - rollback(seq) + rollback() b.cleanupLocked(batchId, batches) batches.mu.Unlock() - if canRespond { - buf, _ := json.Marshal(&JSPubAckResponse{PubAck: &PubAck{Stream: name}, Error: apiErr}) - outq.send(newJSPubMsg(reply, _EMPTY_, _EMPTY_, nil, buf, nil, 0)) - } + mset.mu.Unlock() + _ = respondError(apiErr) return apiErr } @@ -6601,32 +7369,46 @@ func (mset *stream) processJetStreamBatchMsg(batchId, subject, reply string, hdr sz int ) + // If the commit ends with an "End Of Batch" message, we don't store this. + if commitEob { + batchSeq-- + } + diff := &batchStagedDiff{} for seq := uint64(1); seq <= batchSeq; seq++ { - if seq == batchSeq && b.store.Type() != FileStorage { + if seq == batchSeq && !commitEob && b.store.Type() != FileStorage { bsubj, bhdr, bmsg = subject, hdr, msg } else if sm, err = b.store.LoadMsg(seq, &smv); sm != nil && err == nil { bsubj, bhdr, bmsg = sm.subj, sm.hdr, sm.msg } else { - rollback(seq) + rollback() b.cleanupLocked(batchId, batches) batches.mu.Unlock() + mset.mu.Unlock() return respondIncompleteBatch() } + // Apply the input subject transform if any + csubj := bsubj + if mset.itr != nil { + ts, err := mset.itr.Match(csubj) + if err == nil { + // no filtering: if the subject doesn't map the source of the transform, don't change it + csubj = ts + } + } + // Reject unsupported headers. if getExpectedLastMsgId(bhdr) != _EMPTY_ { - return errorOnUnsupported(seq, JSExpectedLastMsgId) + return errorOnUnsupported(JSExpectedLastMsgId) } - if bhdr, bmsg, _, apiErr, err = checkMsgHeadersPreClusteredProposal(diff, mset, bsubj, bhdr, bmsg, false, name, jsa, allowRollup, denyPurge, allowTTL, allowMsgCounter, allowMsgSchedules, discard, discardNewPer, maxMsgSize, maxMsgs, maxMsgsPer, maxBytes); err != nil { - rollback(seq) + if bhdr, bmsg, _, apiErr, err = checkMsgHeadersPreClusteredProposal(diff, mset, csubj, bsubj, bhdr, bmsg, false, name, jsa, allowRollup, denyPurge, allowTTL, allowMsgCounter, allowMsgSchedules, discard, discardNewPer, maxMsgSize, maxMsgs, maxMsgsPer, maxBytes); err != nil { + rollback() b.cleanupLocked(batchId, batches) batches.mu.Unlock() - if canRespond { - buf, _ := json.Marshal(&JSPubAckResponse{PubAck: &PubAck{Stream: name}, Error: apiErr}) - outq.send(newJSPubMsg(reply, _EMPTY_, _EMPTY_, nil, buf, nil, 0)) - } + mset.mu.Unlock() + _ = respondError(apiErr) return err } @@ -6635,6 +7417,10 @@ func (mset *stream) processJetStreamBatchMsg(batchId, subject, reply string, hdr isCommit := seq == batchSeq if isCommit { _reply = reply + // If committed by EOB, the last message must get the normal commit header. + if commitEob { + bhdr = genHeader(bhdr, JSBatchCommit, "1") + } } esm := encodeStreamMsgAllowCompressAndBatch(bsubj, _reply, bhdr, bmsg, mset.clseq, ts, false, batchId, seq, isCommit) entries = append(entries, newEntry(EntryNormal, esm)) @@ -6651,9 +7437,9 @@ func (mset *stream) processJetStreamBatchMsg(batchId, subject, reply string, hdr // Ensure the whole batch is fully isolated, and reads // can only happen after the full batch is committed. - mset.mu.Lock() + // We keep holding the stream lock. for seq := uint64(1); seq <= batchSeq; seq++ { - if seq == batchSeq && b.store.Type() != FileStorage { + if seq == batchSeq && !commitEob && b.store.Type() != FileStorage { bsubj, bhdr, bmsg = subject, hdr, msg } else if sm, err = b.store.LoadMsg(seq, &smv); sm != nil && err == nil { bsubj, bhdr, bmsg = sm.subj, sm.hdr, sm.msg @@ -6666,29 +7452,370 @@ func (mset *stream) processJetStreamBatchMsg(batchId, subject, reply string, hdr var _reply string if seq == batchSeq { _reply = reply + // If committed by EOB, the last message must get the normal commit header. + if commitEob { + bhdr = genHeader(bhdr, JSBatchCommit, "1") + } } - mset.processJetStreamMsg(bsubj, _reply, bhdr, bmsg, 0, 0, mt, false, false) + _ = mset.processJetStreamMsg(bsubj, _reply, bhdr, bmsg, 0, 0, mt, false, false) } mset.mu.Unlock() } else { + mset.mu.Unlock() // Do a single multi proposal. This ensures we get to push all entries to the proposal queue in-order // and not interleaved with other proposals. - diff.commit(mset) - _ = node.ProposeMulti(entries) - // The proposal can fail, but we always account for trying. - mset.trackReplicationTraffic(node, sz, r) + if err = node.ProposeMulti(entries); err == nil { + diff.commit(mset) + mset.trackReplicationTraffic(node, sz, r) - // Check to see if we are being overrun. - // TODO(dlc) - Make this a limit where we drop messages to protect ourselves, but allow to be configured. - if mset.clseq-(lseq+mset.clfs) > streamLagWarnThreshold { - lerr := fmt.Errorf("JetStream stream '%s > %s' has high message lag", jsa.acc().Name, name) - s.RateLimitWarnf("%s", lerr.Error()) + // Check to see if we are being overrun. + // TODO(dlc) - Make this a limit where we drop messages to protect ourselves, but allow to be configured. + if mset.clseq-(lseq+mset.clfs) > streamLagWarnThreshold { + lerr := fmt.Errorf("JetStream stream '%s > %s' has high message lag", jsa.acc().Name, name) + s.RateLimitWarnf("%s", lerr.Error()) + } + } else { + mset.clseq = oclseq } mset.clMu.Unlock() } b.cleanupLocked(batchId, batches) batches.mu.Unlock() - return nil + return err +} + +// processJetStreamFastBatchMsg processes a JetStream message that's part of an atomic batch publish. +// Handles constraints around the batch, storing messages, doing consistency checks, and performing the commit. +func (mset *stream) processJetStreamFastBatchMsg(batch *FastBatch, subject, reply string, hdr, msg []byte, mt *msgTrace) (retErr error) { + mset.mu.RLock() + canRespond := !mset.cfg.NoAck && len(reply) > 0 + name, stype := mset.cfg.Name, mset.cfg.Storage + discard, discardNewPer, maxMsgs, maxMsgsPer, maxBytes := mset.cfg.Discard, mset.cfg.DiscardNewPer, mset.cfg.MaxMsgs, mset.cfg.MaxMsgsPer, mset.cfg.MaxBytes + s, js, jsa, st, r, tierName, outq, node := mset.srv, mset.js, mset.jsa, mset.cfg.Storage, mset.cfg.Replicas, mset.tier, mset.outq, mset.node + maxMsgSize, lseq := int(mset.cfg.MaxMsgSize), mset.lseq + isLeader, isClustered, isSealed, allowRollup, denyPurge, allowTTL, allowMsgCounter, allowMsgSchedules, allowBatchPublish := mset.isLeader(), mset.isClustered(), mset.cfg.Sealed, mset.cfg.AllowRollup, mset.cfg.DenyPurge, mset.cfg.AllowMsgTTL, mset.cfg.AllowMsgCounter, mset.cfg.AllowMsgSchedules, mset.cfg.AllowBatchPublish + + // Apply the input subject transform if any + csubject := subject + if mset.itr != nil { + ts, err := mset.itr.Match(csubject) + if err == nil { + // no filtering: if the subject doesn't map the source of the transform, don't change it + csubject = ts + } + } + mset.mu.RUnlock() + + // If message tracing (with message delivery), we will need to send the + // event on exit in case there was an error (if message was not proposed). + // Otherwise, the event will be sent from processJetStreamMsg when + // invoked by the leader (from applyStreamEntries). + if mt != nil { + defer func() { + if retErr != nil { + mt.sendEventFromJetStream(retErr) + } + }() + } + + // Check that we are the leader. This can be false if we have scaled up from an R1 that had inbound queued messages. + if !isLeader { + return NewJSClusterNotLeaderError() + } + + respondError := func(apiErr *ApiError) error { + if canRespond { + buf, _ := json.Marshal(&JSPubAckResponse{PubAck: &PubAck{Stream: name}, Error: apiErr}) + outq.sendMsg(reply, buf) + } + return apiErr + } + + // Bail here if sealed. + if isSealed { + return respondError(NewJSStreamSealedError()) + } + + // Check here pre-emptively if we have exceeded this server limits. + if js.limitsExceeded(stype) { + s.resourcesExceededError(stype) + // Stepdown regardless. + if node := mset.raftNode(); node != nil { + node.StepDown() + } + return respondError(NewJSInsufficientResourcesError()) + } + + // Check here pre-emptively if we have exceeded our account limits. + if exceeded, err := jsa.wouldExceedLimits(st, tierName, r, csubject, hdr, msg); exceeded { + if err == nil { + err = NewJSAccountResourcesExceededError() + } + s.RateLimitWarnf("JetStream account limits exceeded for '%s': %s", jsa.acc().GetName(), err.Error()) + return respondError(err) + } + + // Check msgSize if we have a limit set there. Again this works if it goes through but better to be pre-emptive. + // Subtract to prevent against overflows. + if maxMsgSize >= 0 && (len(hdr) > maxMsgSize || len(msg) > maxMsgSize-len(hdr)) { + err := fmt.Errorf("JetStream message size exceeds limits for '%s > %s'", jsa.acc().Name, mset.cfg.Name) + s.RateLimitWarnf("%s", err.Error()) + _ = respondError(NewJSStreamMessageExceedsMaximumError()) + return err + } + + if !allowBatchPublish { + return respondError(NewJSBatchPublishDisabledError()) + } + + if batch == nil { + return respondError(NewJSBatchPublishInvalidPatternError()) + } + + // Batch ID is too long. + if len(batch.id) > 64 { + return respondError(NewJSBatchPublishInvalidBatchIDError()) + } + + mset.mu.Lock() + if mset.batches == nil { + mset.batches = &batching{} + } + batches := mset.batches + // Acquire the batches lock. + // Can't release the stream lock now, we need to keep holding it while we hold the batches lock. + // Re-acquiring the stream lock with the batches lock already held would be a lock inversion. + batches.mu.Lock() + + // Get batch. + b, ok := batches.fast[batch.id] + if !ok { + if batch.seq != 1 { + batches.mu.Unlock() + mset.mu.Unlock() + return respondError(NewJSBatchPublishUnknownBatchIDError()) + } + + // Limits. + maxInflightPerStream := streamMaxFastBatchInflightPerStream + maxInflightTotal := streamMaxFastBatchInflightTotal + opts := s.getOpts() + if opts.JetStreamLimits.MaxBatchInflightPerStream > 0 { + maxInflightPerStream = opts.JetStreamLimits.MaxBatchInflightPerStream + } + if opts.JetStreamLimits.MaxBatchInflightTotal > 0 { + maxInflightTotal = opts.JetStreamLimits.MaxBatchInflightTotal + } + + // Confirm we can facilitate an additional batch. + if len(batches.fast)+1 > maxInflightPerStream { + batches.mu.Unlock() + mset.mu.Unlock() + return respondError(NewJSBatchPublishTooManyInflightError()) + } + + // Confirm we'll not exceed the server limit. + if globalInflightFastBatches.Add(1) > int64(maxInflightTotal) { + globalInflightFastBatches.Add(-1) + batches.mu.Unlock() + mset.mu.Unlock() + return respondError(NewJSBatchPublishTooManyInflightError()) + } + + // We'll need a copy as we'll use it as a key and later for cleanup. + batchId := copyString(batch.id) + b = batches.newFastBatch(mset, batchId, batch.gapOk, batch.flow) + } + + // The required API level can have the batch be rejected. But the header is always removed. + if len(sliceHeader(JSRequiredApiLevel, hdr)) != 0 { + if errorOnRequiredApiLevel(hdr) { + b.cleanupLocked(batch.id, batches) + batches.mu.Unlock() + mset.mu.Unlock() + return respondError(NewJSRequiredApiLevelError()) + } + hdr = removeHeaderIfPresent(hdr, JSRequiredApiLevel) + } + + // Fast publishing resets the cleanup timer. + // If cleanup has already happened, we can't continue. + cleanup := !b.resetCleanupTimer(mset) + + // A ping operation confirms we've received a minimum amount of data and resends ack messages. + if batch.ping { + sendFlowControl := true + // Detect a gap or if the batch was cleaned up in the meantime. + if batch.seq > b.lseq || cleanup { + // If a gap is detected, we always report about it. + buf, _ := BatchFlowGap{ExpectedLastSequence: b.lseq + 1, CurrentSequence: batch.seq + 1}.MarshalJSON() + outq.sendMsg(reply, buf) + // If the gap is okay, we can continue without rejecting. + if b.gapOk && !cleanup { + b.lseq = batch.seq + if b.pending == 0 { + b.pseq = b.lseq + } + sendFlowControl = !b.checkFlowControl(mset, reply, batches) + } else if cleanup = batches.fastBatchCommit(b, batch.id, mset, reply); cleanup { + b.cleanupLocked(batch.id, batches) + sendFlowControl = false + } + } + if sendFlowControl { + b.sendFlowControl(b.fseq, mset, reply) + } + batches.mu.Unlock() + mset.mu.Unlock() + return nil + } + + // If the batch is committing, due to an error, we can't add more messages. + // We simply skip, since the client will be waiting for the PubAck. + if b.commit { + // MUST NOT clean up, that will happen when the commit completes. + batches.mu.Unlock() + mset.mu.Unlock() + return nil + } + + // Detect gaps. + b.lseq++ + if b.lseq != batch.seq || cleanup { + // If a forward gap is detected, we always report about it. + if batch.seq > b.lseq { + buf, _ := BatchFlowGap{ExpectedLastSequence: b.lseq, CurrentSequence: batch.seq}.MarshalJSON() + outq.sendMsg(reply, buf) + } + // If the forward gap is okay, we can continue without rejecting. + if b.gapOk && !cleanup && batch.seq > b.lseq { + b.lseq = batch.seq + } else { + // We've reached either a backward gap, or were cleaned up already, or it's gap-fail mode. + // Revert, since we incremented for the gap check. + b.lseq-- + if cleanup = batches.fastBatchCommit(b, batch.id, mset, reply); cleanup { + b.cleanupLocked(batch.id, batches) + } + batches.mu.Unlock() + mset.mu.Unlock() + return nil + } + } + + if batch.commit { + if batch.commitEob { + // Revert, since we incremented for the gap check. + b.lseq-- + // If there is none pending, correct the persisted sequence as we need to commit below. + if b.pending == 0 { + b.pseq = b.lseq + } + } + // We'll try to immediately send a PubAck if we can. + // Only possible if EOB is used and the last message was already persisted + // Otherwise, this sets up the commit for the last message we're about to propose. + cleanup = batches.fastBatchCommit(b, batch.id, mset, reply) + if batch.commitEob { + if cleanup { + b.cleanupLocked(batch.id, batches) + } + batches.mu.Unlock() + mset.mu.Unlock() + return nil + } + } + + // The first message in the batch responds with the settings used for flow control. + // If committing immediately, we only send the PubAck. + if batch.seq == 1 && canRespond && !batch.commit { + buf, _ := BatchFlowAck{Sequence: 0, Messages: b.ackMessages}.MarshalJSON() + outq.sendMsg(reply, buf) + } + + // Proceed with proposing this message. + + // We only use mset.clseq for clustering and in case we run ahead of actual commits. + // Check if we need to set initial value here + mset.clMu.Lock() + if mset.clseq == 0 || mset.clseq < lseq+mset.clfs { + lseq = recalculateClusteredSeq(mset, false) + } + // We can now unlock, since we've potentially recalculated the clustered seq above. + mset.mu.Unlock() + + var ( + dseq uint64 + apiErr *ApiError + err error + ) + diff := &batchStagedDiff{} + if hdr, msg, dseq, apiErr, err = checkMsgHeadersPreClusteredProposal(diff, mset, csubject, subject, hdr, msg, false, name, jsa, allowRollup, denyPurge, allowTTL, allowMsgCounter, allowMsgSchedules, discard, discardNewPer, maxMsgSize, maxMsgs, maxMsgsPer, maxBytes); err != nil { + mset.clMu.Unlock() + + // If the message is a duplicate, and we have no pending messages, we should check if we need to + // send the flow control message here. + if err == errMsgIdDuplicate { + if b.pending == 0 { + b.pseq = batch.seq + b.checkFlowControl(mset, reply, batches) + } + if !batch.commit { + // Otherwise, just skip. + batches.mu.Unlock() + return err + } + } + + // If a batch immediately errors, we send the same response as we would a normal publish. + if !batch.gapOk && b.lseq == 1 { + var response []byte + if err == errMsgIdDuplicate && dseq > 0 { + var buf [256]byte + response = append(buf[:0], mset.pubAck...) + response = append(response, strconv.FormatUint(dseq, 10)...) + response = append(response, fmt.Sprintf(",\"duplicate\": true,\"batch\":%q,\"count\":%d}", batch.id, batch.seq)...) + } else { + response, _ = json.Marshal(&JSPubAckResponse{PubAck: &PubAck{Stream: name}, Error: apiErr}) + } + b.cleanupLocked(batch.id, batches) + batches.mu.Unlock() + outq.sendMsg(reply, response) + return err + } + + // We always return the error to the client, unless it's a duplicate. + if err != errMsgIdDuplicate { + buf, _ := BatchFlowErr{Sequence: batch.seq, Error: apiErr}.MarshalJSON() + outq.sendMsg(reply, buf) + } + + // If gaps are okay, we just allow them to continue. + if batch.gapOk { + batches.mu.Unlock() + return err + } + + // Revert the last sequence, we might be able to immediately return the PubAck as part of the commit. + // Otherwise, the batch is cleaned up automatically later. + if err != errMsgIdDuplicate { + b.lseq-- + } + if cleanup = batches.fastBatchCommit(b, batch.id, mset, reply); cleanup { + b.cleanupLocked(batch.id, batches) + } + batches.mu.Unlock() + return err + } + b.pending++ + batches.mu.Unlock() + if !isClustered { + mset.clMu.Unlock() + return mset.processJetStreamMsgWithBatch(subject, reply, hdr, msg, 0, 0, mt, false, true, batch) + } + err = commitSingleMsg(diff, mset, subject, reply, hdr, msg, name, jsa, mt, node, r, lseq) + mset.clMu.Unlock() + return err } // Used to signal inbound message to registered consumers. @@ -6986,8 +8113,11 @@ func (mset *stream) internalLoop() { ims := msgs.pop() for _, im := range ims { // If we are clustered we need to propose this message to the underlying raft group. - if batchId := getBatchId(im.hdr); batchId != _EMPTY_ { - mset.processJetStreamBatchMsg(batchId, im.subj, im.rply, im.hdr, im.msg, im.mt) + if batch, err := getFastBatch(im.rply, im.hdr); batch != nil || err { + mset.processJetStreamFastBatchMsg(batch, im.subj, im.rply, im.hdr, im.msg, im.mt) + batch.returnToPool() + } else if batchId := getBatchId(im.hdr); batchId != _EMPTY_ { + mset.processJetStreamAtomicBatchMsg(batchId, im.subj, im.rply, im.hdr, im.msg, im.mt) } else if isClustered { mset.processClusteredInboundMsg(im.subj, im.rply, im.hdr, im.msg, im.mt, false) } else { @@ -7074,6 +8204,20 @@ func (mset *stream) stop(deleteFlag, advisory bool) error { // Mark closed. mset.closed.Store(true) + // Both flags set mean a delete where we are the stream leader. + // Try to clean up any consumers used for sourcing (if one wasn't provided to us). + if deleteFlag && advisory { + if mset.cfg.Mirror != nil && mset.cfg.Mirror.Consumer == nil { + mset.tryDeleteMirrorConsumer(mset.cfg.Mirror) + } + for _, s := range mset.cfg.Sources { + if s.Consumer == nil { + id := mset.createSourcingConsumerHash(s, mset.cfg.Sources) + mset.tryDeleteSourceConsumer(id, s) + } + } + } + // Signal to the monitor loop. // Can't use qch here. if mset.mqch != nil { @@ -7253,9 +8397,11 @@ func (mset *stream) getConsumers() []*consumer { return append([]*consumer(nil), mset.cList...) } +// numLimitableConsumers returns the number of consumers that are not direct/sourcing consumers. +// Used to limit the number of consumers for MaxConsumers limits or WQ exclusivity. // Lock should be held for this one. -func (mset *stream) numPublicConsumers() int { - return len(mset.consumers) - mset.directs +func (mset *stream) numLimitableConsumers() int { + return len(mset.consumers) - mset.sourcingConsumers } // This returns all consumers that are not DIRECT. @@ -7352,8 +8498,8 @@ func (mset *stream) setConsumer(o *consumer) { if len(o.subjf) > 0 { mset.numFilter++ } - if o.cfg.Direct { - mset.directs++ + if o.cfg.Direct || o.cfg.Sourcing { + mset.sourcingConsumers++ } // Now update consumers list as well mset.clsMu.Lock() @@ -7372,8 +8518,8 @@ func (mset *stream) removeConsumer(o *consumer) { if o.cfg.FilterSubject != _EMPTY_ && mset.numFilter > 0 { mset.numFilter-- } - if o.cfg.Direct && mset.directs > 0 { - mset.directs-- + if (o.cfg.Direct || o.cfg.Sourcing) && mset.sourcingConsumers > 0 { + mset.sourcingConsumers-- } if mset.consumers != nil { delete(mset.consumers, o.name) @@ -7495,7 +8641,7 @@ func (mset *stream) Store() StreamStore { return mset.store } -// Determines if the new proposed partition is unique amongst all consumers. +// Determines if the new proposed partition is unique amongst all public consumers. // Lock should be held. func (mset *stream) partitionUnique(name string, partitions []string) bool { for _, partition := range partitions { @@ -7505,6 +8651,11 @@ func (mset *stream) partitionUnique(name string, partitions []string) bool { continue } o.mu.RLock() + // Ignore direct/sourcing consumers. + if o.cfg.Direct || o.cfg.Sourcing { + o.mu.RUnlock() + continue + } if o.subjf == nil { o.mu.RUnlock() return false @@ -7625,6 +8776,17 @@ func (mset *stream) clearAllPreAcksBelowFloor(floor uint64) { } } +// Clear all preAcks in [first, last]. Iterates the preAcks map, not the +// range, so callers can pass very wide ranges cheaply. +// Write lock should be held. +func (mset *stream) clearAllPreAcksInRange(first, last uint64) { + for seq := range mset.preAcks { + if seq >= first && seq <= last { + delete(mset.preAcks, seq) + } + } +} + // This will register an ack for a consumer if it arrives before the actual message. func (mset *stream) registerPreAckLock(o *consumer, seq uint64) { mset.mu.Lock() @@ -7718,9 +8880,13 @@ func (mset *stream) ackMsg(o *consumer, seq uint64) bool { return true } - // Only propose message deletion to the stream if we're consumer leader, otherwise all followers would also propose. - // We must be the consumer leader, since we know for sure we've stored the message and don't register as pre-ack. - if o != nil && !o.IsLeader() { + // Only propose message deletion to the stream if we're the leader, otherwise followers would also propose. + // We must be the stream leader, since we are the only one that can guarantee message ordering and ack handling. + // Either we've stored the message, and we know for sure all consumers have acked the message. + // Or, we've not stored the message yet (rare), and all consumers have registered as pre-acks, + // then we do the message delete proposal after we've stored the message instead. + // Except for a Direct AckNone consumer, as that has a nil consumer here, we still forward the delete proposal. + if o != nil && !mset.isLeader() { // Currently, interest-based streams can race on "no interest" because consumer creates/updates go over // the meta layer and published messages go over the stream layer. Some servers could then either store // or not store some initial set of messages that gained new interest. To get the stream back in sync, @@ -7739,6 +8905,7 @@ func (mset *stream) ackMsg(o *consumer, seq uint64) bool { } md := streamMsgDelete{Seq: seq, NoErase: true, Stream: mset.cfg.Name} + // Directly proposes if stream leader, otherwise forwards it. mset.node.ForwardProposal(encodeMsgDelete(&md)) mset.mu.Unlock() return true @@ -7889,11 +9056,6 @@ func (a *Account) RestoreStream(ncfg *StreamConfig, r io.Reader) (*stream, error return nil, err } - if cfg.Template != _EMPTY_ { - if err := jsa.addStreamNameToTemplate(cfg.Template, cfg.Name); err != nil { - return nil, err - } - } mset, err := a.addStream(&cfg) if err != nil { // Make sure to clean up after ourselves here. @@ -8043,6 +9205,43 @@ func (mset *stream) isMonitorRunning() bool { return mset.inMonitor } +// setWriteErr stores the write error in the stream. +func (mset *stream) setWriteErr(err error) { + mset.mu.Lock() + defer mset.mu.Unlock() + mset.setWriteErrLocked(err) +} + +func (mset *stream) setWriteErrLocked(err error) { + if mset.werr != nil { + return + } + // Ignore non-write errors. + if err == ErrStoreClosed { + return + } + mset.srv.Errorf("JetStream stream '%s > %s' critical write error: %v", mset.acc.Name, mset.cfg.Name, err) + mset.werr = err + assert.Unreachable("Stream encountered write error", map[string]any{ + "account": mset.acc.Name, + "stream": mset.cfg.Name, + "err": err, + }) + + // If stream is replicated, put it in observer mode to make sure another server can pick it up. + if node := mset.node; node != nil { + node.StepDown() + node.SetObserver(true) + } +} + +// getWriteErr returns the write error stored in the stream (if any). +func (mset *stream) getWriteErr() error { + mset.mu.RLock() + defer mset.mu.RUnlock() + return mset.werr +} + // Adjust accounting for sent messages as part of replication. func (mset *stream) trackReplicationTraffic(node RaftNode, sz int, r int) { // If we are using the system account for NRG, add in the extra sent msgs and bytes to our account diff --git a/vendor/github.com/nats-io/nats-server/v2/server/sublist.go b/vendor/github.com/nats-io/nats-server/v2/server/sublist.go index 2589cd212..7423be0b2 100644 --- a/vendor/github.com/nats-io/nats-server/v2/server/sublist.go +++ b/vendor/github.com/nats-io/nats-server/v2/server/sublist.go @@ -121,6 +121,18 @@ func NewSublist(enableCache bool) *Sublist { return &Sublist{root: newLevel()} } +// NewSublistForServer will create a default sublist with caching enabled determined +// by the server options. +func NewSublistForServer(srv *Server) *Sublist { + if srv == nil { + return NewSublistNoCache() // Probably just unit tests. + } + if opts := srv.getOpts(); opts != nil { + return NewSublist(!opts.NoSublistCache) + } + return NewSublistNoCache() +} + // NewSublistWithCache will create a default sublist with caching enabled. func NewSublistWithCache() *Sublist { return NewSublist(true) diff --git a/vendor/github.com/nats-io/nats-server/v2/server/thw/thw.go b/vendor/github.com/nats-io/nats-server/v2/server/thw/thw.go index bcbc16e9a..ff6ac24cb 100644 --- a/vendor/github.com/nats-io/nats-server/v2/server/thw/thw.go +++ b/vendor/github.com/nats-io/nats-server/v2/server/thw/thw.go @@ -155,8 +155,11 @@ func (hw *HashWheel) expireTasks(ts int64, callback func(seq uint64, expires int slotLowest := int64(math.MaxInt64) for seq, expires := range s.entries { if expires <= ts && callback(seq, expires) { - delete(s.entries, seq) - hw.count-- + // Only remove if not done so already by the callback. + if _, ok := s.entries[seq]; ok { + delete(s.entries, seq) + hw.count-- + } continue } if expires < slotLowest { diff --git a/vendor/github.com/onsi/gomega/CHANGELOG.md b/vendor/github.com/onsi/gomega/CHANGELOG.md index 91e65521b..9c94d0e6c 100644 --- a/vendor/github.com/onsi/gomega/CHANGELOG.md +++ b/vendor/github.com/onsi/gomega/CHANGELOG.md @@ -1,3 +1,11 @@ +## 1.40.0 + +We're adopting a new release strategy to minimize dependency bloat in projects that consume Gomega. It is a limitation of the go mod toolchain that _test_ subdependencies of your project's direct dependencies get pulled in as *indirect* dependencies. In the case of Gomega, this ends up pulling in all of Ginkgo into your `go.mod` even if you are only using Gomega (Gomega uses Ginkgo for its own tests). + +Going forward, releases will strip out all tests, tidy up the `go.mod` and then push this stripped down version to a new `master-lite` branch. These stripped-down versions will receive the `vx.y.z` git tag and will be picked up by the go toolchain. + +Please open an issue if this new release process causes unexpected changes for your projects. + ## 1.39.1 Update all dependencies. This auto-updated the required version of Go to 1.24, consistent with the fact that Go 1.23 has been out of support for almost six months. diff --git a/vendor/github.com/onsi/gomega/gomega_dsl.go b/vendor/github.com/onsi/gomega/gomega_dsl.go index 87c70692b..af1341bdb 100644 --- a/vendor/github.com/onsi/gomega/gomega_dsl.go +++ b/vendor/github.com/onsi/gomega/gomega_dsl.go @@ -22,7 +22,7 @@ import ( "github.com/onsi/gomega/types" ) -const GOMEGA_VERSION = "1.39.1" +const GOMEGA_VERSION = "1.40.0" const nilGomegaPanic = `You are trying to make an assertion, but haven't registered Gomega's fail handler. If you're using Ginkgo then you probably forgot to put your assertion in an It(). diff --git a/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/services/storageprovider/storageprovider.go b/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/services/storageprovider/storageprovider.go index e14907025..8a50c9c43 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/services/storageprovider/storageprovider.go +++ b/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/services/storageprovider/storageprovider.go @@ -744,16 +744,6 @@ func (s *Service) Delete(ctx context.Context, req *provider.DeleteRequest) (*pro } ctx = ctxpkg.ContextSetLockID(ctx, req.LockId) - - // check DeleteRequest for any known opaque properties. - // FIXME these should be part of the DeleteRequest object - if req.Opaque != nil { - if _, ok := req.Opaque.Map["deleting_shared_resource"]; ok { - // it is a binary key; its existence signals true. Although, do not assume. - ctx = appctx.WithDeletingSharedResource(ctx) - } - } - md, err := s.Storage.GetMD(ctx, req.Ref, []string{}, []string{"id", "status"}) if err != nil { return &provider.DeleteResponse{ diff --git a/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/services/userprovider/userprovider.go b/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/services/userprovider/userprovider.go index 8bf5fbbe1..85952e94f 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/services/userprovider/userprovider.go +++ b/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/services/userprovider/userprovider.go @@ -182,9 +182,12 @@ func (s *service) GetUser(ctx context.Context, req *userpb.GetUserRequest) (*use user, err := s.usermgr.GetUser(ctx, req.UserId, req.SkipFetchingUserGroups) if err != nil { res := &userpb.GetUserResponse{} - if _, ok := err.(errtypes.NotFound); ok { + switch err.(type) { + case errtypes.NotFound: res.Status = status.NewNotFound(ctx, "user not found") - } else { + case errtypes.Unavailable: + res.Status = status.NewUnavailable(ctx, "user provider temporarily unavailable") + default: res.Status = status.NewInternal(ctx, "error getting user") } return res, nil @@ -205,9 +208,12 @@ func (s *service) GetUserByClaim(ctx context.Context, req *userpb.GetUserByClaim user, err := s.usermgr.GetUserByClaim(ctx, req.Claim, req.Value, tenantID, req.SkipFetchingUserGroups) if err != nil { res := &userpb.GetUserByClaimResponse{} - if _, ok := err.(errtypes.NotFound); ok { + switch err.(type) { + case errtypes.NotFound: res.Status = status.NewNotFound(ctx, fmt.Sprintf("user not found %s %s", req.Claim, req.Value)) - } else { + case errtypes.Unavailable: + res.Status = status.NewUnavailable(ctx, "user provider temporarily unavailable") + default: res.Status = status.NewInternal(ctx, "error getting user by claim") } return res, nil diff --git a/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/services/usershareprovider/usershareprovider.go b/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/services/usershareprovider/usershareprovider.go index eaab35976..1b801f581 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/services/usershareprovider/usershareprovider.go +++ b/vendor/github.com/opencloud-eu/reva/v2/internal/grpc/services/usershareprovider/usershareprovider.go @@ -84,9 +84,9 @@ type service struct { allowedPathsForShares []*regexp.Regexp } -func getShareManager(c *config) (share.Manager, error) { +func getShareManager(c *config, logger *zerolog.Logger) (share.Manager, error) { if f, ok := registry.NewFuncs[c.Driver]; ok { - return f(c.Drivers[c.Driver]) + return f(c.Drivers[c.Driver], logger) } return nil, errtypes.NotFound("driver not found: " + c.Driver) } @@ -114,7 +114,7 @@ func parseConfig(m map[string]interface{}) (*config, error) { } // New creates a new user share provider svc initialized from defaults -func NewDefault(m map[string]interface{}, ss *grpc.Server, _ *zerolog.Logger) (rgrpc.Service, error) { +func NewDefault(m map[string]any, ss *grpc.Server, logger *zerolog.Logger) (rgrpc.Service, error) { c, err := parseConfig(m) if err != nil { @@ -123,7 +123,7 @@ func NewDefault(m map[string]interface{}, ss *grpc.Server, _ *zerolog.Logger) (r c.init() - sm, err := getShareManager(c) + sm, err := getShareManager(c, logger) if err != nil { return nil, err } diff --git a/vendor/github.com/opencloud-eu/reva/v2/internal/http/services/owncloud/ocdav/proppatch.go b/vendor/github.com/opencloud-eu/reva/v2/internal/http/services/owncloud/ocdav/proppatch.go index 1c1f9797b..3a2df9496 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/internal/http/services/owncloud/ocdav/proppatch.go +++ b/vendor/github.com/opencloud-eu/reva/v2/internal/http/services/owncloud/ocdav/proppatch.go @@ -155,6 +155,13 @@ func (s *svc) handleProppatch(ctx context.Context, w http.ResponseWriter, r *htt } for j := range patches[i].Props { propNameXML := patches[i].Props[j].XMLName + + // favorites are now managed by the Graph API and can no longer be set using PROPPATCH. To avoid confusion, we return a 403 Forbidden when clients try to set the oc:favorites property + if propNameXML.Local == "favorite" { + w.WriteHeader(http.StatusForbidden) + return nil, nil, false + } + // don't use path.Join. It removes the double slash! concatenate with a / key := fmt.Sprintf("%s/%s", patches[i].Props[j].XMLName.Space, patches[i].Props[j].XMLName.Local) value := string(patches[i].Props[j].InnerXML) diff --git a/vendor/github.com/opencloud-eu/reva/v2/pkg/appctx/appctx.go b/vendor/github.com/opencloud-eu/reva/v2/pkg/appctx/appctx.go index 049ac9df4..336c5618d 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/pkg/appctx/appctx.go +++ b/vendor/github.com/opencloud-eu/reva/v2/pkg/appctx/appctx.go @@ -27,16 +27,6 @@ import ( "go.opentelemetry.io/otel/trace" ) -// deletingSharedResource flags to a storage a shared resource is being deleted not by the owner. -type deletingSharedResource struct{} - -func WithDeletingSharedResource(ctx context.Context) context.Context { - return context.WithValue(ctx, deletingSharedResource{}, struct{}{}) -} -func DeletingSharedResourceFromContext(ctx context.Context) bool { - return ctx.Value(deletingSharedResource{}) != nil -} - // WithLogger returns a context with an associated logger. func WithLogger(ctx context.Context, l *zerolog.Logger) context.Context { return l.WithContext(ctx) diff --git a/vendor/github.com/opencloud-eu/reva/v2/pkg/errtypes/errtypes.go b/vendor/github.com/opencloud-eu/reva/v2/pkg/errtypes/errtypes.go index a02399e40..3b349f82f 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/pkg/errtypes/errtypes.go +++ b/vendor/github.com/opencloud-eu/reva/v2/pkg/errtypes/errtypes.go @@ -203,6 +203,15 @@ func (e TooEarly) Error() string { return "error: too early: " + string(e) } // IsTooEarly implements the IsTooEarly interface. func (e TooEarly) IsTooEarly() {} +// Unavailable is the error to use when a backend service (e.g. LDAP, database) is +// temporarily unreachable. Callers should treat this as a transient failure and retry. +type Unavailable string + +func (e Unavailable) Error() string { return "error: unavailable: " + string(e) } + +// IsUnavailable implements the IsUnavailable interface. +func (e Unavailable) IsUnavailable() {} + // IsNotFound is the interface to implement // to specify that a resource is not found. type IsNotFound interface { @@ -293,6 +302,12 @@ type IsTooEarly interface { IsTooEarly() } +// IsUnavailable is the interface to implement to specify that a backend service is +// temporarily unavailable and the caller should retry. +type IsUnavailable interface { + IsUnavailable() +} + // NewErrtypeFromStatus maps a rpc status to an errtype func NewErrtypeFromStatus(status *rpc.Status) error { switch status.Code { @@ -329,6 +344,8 @@ func NewErrtypeFromStatus(status *rpc.Status) error { return BadRequest(status.Message) case rpc.Code_CODE_TOO_EARLY: return TooEarly(status.Message) + case rpc.Code_CODE_UNAVAILABLE: + return Unavailable(status.Message) default: return InternalError(status.Message) } @@ -363,6 +380,8 @@ func NewErrtypeFromHTTPStatusCode(code int, message string) error { return PartialContent(message) case http.StatusTooEarly: return TooEarly(message) + case http.StatusServiceUnavailable: + return Unavailable(message) case StatusChecksumMismatch: return ChecksumMismatch(message) default: @@ -399,6 +418,8 @@ func NewHTTPStatusCodeFromErrtype(err error) int { return http.StatusPartialContent case TooEarly: return http.StatusTooEarly + case Unavailable: + return http.StatusServiceUnavailable case ChecksumMismatch: return StatusChecksumMismatch default: diff --git a/vendor/github.com/opencloud-eu/reva/v2/pkg/events/raw/raw.go b/vendor/github.com/opencloud-eu/reva/v2/pkg/events/raw/raw.go index 5f24f45c1..5126bc1d6 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/pkg/events/raw/raw.go +++ b/vendor/github.com/opencloud-eu/reva/v2/pkg/events/raw/raw.go @@ -71,9 +71,8 @@ type RawStream struct { c Config } -func FromConfig(ctx context.Context, name string, cfg Config) (Stream, error) { - var s Stream - b := backoff.NewExponentialBackOff() +func JetStream(ctx context.Context, name string, cfg Config) (jetstream.JetStream, error) { + var js jetstream.JetStream connect := func() error { var tlsConf *tls.Config @@ -120,27 +119,32 @@ func FromConfig(ctx context.Context, name string, cfg Config) (Stream, error) { return err } - jsConn, err := jetstream.New(conn) - if err != nil { - return err - } - - js, err := jsConn.Stream(ctx, events.MainQueueName) - if err != nil { - return err - } - - s = &RawStream{ - js: js, - c: cfg, - } - return nil + js, err = jetstream.New(conn) + return err } - err := backoff.Retry(connect, b) + + err := backoff.Retry(connect, backoff.NewExponentialBackOff()) if err != nil { - return s, errors.Wrap(err, "could not connect to nats jetstream") + return nil, errors.Wrap(err, "could not connect to nats jetstream") } - return s, nil + return js, nil +} + +func FromConfig(ctx context.Context, name string, cfg Config) (Stream, error) { + jsConn, err := JetStream(ctx, name, cfg) + if err != nil { + return nil, err + } + + js, err := jsConn.Stream(ctx, events.MainQueueName) + if err != nil { + return nil, err + } + + return &RawStream{ + js: js, + c: cfg, + }, nil } func (s *RawStream) Consume(group string, evs ...events.Unmarshaller) (<-chan Event, error) { diff --git a/vendor/github.com/opencloud-eu/reva/v2/pkg/events/stream/nats.go b/vendor/github.com/opencloud-eu/reva/v2/pkg/events/stream/nats.go index 24b47872d..4fbaa5cfe 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/pkg/events/stream/nats.go +++ b/vendor/github.com/opencloud-eu/reva/v2/pkg/events/stream/nats.go @@ -2,6 +2,7 @@ package stream import ( "bytes" + "context" "crypto/tls" "crypto/x509" "errors" @@ -11,7 +12,9 @@ import ( "github.com/cenkalti/backoff" "github.com/go-micro/plugins/v4/events/natsjs" + "github.com/nats-io/nats.go/jetstream" "github.com/opencloud-eu/reva/v2/pkg/events" + "github.com/opencloud-eu/reva/v2/pkg/events/raw" "github.com/opencloud-eu/reva/v2/pkg/logger" ) @@ -65,7 +68,38 @@ func NatsFromConfig(connName string, disableDurability bool, cfg NatsConfig) (ev opts = append(opts, natsjs.DisableDurableStreams()) } - return Nats(opts...) + s, err := Nats(opts...) + if err != nil { + return nil, err + } + + // apply a MaxAge to the main queue to prevent it from filling up + ctx := context.Background() + jsConn, err := raw.JetStream(ctx, connName, raw.Config{ + Endpoint: cfg.Endpoint, + Cluster: cfg.Cluster, + TLSInsecure: cfg.TLSInsecure, + TLSRootCACertificate: cfg.TLSRootCACertificate, + EnableTLS: cfg.EnableTLS, + AuthUsername: cfg.AuthUsername, + AuthPassword: cfg.AuthPassword, + }) + if err != nil { + return nil, err + } + streamCfg := jetstream.StreamConfig{ + Name: "main-queue", + MaxAge: 7 * 24 * time.Hour, + } + _, err = jsConn.CreateStream(ctx, streamCfg) + if err != nil { + // If the stream already exists, update its configuration + if err == jetstream.ErrStreamNameAlreadyInUse { + _, _ = jsConn.UpdateStream(ctx, streamCfg) + } + } + + return s, nil } // nats returns a nats streaming client diff --git a/vendor/github.com/opencloud-eu/reva/v2/pkg/rgrpc/status/status.go b/vendor/github.com/opencloud-eu/reva/v2/pkg/rgrpc/status/status.go index 0ee9b1029..07eb32e25 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/pkg/rgrpc/status/status.go +++ b/vendor/github.com/opencloud-eu/reva/v2/pkg/rgrpc/status/status.go @@ -68,6 +68,15 @@ func NewInternal(ctx context.Context, msg string) *rpc.Status { } } +// NewUnavailable returns a Status with CODE_UNAVAILABLE. +func NewUnavailable(ctx context.Context, msg string) *rpc.Status { + return &rpc.Status{ + Code: rpc.Code_CODE_UNAVAILABLE, + Message: msg, + Trace: getTrace(ctx), + } +} + // NewUnauthenticated returns a Status with CODE_UNAUTHENTICATED. func NewUnauthenticated(ctx context.Context, err error, msg string) *rpc.Status { return &rpc.Status{ @@ -191,6 +200,10 @@ func NewStatusFromErrType(ctx context.Context, msg string, err error) *rpc.Statu return NewUnimplemented(ctx, err, msg+":"+err.Error()) case errtypes.BadRequest: return NewInvalid(ctx, msg+":"+err.Error()) + case errtypes.Unavailable: + return NewUnavailable(ctx, msg+": "+err.Error()) + case errtypes.IsUnavailable: + return NewUnavailable(ctx, msg+": "+err.Error()) } // map GRPC status codes coming from the auth middleware diff --git a/vendor/github.com/opencloud-eu/reva/v2/pkg/share/manager/jsoncs3/jsoncs3.go b/vendor/github.com/opencloud-eu/reva/v2/pkg/share/manager/jsoncs3/jsoncs3.go index ba995639b..cf336ecb0 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/pkg/share/manager/jsoncs3/jsoncs3.go +++ b/vendor/github.com/opencloud-eu/reva/v2/pkg/share/manager/jsoncs3/jsoncs3.go @@ -36,9 +36,9 @@ import ( "github.com/opencloud-eu/reva/v2/pkg/errtypes" "github.com/opencloud-eu/reva/v2/pkg/events" "github.com/opencloud-eu/reva/v2/pkg/events/stream" - "github.com/opencloud-eu/reva/v2/pkg/logger" "github.com/opencloud-eu/reva/v2/pkg/rgrpc/todo/pool" "github.com/opencloud-eu/reva/v2/pkg/share" + migration "github.com/opencloud-eu/reva/v2/pkg/share/manager/jsoncs3/migrations" "github.com/opencloud-eu/reva/v2/pkg/share/manager/jsoncs3/providercache" "github.com/opencloud-eu/reva/v2/pkg/share/manager/jsoncs3/receivedsharecache" "github.com/opencloud-eu/reva/v2/pkg/share/manager/jsoncs3/sharecache" @@ -48,6 +48,7 @@ import ( "github.com/opencloud-eu/reva/v2/pkg/storagespace" "github.com/opencloud-eu/reva/v2/pkg/utils" "github.com/pkg/errors" + "github.com/rs/zerolog" "go.opentelemetry.io/otel/codes" "golang.org/x/sync/errgroup" "google.golang.org/genproto/protobuf/field_mask" @@ -122,14 +123,20 @@ var ( ) type config struct { - GatewayAddr string `mapstructure:"gateway_addr"` - MaxConcurrency int `mapstructure:"max_concurrency"` - ProviderAddr string `mapstructure:"provider_addr"` - ServiceUserID string `mapstructure:"service_user_id"` - ServiceUserIdp string `mapstructure:"service_user_idp"` - MachineAuthAPIKey string `mapstructure:"machine_auth_apikey"` - CacheTTL int `mapstructure:"ttl"` - Events EventOptions `mapstructure:"events"` + GatewayAddr string `mapstructure:"gateway_addr"` + MaxConcurrency int `mapstructure:"max_concurrency"` + ProviderAddr string `mapstructure:"provider_addr"` + SystemUserID string `mapstructure:"system_user_id"` + SystemUserIdp string `mapstructure:"system_user_idp"` + MachineAuthAPIKey string `mapstructure:"machine_auth_apikey"` + ServiceAccountID string `mapstructure:"service_account_id"` + ServiceAccountSecret string `mapstructure:"service_account_secret"` + // ProviderRegistryAddr is the address of the storage registry used during + // migrations. Defaults to GatewayAddr when empty, because in the default + // OpenCloud deployment the registry is co-located with the gateway. + ProviderRegistryAddr string `mapstructure:"provider_registry_addr"` + CacheTTL int `mapstructure:"ttl"` + Events EventOptions `mapstructure:"events"` } // EventOptions are the configurable options for events @@ -145,8 +152,6 @@ type EventOptions struct { // Manager implements a share manager using a cs3 storage backend with local caching type Manager struct { - sync.RWMutex - Cache providercache.Cache // holds all shares, sharded by provider id and space id CreatedCache sharecache.Cache // holds the list of shares a user has created, sharded by user id GroupReceivedCache sharecache.Cache // holds the list of shares a group has access to, sharded by group id @@ -155,23 +160,25 @@ type Manager struct { storage metadata.Storage SpaceRoot *provider.ResourceId - initialized bool + ready chan struct{} // closed once initialize() has completed successfully + migrationsDone chan struct{} // closed once doMigrations() has returned on this instance MaxConcurrency int gatewaySelector pool.Selectable[gatewayv1beta1.GatewayAPIClient] eventStream events.Stream + logger *zerolog.Logger } // NewDefault returns a new manager instance with default dependencies -func NewDefault(m map[string]interface{}) (share.Manager, error) { +func NewDefault(m map[string]interface{}, logger *zerolog.Logger) (share.Manager, error) { c := &config{} if err := mapstructure.Decode(m, c); err != nil { err = errors.Wrap(err, "error creating a new manager") return nil, err } - s, err := metadata.NewCS3Storage(c.ProviderAddr, c.ProviderAddr, c.ServiceUserID, c.ServiceUserIdp, c.MachineAuthAPIKey) + s, err := metadata.NewCS3Storage(c.ProviderAddr, c.ProviderAddr, c.SystemUserID, c.SystemUserIdp, c.MachineAuthAPIKey) if err != nil { return nil, err } @@ -189,11 +196,34 @@ func NewDefault(m map[string]interface{}) (share.Manager, error) { } } - return New(s, gatewaySelector, c.CacheTTL, es, c.MaxConcurrency) + mgr, err := New(s, logger, gatewaySelector, c.CacheTTL, es, c.MaxConcurrency) + if err != nil { + return nil, err + } + providerRegistryAddr := c.ProviderRegistryAddr + if providerRegistryAddr == "" { + providerRegistryAddr = c.GatewayAddr + } + mgr.RunMigrations(migration.MigrationConfig{ + ServiceAccountID: c.ServiceAccountID, + ServiceAccountSecret: c.ServiceAccountSecret, + ProviderRegistryAddr: providerRegistryAddr, + }) + return mgr, nil } // New returns a new manager instance. -func New(s metadata.Storage, gatewaySelector pool.Selectable[gatewayv1beta1.GatewayAPIClient], ttlSeconds int, es events.Stream, maxconcurrency int) (*Manager, error) { +func New(s metadata.Storage, + logger *zerolog.Logger, + gatewaySelector pool.Selectable[gatewayv1beta1.GatewayAPIClient], + ttlSeconds int, + es events.Stream, + maxconcurrency int, +) (*Manager, error) { + if logger == nil { + nop := zerolog.Nop() + logger = &nop + } ttl := time.Duration(ttlSeconds) * time.Second m := &Manager{ @@ -205,13 +235,38 @@ func New(s metadata.Storage, gatewaySelector pool.Selectable[gatewayv1beta1.Gate gatewaySelector: gatewaySelector, eventStream: es, MaxConcurrency: maxconcurrency, + logger: logger, + ready: make(chan struct{}), + // migrationsDone is open (blocking) by default. It is closed by + // doMigrations when all migrations complete, or by SkipMigrations for + // callers (e.g. tests) that do not run migrations at all. + migrationsDone: make(chan struct{}), } + // Initialize the metadata storage connection in the background, retrying + // with exponential backoff if the backend is not yet available. + go func() { + backoff := time.Second + for { + if err := m.initialize(context.Background()); err != nil { + logger.Info().Err(err).Dur("backoff", backoff).Msg("share manager: metadata storage initialization failed, retrying") + time.Sleep(backoff) + if backoff < 30*time.Second { + backoff *= 2 + } + continue + } + logger.Debug().Msg("share manager: initialization succeeded") + close(m.ready) + return + } + }() + // listen for events if m.eventStream != nil { ch, err := events.Consume(m.eventStream, "jsoncs3sharemanager", _registeredEvents...) if err != nil { - appctx.GetLogger(context.Background()).Error().Err(err).Msg("error consuming events") + logger.Error().Err(err).Msg("error consuming events") } go m.ProcessEvents(ch) } @@ -219,23 +274,13 @@ func New(s metadata.Storage, gatewaySelector pool.Selectable[gatewayv1beta1.Gate return m, nil } +// initialize connects to the metadata storage backend and ensures the required +// directory structure exists. It is called once at startup from a background +// goroutine (see New) and must not be called concurrently. func (m *Manager) initialize(ctx context.Context) error { _, span := appctx.GetTracerProvider(ctx).Tracer(tracerName).Start(ctx, "initialize") defer span.End() - if m.initialized { - span.SetStatus(codes.Ok, "already initialized") - return nil - } - m.Lock() - defer m.Unlock() - - if m.initialized { // check if initialization happened while grabbing the lock - span.SetStatus(codes.Ok, "initialized while grabbing lock") - return nil - } - - ctx = context.Background() err := m.storage.Init(ctx, "jsoncs3-share-manager-metadata") if err != nil { span.RecordError(err) @@ -261,21 +306,85 @@ func (m *Manager) initialize(ctx context.Context) error { span.SetStatus(codes.Error, err.Error()) return err } + err = m.storage.MakeDirIfNotExist(ctx, "migrations") + if err != nil { + span.RecordError(err) + span.SetStatus(codes.Error, err.Error()) + return err + } - m.initialized = true span.SetStatus(codes.Ok, "initialized") return nil } +// waitForInit blocks until the background initialization goroutine has +// successfully completed, or until ctx is cancelled. +func (m *Manager) waitForInit(ctx context.Context) error { + select { + case <-m.ready: + return nil + case <-ctx.Done(): + return errors.Wrap(ctx.Err(), "share manager not yet initialized") + } +} + +// waitForMigrations blocks until both storage initialization and all data +// migrations have completed on this instance, or until ctx is cancelled. +// It is a strict superset of waitForInit and should be used by write operations +// to ensure no writes race with an in-progress migration. +func (m *Manager) waitForMigrations(ctx context.Context) error { + select { + case <-m.ready: + case <-ctx.Done(): + return errors.Wrap(ctx.Err(), "share manager not yet initialized") + } + select { + case <-m.migrationsDone: + return nil + case <-ctx.Done(): + return errors.Wrap(ctx.Err(), "share manager migrations not yet complete") + } +} + +// RunMigrations starts data migrations in a background goroutine. It should be +// called once after New() in production server startup. Callers that do not +// need migrations should call SkipMigrations instead to unblock write operations. +func (m *Manager) RunMigrations(cfg migration.MigrationConfig) { + go m.doMigrations(cfg) +} + +// SkipMigrations unblocks write operations on this instance without running +// any migrations. It must be called when RunMigrations will not be called, +// for example in tests. +func (m *Manager) SkipMigrations() { + close(m.migrationsDone) +} + +func (m *Manager) doMigrations(cfg migration.MigrationConfig) { + // Always close migrationsDone when this goroutine exits, whether migrations + // ran, were skipped, or failed. This unblocks write operations on this + // instance. Non-winning instances are held here by acquireLock until the + // winning instance finishes, so the close happens only after the storage + // state is fully migrated. + defer close(m.migrationsDone) + if err := m.waitForInit(context.Background()); err != nil { + m.logger.Error().Err(err).Msg("share manager: aborting migrations, manager did not initialize") + return + } + m.logger.Debug().Msg("migrations start") + migrations := migration.New(*m.logger, m.gatewaySelector, m.storage, cfg, m, m) + migrations.RunMigrations() +} + func (m *Manager) ProcessEvents(ch <-chan events.Event) { - log := logger.New() + log := m.logger + ctx := context.Background() + if err := m.waitForInit(ctx); err != nil { + log.Error().Err(err).Msg("share manager: error waiting for initialization") + return + } for event := range ch { ctx := context.Background() - - if err := m.initialize(ctx); err != nil { - log.Error().Err(err).Msg("error initializing manager") - } - if ev, ok := event.Event.(events.SpaceDeleted); ok { log.Debug().Msgf("space deleted event: %v", ev) go func() { m.purgeSpace(ctx, ev.ID) }() @@ -287,7 +396,7 @@ func (m *Manager) ProcessEvents(ch <-chan events.Event) { func (m *Manager) Share(ctx context.Context, md *provider.ResourceInfo, g *collaboration.ShareGrant) (*collaboration.Share, error) { ctx, span := appctx.GetTracerProvider(ctx).Tracer(tracerName).Start(ctx, "Share") defer span.End() - if err := m.initialize(ctx); err != nil { + if err := m.waitForMigrations(ctx); err != nil { span.RecordError(err) span.SetStatus(codes.Error, err.Error()) return nil, err @@ -436,7 +545,7 @@ func (m *Manager) GetShare(ctx context.Context, ref *collaboration.ShareReferenc ctx, span := appctx.GetTracerProvider(ctx).Tracer(tracerName).Start(ctx, "GetShare") defer span.End() sublog := appctx.GetLogger(ctx).With().Str("id", ref.GetId().GetOpaqueId()).Str("key", ref.GetKey().String()).Str("driver", "jsoncs3").Str("handler", "GetShare").Logger() - if err := m.initialize(ctx); err != nil { + if err := m.waitForInit(ctx); err != nil { return nil, err } @@ -494,7 +603,7 @@ func (m *Manager) Unshare(ctx context.Context, ref *collaboration.ShareReference ctx, span := appctx.GetTracerProvider(ctx).Tracer(tracerName).Start(ctx, "Unshare") defer span.End() - if err := m.initialize(ctx); err != nil { + if err := m.waitForMigrations(ctx); err != nil { return err } @@ -511,7 +620,7 @@ func (m *Manager) UpdateShare(ctx context.Context, ref *collaboration.ShareRefer ctx, span := appctx.GetTracerProvider(ctx).Tracer(tracerName).Start(ctx, "UpdateShare") defer span.End() - if err := m.initialize(ctx); err != nil { + if err := m.waitForMigrations(ctx); err != nil { return nil, err } @@ -599,7 +708,7 @@ func (m *Manager) ListShares(ctx context.Context, filters []*collaboration.Filte ctx, span := appctx.GetTracerProvider(ctx).Tracer(tracerName).Start(ctx, "ListShares") defer span.End() - if err := m.initialize(ctx); err != nil { + if err := m.waitForInit(ctx); err != nil { return nil, err } @@ -816,7 +925,7 @@ func (m *Manager) ListReceivedShares(ctx context.Context, filters []*collaborati defer span.End() sublog := appctx.GetLogger(ctx).With().Str("driver", "jsoncs3").Str("handler", "ListReceivedShares").Logger() - if err := m.initialize(ctx); err != nil { + if err := m.waitForInit(ctx); err != nil { return nil, err } @@ -1012,7 +1121,7 @@ func (m *Manager) convert(ctx context.Context, userID string, s *collaboration.S // GetReceivedShare returns the information for a received share. func (m *Manager) GetReceivedShare(ctx context.Context, ref *collaboration.ShareReference) (*collaboration.ReceivedShare, error) { - if err := m.initialize(ctx); err != nil { + if err := m.waitForInit(ctx); err != nil { return nil, err } @@ -1056,7 +1165,7 @@ func (m *Manager) UpdateReceivedShare(ctx context.Context, receivedShare *collab ctx, span := appctx.GetTracerProvider(ctx).Tracer(tracerName).Start(ctx, "UpdateReceivedShare") defer span.End() - if err := m.initialize(ctx); err != nil { + if err := m.waitForMigrations(ctx); err != nil { return nil, err } @@ -1103,8 +1212,8 @@ func updateShareID(share *collaboration.Share) { // Load imports shares and received shares from channels (e.g. during migration) func (m *Manager) Load(ctx context.Context, shareChan <-chan *collaboration.Share, receivedShareChan <-chan share.ReceivedShareWithUser) error { - log := appctx.GetLogger(ctx) - if err := m.initialize(ctx); err != nil { + l := m.logger + if err := m.waitForInit(ctx); err != nil { return err } @@ -1119,14 +1228,14 @@ func (m *Manager) Load(ctx context.Context, shareChan <-chan *collaboration.Shar updateShareID(s) } if err := m.Cache.Add(context.Background(), s.GetResourceId().GetStorageId(), s.GetResourceId().GetSpaceId(), s.Id.OpaqueId, s); err != nil { - log.Error().Err(err).Interface("share", s).Msg("error persisting share") + l.Error().Err(err).Interface("share", s).Msg("error persisting share") } else { - log.Debug().Str("storageid", s.GetResourceId().GetStorageId()).Str("spaceid", s.GetResourceId().GetSpaceId()).Str("shareid", s.Id.OpaqueId).Msg("imported share") + l.Debug().Str("storageid", s.GetResourceId().GetStorageId()).Str("spaceid", s.GetResourceId().GetSpaceId()).Str("shareid", s.Id.OpaqueId).Msg("imported share") } if err := m.CreatedCache.Add(ctx, s.GetCreator().GetOpaqueId(), s.Id.OpaqueId); err != nil { - log.Error().Err(err).Interface("share", s).Msg("error persisting created cache") + l.Error().Err(err).Interface("share", s).Msg("error persisting created cache") } else { - log.Debug().Str("creatorid", s.GetCreator().GetOpaqueId()).Str("shareid", s.Id.OpaqueId).Msg("updated created cache") + l.Debug().Str("creatorid", s.GetCreator().GetOpaqueId()).Str("shareid", s.Id.OpaqueId).Msg("updated created cache") } } wg.Done() @@ -1137,18 +1246,19 @@ func (m *Manager) Load(ctx context.Context, shareChan <-chan *collaboration.Shar if !shareIsRoutable(s.ReceivedShare.GetShare()) { updateShareID(s.ReceivedShare.GetShare()) } - switch s.ReceivedShare.Share.Grantee.Type { - case provider.GranteeType_GRANTEE_TYPE_USER: - if err := m.UserReceivedStates.Add(context.Background(), s.ReceivedShare.GetShare().GetGrantee().GetUserId().GetOpaqueId(), s.ReceivedShare.GetShare().GetResourceId().GetSpaceId(), s.ReceivedShare); err != nil { - log.Error().Err(err).Interface("received share", s).Msg("error persisting received share for user") + if s.UserID != nil { + spaceid := s.ReceivedShare.GetShare().GetResourceId().GetStorageId() + shareid.IDDelimiter + s.ReceivedShare.GetShare().GetResourceId().GetSpaceId() + if err := m.UserReceivedStates.Add(context.Background(), s.UserID.GetOpaqueId(), spaceid, s.ReceivedShare); err != nil { + l.Error().Err(err).Interface("received share", s).Msg("error persisting received share for user") } else { - log.Debug().Str("userid", s.ReceivedShare.GetShare().GetGrantee().GetUserId().GetOpaqueId()).Str("spaceid", s.ReceivedShare.GetShare().GetResourceId().GetSpaceId()).Str("shareid", s.ReceivedShare.GetShare().Id.OpaqueId).Msg("updated received share userdata") + l.Debug().Str("userid", s.UserID.GetOpaqueId()).Str("spaceid", spaceid).Str("shareid", s.ReceivedShare.GetShare().Id.OpaqueId).Msg("updated received share userdata") } - case provider.GranteeType_GRANTEE_TYPE_GROUP: + } + if s.ReceivedShare.Share.Grantee.Type == provider.GranteeType_GRANTEE_TYPE_GROUP && s.UserID == nil { if err := m.GroupReceivedCache.Add(context.Background(), s.ReceivedShare.GetShare().GetGrantee().GetGroupId().GetOpaqueId(), s.ReceivedShare.GetShare().GetId().GetOpaqueId()); err != nil { - log.Error().Err(err).Interface("received share", s).Msg("error persisting received share to group cache") + l.Error().Err(err).Interface("received share", s).Msg("error persisting received share to group cache") } else { - log.Debug().Str("groupid", s.ReceivedShare.GetShare().GetGrantee().GetGroupId().GetOpaqueId()).Str("shareid", s.ReceivedShare.GetShare().Id.OpaqueId).Msg("updated received share group cache") + l.Debug().Str("groupid", s.ReceivedShare.GetShare().GetGrantee().GetGroupId().GetOpaqueId()).Str("shareid", s.ReceivedShare.GetShare().Id.OpaqueId).Msg("updated received share group cache") } } } @@ -1220,7 +1330,7 @@ func (m *Manager) removeShare(ctx context.Context, s *collaboration.Share, skipS func (m *Manager) CleanupStaleShares(ctx context.Context) { log := appctx.GetLogger(ctx) - if err := m.initialize(ctx); err != nil { + if err := m.waitForMigrations(ctx); err != nil { return } diff --git a/vendor/github.com/opencloud-eu/reva/v2/pkg/share/manager/jsoncs3/migrations/0001_import_spacemembers.go b/vendor/github.com/opencloud-eu/reva/v2/pkg/share/manager/jsoncs3/migrations/0001_import_spacemembers.go new file mode 100644 index 000000000..8f15a563e --- /dev/null +++ b/vendor/github.com/opencloud-eu/reva/v2/pkg/share/manager/jsoncs3/migrations/0001_import_spacemembers.go @@ -0,0 +1,435 @@ +// Copyright 2026 OpenCloud GmbH +// +// Licensed under the Apache License, Version 2.0 (the "License"); +// you may not use this file except in compliance with the License. +// You may obtain a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, +// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +// See the License for the specific language governing permissions and +// limitations under the License. +// +// In applying this license, CERN does not waive the privileges and immunities +// granted to it by virtue of its status as an Intergovernmental Organization +// or submit itself to any jurisdiction. + +package migration + +import ( + "context" + "encoding/json" + "fmt" + "sync" + "time" + + "github.com/cenkalti/backoff" + grouppb "github.com/cs3org/go-cs3apis/cs3/identity/group/v1beta1" + userpb "github.com/cs3org/go-cs3apis/cs3/identity/user/v1beta1" + rpc "github.com/cs3org/go-cs3apis/cs3/rpc/v1beta1" + collaboration "github.com/cs3org/go-cs3apis/cs3/sharing/collaboration/v1beta1" + provider "github.com/cs3org/go-cs3apis/cs3/storage/provider/v1beta1" + registry "github.com/cs3org/go-cs3apis/cs3/storage/registry/v1beta1" + typesv1beta1 "github.com/cs3org/go-cs3apis/cs3/types/v1beta1" + "github.com/google/uuid" + ctxpkg "github.com/opencloud-eu/reva/v2/pkg/ctx" + "github.com/opencloud-eu/reva/v2/pkg/errtypes" + "github.com/opencloud-eu/reva/v2/pkg/rgrpc/todo/pool" + "github.com/opencloud-eu/reva/v2/pkg/share" + "github.com/opencloud-eu/reva/v2/pkg/share/manager/jsoncs3/shareid" + "github.com/opencloud-eu/reva/v2/pkg/utils" + "github.com/rs/zerolog" + "google.golang.org/grpc" +) + +// storageProvider is the narrow subset of provider.ProviderAPIClient that the +// migration actually uses. Keeping it narrow makes test stubs trivial to write. +type storageProvider interface { + ListGrants(ctx context.Context, in *provider.ListGrantsRequest, opts ...grpc.CallOption) (*provider.ListGrantsResponse, error) +} + +type ImportSpaceMembersMigration struct { + cfg config + sharesChan chan *collaboration.Share + receivedChan chan share.ReceivedShareWithUser + userCache map[string]*userpb.UserId + groupCache map[string]*grouppb.GroupId + providerResolver func(context.Context, *provider.StorageSpace) (storageProvider, error) +} + +func init() { + registerMigration(&ImportSpaceMembersMigration{}) +} + +func (m *ImportSpaceMembersMigration) Initialize(cfg config) { + m.cfg = cfg + m.sharesChan = make(chan *collaboration.Share) + m.receivedChan = make(chan share.ReceivedShareWithUser) + m.userCache = make(map[string]*userpb.UserId) + m.groupCache = make(map[string]*grouppb.GroupId) + m.providerResolver = func(ctx context.Context, space *provider.StorageSpace) (storageProvider, error) { + return m.storageProviderForSpace(ctx, space) + } +} + +func (m *ImportSpaceMembersMigration) Name() string { + return "import_space_members" +} + +func (m *ImportSpaceMembersMigration) Version() int { + return 1 +} + +func (m *ImportSpaceMembersMigration) Migrate() error { + gwc, err := m.cfg.gatewaySelector.Next() + if err != nil { + return err + } + + svcCtx, err := utils.GetServiceUserContextWithContext(context.Background(), gwc, m.cfg.serviceAccountID, m.cfg.serviceAccountSecret) + if err != nil { + m.cfg.logger.Error().Err(err).Msg("failed to get service user context for migration") + return err + } + // List all project spaces. + listRes, err := gwc.ListStorageSpaces(svcCtx, &provider.ListStorageSpacesRequest{ + Opaque: utils.AppendPlainToOpaque(nil, "unrestricted", "true"), + Filters: []*provider.ListStorageSpacesRequest_Filter{ + { + Type: provider.ListStorageSpacesRequest_Filter_TYPE_SPACE_TYPE, + Term: &provider.ListStorageSpacesRequest_Filter_SpaceType{SpaceType: "project"}, + }, + }, + }) + if err != nil { + m.cfg.logger.Error().Err(err).Msg("space-membership migration: failed to list storage spaces") + return err + } + + if listRes.GetStatus().GetCode() != rpc.Code_CODE_OK { + m.cfg.logger.Error().Str("status", listRes.GetStatus().GetMessage()).Msg("space-membership migration: ListStorageSpaces returned non-OK status") + return errtypes.InternalError("ListStorageSpaces") + } + + spaces := listRes.GetStorageSpaces() + m.cfg.logger.Info().Int("spaces", len(spaces)).Msg("Starting migration") + + // loadCtx is cancelled when the producer finishes (or fails) so that the + // Load goroutine — which blocks reading from the channels — is not left + // waiting forever if we return early from an error. + loadCtx, cancelLoad := context.WithCancel(svcCtx) + defer cancelLoad() + + var wg sync.WaitGroup + var loaderError error + wg.Go(func() { + loaderError = m.cfg.loader.Load(loadCtx, m.sharesChan, m.receivedChan) + }) + + migrated := 0 + for _, space := range spaces { + sharesCreated, err := m.migrateSpace(loadCtx, space) + if err != nil { + m.cfg.logger.Error().Err(err).Str("space", space.GetId().GetOpaqueId()).Msg("failed to migrate space; continuing with remaining spaces") + continue + } + migrated++ + m.cfg.logger.Debug(). + Str("space", space.GetId().GetOpaqueId()). + Int("shares_created", sharesCreated). + Msg("space migrated") + if migrated%10 == 0 { + m.cfg.logger.Info(). + Int("migrated", migrated). + Int("total", len(spaces)). + Msg("migration progress") + } + } + close(m.receivedChan) + close(m.sharesChan) + + wg.Wait() + m.cfg.logger.Info().Err(loaderError).Int("migrated", migrated).Int("total", len(spaces)).Msg("Migration finished") + return loaderError +} + +func (m *ImportSpaceMembersMigration) migrateSpace(ctx context.Context, space *provider.StorageSpace) (int, error) { + spClient, err := m.providerResolver(ctx, space) + if err != nil { + return 0, err + } + + ref := &provider.Reference{ResourceId: space.GetRoot()} + grantsRes, err := spClient.ListGrants(ctx, &provider.ListGrantsRequest{Ref: ref}) + if err != nil { + return 0, err + } + if grantsRes.GetStatus().GetCode() != rpc.Code_CODE_OK { + return 0, errtypes.NewErrtypeFromStatus(grantsRes.GetStatus()) + } + + sharesCreated := 0 + for _, grant := range grantsRes.GetGrants() { + share, receivedShares, err := m.spaceGrantToShares(ctx, grant, space) + if err != nil { + m.cfg.logger.Error().Err(err). + Interface("grant", grant). + Msg("Failed to convert grant to shares") + continue + } + if share == nil { + // share already existed; nothing to import for this grant + continue + } + + select { + case m.sharesChan <- share: + case <-ctx.Done(): + return sharesCreated, ctx.Err() + } + for _, rs := range receivedShares { + select { + case m.receivedChan <- rs: + case <-ctx.Done(): + return sharesCreated, ctx.Err() + } + } + sharesCreated++ + } + return sharesCreated, nil +} + +// resolveRetries is the maximum number of times resolveUserID / resolveGroupID +// will retry after receiving an errtypes.Unavailable response (LDAP down). +const resolveRetries = 10 + +// retryOnUnavailable calls op, retrying with exponential backoff whenever op +// returns errtypes.Unavailable. Any other error (including context +// cancellation) stops the loop immediately and is returned as-is. +// Retries are capped at resolveRetries attempts and respect ctx cancellation. +func retryOnUnavailable(ctx context.Context, log zerolog.Logger, op func() error) error { + b := backoff.WithContext( + backoff.WithMaxRetries(backoff.NewExponentialBackOff(), resolveRetries), + ctx, + ) + notify := func(err error, d time.Duration) { + log.Warn().Err(err).Dur("retry_in", d).Msg("identity provider temporarily unavailable, retrying") + } + return backoff.RetryNotify(func() error { + err := op() + if err == nil { + return nil + } + if _, ok := err.(errtypes.Unavailable); ok { + return err // transient — keep retrying + } + return backoff.Permanent(err) // permanent — stop immediately + }, b, notify) +} + +func (m *ImportSpaceMembersMigration) resolveUserID(ctx context.Context, opaqueID string) (*userpb.UserId, error) { + if id, ok := m.userCache[opaqueID]; ok { + return id, nil + } + var id *userpb.UserId + err := retryOnUnavailable(ctx, m.cfg.logger, func() error { + gwc, err := m.cfg.gatewaySelector.Next() + if err != nil { + return err + } + res, err := gwc.GetUser(ctx, &userpb.GetUserRequest{ + UserId: &userpb.UserId{OpaqueId: opaqueID}, + SkipFetchingUserGroups: true, + }) + if err != nil { + return err + } + if res.GetStatus().GetCode() != rpc.Code_CODE_OK { + // errtypes.NewErrtypeFromStatus maps CODE_UNAVAILABLE → errtypes.Unavailable, + // which retryOnUnavailable will retry; all other codes are treated as permanent. + return errtypes.NewErrtypeFromStatus(res.GetStatus()) + } + id = res.GetUser().GetId() + return nil + }) + if err != nil { + return nil, err + } + m.userCache[opaqueID] = id + return id, nil +} + +func (m *ImportSpaceMembersMigration) resolveGroupID(ctx context.Context, opaqueID string) (*grouppb.GroupId, error) { + if id, ok := m.groupCache[opaqueID]; ok { + return id, nil + } + var id *grouppb.GroupId + err := retryOnUnavailable(ctx, m.cfg.logger, func() error { + gwc, err := m.cfg.gatewaySelector.Next() + if err != nil { + return err + } + res, err := gwc.GetGroup(ctx, &grouppb.GetGroupRequest{ + GroupId: &grouppb.GroupId{OpaqueId: opaqueID}, + SkipFetchingMembers: true, + }) + if err != nil { + return err + } + if res.GetStatus().GetCode() != rpc.Code_CODE_OK { + return errtypes.NewErrtypeFromStatus(res.GetStatus()) + } + id = res.GetGroup().GetId() + return nil + }) + if err != nil { + return nil, err + } + m.groupCache[opaqueID] = id + return id, nil +} + +func (m *ImportSpaceMembersMigration) spaceGrantToShares(ctx context.Context, grant *provider.Grant, space *provider.StorageSpace) (*collaboration.Share, []share.ReceivedShareWithUser, error) { + // The grantee ids as persisted on disk do not have an IDP or type stored as + // part of the userid/groupid. Resolve them via the gateway so we get the + // full userid + switch grant.GetGrantee().GetType() { + case provider.GranteeType_GRANTEE_TYPE_GROUP: + groupID, err := m.resolveGroupID(ctx, grant.GetGrantee().GetGroupId().GetOpaqueId()) + if err != nil { + return nil, nil, fmt.Errorf("resolve group %s: %w", grant.GetGrantee().GetGroupId().GetOpaqueId(), err) + } + grant.Grantee.Id = &provider.Grantee_GroupId{GroupId: groupID} + case provider.GranteeType_GRANTEE_TYPE_USER: + userID, err := m.resolveUserID(ctx, grant.GetGrantee().GetUserId().GetOpaqueId()) + if err != nil { + return nil, nil, fmt.Errorf("resolve user %s: %w", grant.GetGrantee().GetUserId().GetOpaqueId(), err) + } + grant.Grantee.Id = &provider.Grantee_UserId{UserId: userID} + } + + ref := &collaboration.ShareReference{ + Spec: &collaboration.ShareReference_Key{ + Key: &collaboration.ShareKey{ + ResourceId: space.GetRoot(), + Grantee: grant.GetGrantee(), + }, + }, + } + + ctx = ctxpkg.ContextSetUser(ctx, &userpb.User{Id: grant.Creator}) + if s, err := m.cfg.manager.GetShare(ctx, ref); err == nil { + // FIXME: Verify the actual grants? + m.cfg.logger.Debug().Interface("share", s).Msg("share already exists") + return nil, nil, nil + } + + ts := utils.TSNow() + shareID := shareid.Encode(space.GetRoot().GetStorageId(), space.GetRoot().GetSpaceId(), uuid.NewString()) + + creator := grant.GetCreator() + if creator.Type == userpb.UserType_USER_TYPE_INVALID { + creator = nil + } + newShare := &collaboration.Share{ + Id: &collaboration.ShareId{OpaqueId: shareID}, + ResourceId: space.GetRoot(), + Permissions: &collaboration.SharePermissions{Permissions: grant.GetPermissions()}, + Grantee: grant.GetGrantee(), + Expiration: grant.GetExpiration(), + Owner: creator, + Creator: creator, + Ctime: ts, + Mtime: ts, + } + + var newReceivedShares []share.ReceivedShareWithUser + switch grant.GetGrantee().GetType() { + case provider.GranteeType_GRANTEE_TYPE_GROUP: + gwc, err := m.cfg.gatewaySelector.Next() + if err != nil { + m.cfg.logger.Error().Err(err).Msg("Failed to get gateway client") + return nil, nil, err + } + + gr, err := gwc.GetMembers(ctx, &grouppb.GetMembersRequest{ + GroupId: grant.GetGrantee().GetGroupId(), + }) + if err != nil { + m.cfg.logger.Error().Err(err).Msg("Failed to expand group membership") + return nil, nil, err + } + if gr.GetStatus().GetCode() != rpc.Code_CODE_OK { + m.cfg.logger.Error().Str("Status", gr.GetStatus().GetMessage()).Msg("Failed to expand group membership") + return nil, nil, errtypes.NewErrtypeFromStatus(gr.GetStatus()) + } + for _, u := range gr.GetMembers() { + newReceivedShares = append(newReceivedShares, share.ReceivedShareWithUser{ + UserID: u, + ReceivedShare: &collaboration.ReceivedShare{ + Share: newShare, + State: collaboration.ShareState_SHARE_STATE_ACCEPTED, + }, + }) + } + // Also add a group-level entry (UserID == nil) so the group cache is populated. + newReceivedShares = append(newReceivedShares, share.ReceivedShareWithUser{ + UserID: nil, + ReceivedShare: &collaboration.ReceivedShare{ + Share: newShare, + State: collaboration.ShareState_SHARE_STATE_ACCEPTED, + }, + }) + case provider.GranteeType_GRANTEE_TYPE_USER: + newReceivedShares = append(newReceivedShares, share.ReceivedShareWithUser{ + UserID: grant.GetGrantee().GetUserId(), + ReceivedShare: &collaboration.ReceivedShare{ + Share: newShare, + State: collaboration.ShareState_SHARE_STATE_ACCEPTED, + }, + }) + } + return newShare, newReceivedShares, nil +} + +// storageProviderForSpace resolves the storageprovider responsible for the +// given storage space and returns a dialled client. In the default opencloud +// deployment the storage registry is co-located with the gateway, so +// the GatewayAddr is used as the registry address. +func (m *ImportSpaceMembersMigration) storageProviderForSpace(ctx context.Context, space *provider.StorageSpace) (provider.ProviderAPIClient, error) { + + srClient, err := pool.GetStorageRegistryClient(m.cfg.providerRegistryAddr) + if err != nil { + return nil, fmt.Errorf("get storage registry client: %w", err) + } + + spaceJSON, err := json.Marshal(space) + if err != nil { + return nil, fmt.Errorf("marshal space: %w", err) + } + + res, err := srClient.GetStorageProviders(ctx, ®istry.GetStorageProvidersRequest{ + Opaque: &typesv1beta1.Opaque{ + Map: map[string]*typesv1beta1.OpaqueEntry{ + "space": { + Decoder: "json", + Value: spaceJSON, + }, + }, + }, + }) + if err != nil { + return nil, fmt.Errorf("GetStorageProviders: %w", err) + } + if len(res.GetProviders()) == 0 { + return nil, fmt.Errorf("no storage provider found for space %s", space.GetId().GetOpaqueId()) + } + + c, err := pool.GetStorageProviderServiceClient(res.GetProviders()[0].GetAddress()) + if err != nil { + return nil, fmt.Errorf("dial storage provider: %w", err) + } + return c, nil +} diff --git a/vendor/github.com/opencloud-eu/reva/v2/pkg/share/manager/jsoncs3/migrations/migration.go b/vendor/github.com/opencloud-eu/reva/v2/pkg/share/manager/jsoncs3/migrations/migration.go new file mode 100644 index 000000000..94fd7af49 --- /dev/null +++ b/vendor/github.com/opencloud-eu/reva/v2/pkg/share/manager/jsoncs3/migrations/migration.go @@ -0,0 +1,353 @@ +// Copyright 2026 OpenCloud GmbH +// +// Licensed under the Apache License, Version 2.0 (the "License"); +// you may not use this file except in compliance with the License. +// You may obtain a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, +// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +// See the License for the specific language governing permissions and +// limitations under the License. +// +// In applying this license, CERN does not waive the privileges and immunities +// granted to it by virtue of its status as an Intergovernmental Organization +// or submit itself to any jurisdiction. + +package migration + +import ( + "cmp" + "context" + "crypto/rand" + "encoding/json" + "fmt" + "os" + "os/signal" + "slices" + "syscall" + "time" + + gatewayv1beta1 "github.com/cs3org/go-cs3apis/cs3/gateway/v1beta1" + "github.com/opencloud-eu/reva/v2/pkg/errtypes" + "github.com/opencloud-eu/reva/v2/pkg/rgrpc/todo/pool" + "github.com/opencloud-eu/reva/v2/pkg/share" + "github.com/opencloud-eu/reva/v2/pkg/storage/utils/metadata" + "github.com/rs/zerolog" +) + +const stateFile = "migrations/state.json" + +const ( + lockFile = "migrations/lock.json" + lockTTL = time.Minute + lockHeartbeatInterval = 20 * time.Second +) + +// lockPollInterval is how long acquireLock sleeps between retries when the +// lock is held by another instance. Declared as a variable so tests can +// shorten it without rebuilding. +var lockPollInterval = 5 * time.Second + +// lockData is the content written to the lock file. +type lockData struct { + Timestamp time.Time `json:"timestamp"` + InstanceID string `json:"instance_id"` +} + +type migration interface { + Name() string + Version() int + Initialize(config) + Migrate() error +} + +// persistedState is the on-disk representation of the migration state. +type persistedState struct { + Version int `json:"version"` +} + +type state struct { + version int +} + +// MigrationConfig holds all caller-supplied options for a migration run. +// It is intentionally a plain struct so that new fields can be added without +// changing function signatures throughout the call chain. +type MigrationConfig struct { + ServiceAccountID string + ServiceAccountSecret string + ProviderRegistryAddr string +} + +type config struct { + logger zerolog.Logger + gatewaySelector pool.Selectable[gatewayv1beta1.GatewayAPIClient] + storage metadata.Storage + serviceAccountID string + serviceAccountSecret string + providerRegistryAddr string + manager share.Manager + loader share.LoadableManager +} + +type Migrations struct { + config + state state + instanceID string +} + +var migrations []migration + +// registerMigration is only supposed to be call from init(), which runs sequentially +// so we don't need ot protect migrations with a lock +func registerMigration(m migration) { + migrations = append(migrations, m) +} + +func New(logger zerolog.Logger, + gatewaySelector pool.Selectable[gatewayv1beta1.GatewayAPIClient], + storage metadata.Storage, + cfg MigrationConfig, + manager share.Manager, + loader share.LoadableManager, +) Migrations { + + slices.SortFunc(migrations, func(a, b migration) int { + return cmp.Compare(a.Version(), b.Version()) + }) + + b := make([]byte, 8) + _, _ = rand.Read(b) + instanceID := fmt.Sprintf("%x", b) + + return Migrations{ + config{ + logger: logger.With().Str("jsoncs3", "migrations").Logger(), + gatewaySelector: gatewaySelector, + storage: storage, + serviceAccountID: cfg.ServiceAccountID, + serviceAccountSecret: cfg.ServiceAccountSecret, + providerRegistryAddr: cfg.ProviderRegistryAddr, + manager: manager, + loader: loader, + }, + state{}, + instanceID, + } +} + +// acquireLock tries to atomically create the lock file, blocking until the lock +// is obtained. It returns the etag of the lock file on success. It retries +// indefinitely until ctx is cancelled. A lock whose timestamp is older than +// lockTTL is considered stale and will be taken over. +func (m *Migrations) acquireLock(ctx context.Context) (string, error) { + m.logger.Debug().Str("instance", m.instanceID).Msg("acquiring migration lock") + for { + // Fast path: create the lock file only if it does not exist yet. + data, err := json.Marshal(lockData{Timestamp: time.Now(), InstanceID: m.instanceID}) + if err != nil { + return "", err + } + res, err := m.storage.Upload(ctx, metadata.UploadRequest{ + Path: lockFile, + Content: data, + IfNoneMatch: []string{"*"}, + }) + if err == nil { + m.logger.Debug().Str("instance", m.instanceID).Msg("migration lock acquired") + return res.Etag, nil + } + + // Propagate context cancellation immediately. + select { + case <-ctx.Done(): + return "", ctx.Err() + default: + } + + // Any error other than a conflict means something unexpected happened. + if !isConflict(err) { + return "", err + } + + // Lock file already exists — read it to decide whether it is stale. + dl, err := m.storage.Download(ctx, metadata.DownloadRequest{Path: lockFile}) + if err != nil { + if _, ok := err.(errtypes.IsNotFound); ok { + // Lock was released between our upload attempt and the download; + // retry acquiring it immediately. + m.logger.Debug().Str("instance", m.instanceID).Msg("migration lock vanished during read; retrying") + continue + } + return "", err + } + + var existing lockData + stale := true + if err := json.Unmarshal(dl.Content, &existing); err == nil { + stale = time.Since(existing.Timestamp) > lockTTL + } + + if stale { + m.logger.Debug(). + Str("instance", m.instanceID). + Str("held_by", existing.InstanceID). + Time("lock_timestamp", existing.Timestamp). + Msg("migration lock is stale; attempting takeover") + + // Atomically take over the stale lock using the etag we just read. + newData, err := json.Marshal(lockData{Timestamp: time.Now(), InstanceID: m.instanceID}) + if err != nil { + return "", err + } + res, err := m.storage.Upload(ctx, metadata.UploadRequest{ + Path: lockFile, + Content: newData, + IfMatchEtag: dl.Etag, + }) + if err == nil { + m.logger.Debug().Str("instance", m.instanceID).Msg("migration lock acquired via stale takeover") + return res.Etag, nil + } + // Another instance took the stale lock before us; loop and retry. + m.logger.Debug().Str("instance", m.instanceID).Err(err).Msg("stale lock takeover lost race; retrying") + continue + } + + m.logger.Debug(). + Str("instance", m.instanceID). + Str("held_by", existing.InstanceID). + Time("lock_timestamp", existing.Timestamp). + Dur("poll_interval", lockPollInterval). + Msg("migration lock held by another instance; waiting") + + // Lock is fresh and held by another instance; wait before retrying. + select { + case <-ctx.Done(): + return "", ctx.Err() + case <-time.After(lockPollInterval): + } + } +} + +// startHeartbeat spawns a goroutine that periodically renews the lock file so +// that it is not considered stale while a long migration is running. Call the +// returned cancel function to stop the heartbeat. +func (m *Migrations) startHeartbeat(ctx context.Context, etag string) context.CancelFunc { + hbCtx, cancel := context.WithCancel(ctx) + go func() { + ticker := time.NewTicker(lockHeartbeatInterval) + defer ticker.Stop() + for { + select { + case <-hbCtx.Done(): + return + case <-ticker.C: + data, err := json.Marshal(lockData{Timestamp: time.Now(), InstanceID: m.instanceID}) + if err != nil { + m.logger.Warn().Err(err).Msg("failed to marshal heartbeat data for migration lock") + return + } + res, err := m.storage.Upload(hbCtx, metadata.UploadRequest{ + Path: lockFile, + Content: data, + IfMatchEtag: etag, + }) + if err != nil { + m.logger.Warn().Err(err).Msg("failed to renew migration lock; another instance may take over") + return + } + etag = res.Etag + } + } + }() + return cancel +} + +// releaseLock deletes the lock file unconditionally. +func (m *Migrations) releaseLock(ctx context.Context) { + if err := m.storage.Delete(ctx, lockFile); err != nil { + m.logger.Warn().Err(err).Msg("failed to release migration lock") + } +} + +// isConflict returns true for errors that signal a conditional-upload conflict, +// i.e. the lock file already exists or the etag did not match. +func isConflict(err error) bool { + switch err.(type) { + case errtypes.IsAlreadyExists, errtypes.IsAborted, errtypes.IsPreconditionFailed: + return true + } + return false +} + +// loadState reads the persisted migration version from storage. If no state +// file exists yet (fresh deployment) it returns version 0 without error. +func (m *Migrations) loadState(ctx context.Context) error { + data, err := m.storage.SimpleDownload(ctx, stateFile) + if err != nil { + if _, ok := err.(errtypes.IsNotFound); ok { + m.state = state{version: 0} + return nil + } + return err + } + var ps persistedState + if err := json.Unmarshal(data, &ps); err != nil { + return err + } + m.state = state{version: ps.Version} + return nil +} + +// saveState writes the current migration version to storage so that already- +// applied migrations are not re-run on the next server start. +func (m *Migrations) saveState(ctx context.Context) error { + data, err := json.Marshal(persistedState{Version: m.state.version}) + if err != nil { + return err + } + return m.storage.SimpleUpload(ctx, stateFile, data) +} + +func (m *Migrations) RunMigrations() { + ctx, stop := signal.NotifyContext(context.Background(), os.Interrupt, syscall.SIGTERM) + defer stop() + + etag, err := m.acquireLock(ctx) + if err != nil { + m.logger.Error().Err(err).Msg("failed to acquire migration lock; skipping migrations") + return + } + cancelHB := m.startHeartbeat(ctx, etag) + defer cancelHB() + defer m.releaseLock(ctx) + + if err := m.loadState(ctx); err != nil { + m.logger.Error().Err(err).Msg("failed to load migration state; skipping migrations") + return + } + + m.logger.Info().Int("current state", m.state.version).Msg("checking migrations") + + for _, mig := range migrations { + if mig.Version() > m.state.version { + m.logger.Info().Str("migration", mig.Name()).Int("version", mig.Version()).Msg("running migration") + mig.Initialize(m.config) + if err := mig.Migrate(); err != nil { + m.logger.Error().Err(err).Str("migration", mig.Name()).Msg("migration failed; stopping") + return + } + m.state.version = mig.Version() + if err := m.saveState(ctx); err != nil { + m.logger.Error().Err(err).Msg("failed to save migration state; stopping") + return + } + } else { + m.logger.Info().Str("migration", mig.Name()).Int("version", mig.Version()).Msg("skipping migration") + } + } +} diff --git a/vendor/github.com/opencloud-eu/reva/v2/pkg/share/manager/memory/memory.go b/vendor/github.com/opencloud-eu/reva/v2/pkg/share/manager/memory/memory.go index 8ade5926f..0f34d3a68 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/pkg/share/manager/memory/memory.go +++ b/vendor/github.com/opencloud-eu/reva/v2/pkg/share/manager/memory/memory.go @@ -28,6 +28,7 @@ import ( ctxpkg "github.com/opencloud-eu/reva/v2/pkg/ctx" "github.com/opencloud-eu/reva/v2/pkg/share" + "github.com/rs/zerolog" "google.golang.org/genproto/protobuf/field_mask" userv1beta1 "github.com/cs3org/go-cs3apis/cs3/identity/user/v1beta1" @@ -46,7 +47,7 @@ func init() { } // New returns a new manager. -func New(c map[string]interface{}) (share.Manager, error) { +func New(c map[string]any, _ *zerolog.Logger) (share.Manager, error) { state := map[string]map[*collaboration.ShareId]collaboration.ShareState{} mp := map[string]map[*collaboration.ShareId]*provider.Reference{} return &manager{ diff --git a/vendor/github.com/opencloud-eu/reva/v2/pkg/share/manager/registry/registry.go b/vendor/github.com/opencloud-eu/reva/v2/pkg/share/manager/registry/registry.go index 16fc627ff..6b22beb77 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/pkg/share/manager/registry/registry.go +++ b/vendor/github.com/opencloud-eu/reva/v2/pkg/share/manager/registry/registry.go @@ -18,11 +18,14 @@ package registry -import "github.com/opencloud-eu/reva/v2/pkg/share" +import ( + "github.com/opencloud-eu/reva/v2/pkg/share" + "github.com/rs/zerolog" +) // NewFunc is the function that share managers // should register at init time. -type NewFunc func(map[string]interface{}) (share.Manager, error) +type NewFunc func(map[string]any, *zerolog.Logger) (share.Manager, error) // NewFuncs is a map containing all the registered share managers. var NewFuncs = map[string]NewFunc{} diff --git a/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/cache/kv.go b/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/cache/kv.go index 9ce096f1b..94c134d3a 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/cache/kv.go +++ b/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/cache/kv.go @@ -72,7 +72,7 @@ func NewNatsKeyValueFromJetStream(c Config, js jetstream.JetStream) (jetstream.K if err != nil { kvConfig := jetstream.KeyValueConfig{ Bucket: c.Database, - TTL: 0, // we don't do TTLs for this store + TTL: c.TTL, } if c.DisablePersistence { kvConfig.Storage = jetstream.MemoryStorage diff --git a/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/idcache/idcache.go b/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/idcache/idcache.go index 861e19180..0228dd5d7 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/idcache/idcache.go +++ b/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/idcache/idcache.go @@ -65,16 +65,16 @@ func (c *IDCache) DeleteByPath(ctx context.Context, path string) error { } else { err := c.kv.Purge(ctx, baseKey) if err != nil && err != nats.ErrKeyNotFound { - appctx.GetLogger(ctx).Error().Err(err).Str("record", path).Str("spaceID", spaceID).Str("nodeID", nodeID).Msg("could not get spaceID and nodeID from cache") + appctx.GetLogger(ctx).Error().Err(err).Str("record", baseKey).Str("spaceID", spaceID).Str("nodeID", nodeID).Msg("could not purge from cache") } err = c.kv.Purge(ctx, cacheKey(spaceID, nodeID)) if err != nil && err != nats.ErrKeyNotFound { - appctx.GetLogger(ctx).Error().Err(err).Str("record", path).Str("spaceID", spaceID).Str("nodeID", nodeID).Msg("could not get spaceID and nodeID from cache") + appctx.GetLogger(ctx).Error().Err(err).Str("record", cacheKey(spaceID, nodeID)).Str("spaceID", spaceID).Str("nodeID", nodeID).Msg("could not purge from cache") } } - watcher, err := c.kv.Watch(ctx, baseKey+".*") + watcher, err := c.kv.Watch(ctx, baseKey+".>") if err != nil { return err } @@ -85,7 +85,6 @@ func (c *IDCache) DeleteByPath(ctx context.Context, path string) error { break } key := update.Key() - spaceID, nodeID, ok := c.getByReverseCacheKey(ctx, key) if !ok { appctx.GetLogger(ctx).Error().Str("record", key).Msg("could not get spaceID and nodeID from cache") @@ -94,12 +93,12 @@ func (c *IDCache) DeleteByPath(ctx context.Context, path string) error { err := c.kv.Purge(ctx, key) if err != nil && err != nats.ErrKeyNotFound { - appctx.GetLogger(ctx).Error().Err(err).Str("record", key).Str("spaceID", spaceID).Str("nodeID", nodeID).Msg("could not get spaceID and nodeID from cache") + appctx.GetLogger(ctx).Error().Err(err).Str("record", key).Str("spaceID", spaceID).Str("nodeID", nodeID).Msg("could not purge from cache") } err = c.kv.Purge(ctx, cacheKey(spaceID, nodeID)) if err != nil && err != nats.ErrKeyNotFound { - appctx.GetLogger(ctx).Error().Err(err).Str("record", key).Str("spaceID", spaceID).Str("nodeID", nodeID).Msg("could not get spaceID and nodeID from cache") + appctx.GetLogger(ctx).Error().Err(err).Str("record", cacheKey(spaceID, nodeID)).Str("spaceID", spaceID).Str("nodeID", nodeID).Msg("could not purge from cache") } } return nil diff --git a/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/posix.go b/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/posix.go index ed807f901..9c60f3a68 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/posix.go +++ b/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/posix.go @@ -24,6 +24,7 @@ import ( "os" "path/filepath" "syscall" + "time" "github.com/rs/zerolog" tusd "github.com/tus/tusd/v2/pkg/handler" @@ -58,7 +59,8 @@ func init() { type posixFS struct { storage.FS - um usermapper.Mapper + tree *tree.Tree + um usermapper.Mapper } // New returns an implementation to of the storage.FS interface that talk to @@ -70,6 +72,7 @@ func NewDefault(m map[string]interface{}, stream events.Stream, log *zerolog.Log } o.IDCache.Database += "_v2" // Use a versioned bucket name to avoid conflicts with previous implementations + o.IDCache.TTL = 0 // Disable TTL for the ID cache, as the posix driver relies on it for caching file IDs and we don't want them to expire kv, err := cache.NewNatsKeyValue(o.IDCache) if err != nil { return nil, errors.Wrap(err, "could not create nats key value store") @@ -80,6 +83,7 @@ func NewDefault(m map[string]interface{}, stream events.Stream, log *zerolog.Log } o.IDCache.Database += "_history" // Use a versioned bucket name to avoid conflicts with previous implementations + o.IDCache.TTL = 24 * 60 * time.Minute historyKv, err := cache.NewNatsKeyValue(o.IDCache) if err != nil { return nil, errors.Wrap(err, "could not create nats key value store") @@ -215,11 +219,17 @@ func New(o *options.Options, stream events.Stream, cache, historyCache *idcache. mw := middleware.NewFS(dfs, hooks...) fs.FS = mw + fs.tree = tp fs.um = um return fs, nil } +// WarmupIDCache allows triggering a posix fs scan and id cache warmup manually. +func (fs *posixFS) WarmupIDCache(root string, assimilate, onlyDirty bool) error { + return fs.tree.WarmupIDCache(root, assimilate, onlyDirty) +} + // ListUploadSessions returns the upload sessions matching the given filter func (fs *posixFS) ListUploadSessions(ctx context.Context, filter storage.UploadSessionFilter) ([]storage.UploadSession, error) { return fs.FS.(storage.UploadSessionLister).ListUploadSessions(ctx, filter) diff --git a/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/tree/tree.go b/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/tree/tree.go index f3f8fb9c1..ff510bbc2 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/tree/tree.go +++ b/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/tree/tree.go @@ -37,10 +37,8 @@ import ( "go.opentelemetry.io/otel/trace" "golang.org/x/sync/errgroup" - user "github.com/cs3org/go-cs3apis/cs3/identity/user/v1beta1" provider "github.com/cs3org/go-cs3apis/cs3/storage/provider/v1beta1" - "github.com/opencloud-eu/reva/v2/pkg/appctx" "github.com/opencloud-eu/reva/v2/pkg/errtypes" "github.com/opencloud-eu/reva/v2/pkg/events" "github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/blobstore" @@ -590,11 +588,6 @@ func (t *Tree) Delete(ctx context.Context, n *node.Node) error { } }() - if appctx.DeletingSharedResourceFromContext(ctx) { - src := filepath.Join(n.ParentPath(), n.Name) - return os.RemoveAll(src) - } - var sizeDiff int64 if n.IsDir(ctx) { treesize, err := n.GetTreeSize(ctx) @@ -819,11 +812,3 @@ func isLockFile(path string) bool { func isTrash(path string) bool { return strings.HasSuffix(path, ".trashinfo") || strings.HasSuffix(path, ".trashitem") || strings.Contains(path, ".Trash") } - -func (t *Tree) AddLabel(ctx context.Context, ref *provider.Reference, userID *user.UserId, label string) error { - return errtypes.NotSupported("AddLabel not implemented") -} - -func (t *Tree) RemoveLabel(ctx context.Context, ref *provider.Reference, userID *user.UserId, label string) error { - return errtypes.NotSupported("RemoveLabel not implemented") -} diff --git a/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/pkg/decomposedfs/node/permissions.go b/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/pkg/decomposedfs/node/permissions.go index 6b1beb37d..9fe2a459f 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/pkg/decomposedfs/node/permissions.go +++ b/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/pkg/decomposedfs/node/permissions.go @@ -101,6 +101,7 @@ func ServiceAccountPermissions() *provider.ResourcePermissions { Delete: true, // for cli restore command with replace option CreateContainer: true, // for space provisioning AddGrant: true, // for initial project space member assignment + ListGrants: true, // for initial project space member assignment } } diff --git a/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/pkg/decomposedfs/tree/tree.go b/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/pkg/decomposedfs/tree/tree.go index 47d6ab058..c718b3f16 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/pkg/decomposedfs/tree/tree.go +++ b/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/pkg/decomposedfs/tree/tree.go @@ -429,11 +429,6 @@ func (t *Tree) Delete(ctx context.Context, n *node.Node) (err error) { // remove entry from cache immediately to avoid inconsistencies defer func() { _ = t.idCache.Delete(path) }() - if appctx.DeletingSharedResourceFromContext(ctx) { - src := filepath.Join(n.ParentPath(), n.Name) - return os.Remove(src) - } - // get the original path origin, err := t.lookup.Path(ctx, n, node.NoCheck) if err != nil { diff --git a/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/utils/decomposedfs/tree/tree.go b/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/utils/decomposedfs/tree/tree.go index 1162836ea..6fdf2df3c 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/utils/decomposedfs/tree/tree.go +++ b/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/utils/decomposedfs/tree/tree.go @@ -445,11 +445,6 @@ func (t *Tree) Delete(ctx context.Context, n *node.Node) (err error) { // remove entry from cache immediately to avoid inconsistencies defer func() { _ = t.idCache.Delete(path) }() - if appctx.DeletingSharedResourceFromContext(ctx) { - src := filepath.Join(n.ParentPath(), n.Name) - return os.Remove(src) - } - // get the original path origin, err := t.lookup.Path(ctx, n, node.NoCheck) if err != nil { diff --git a/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/utils/metadata/disk.go b/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/utils/metadata/disk.go index 6eae43e63..5caef632d 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/utils/metadata/disk.go +++ b/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/utils/metadata/disk.go @@ -93,6 +93,40 @@ func (disk *Disk) SimpleUpload(ctx context.Context, uploadpath string, content [ // Upload stores a file on disk func (disk *Disk) Upload(_ context.Context, req UploadRequest) (*UploadResponse, error) { p := disk.targetPath(req.Path) + + // IfNoneMatch: ["*"] means create the file only if it does not already + // exist. Use O_EXCL so the check and the create are atomic on the local + // filesystem. + for _, tag := range req.IfNoneMatch { + if tag != "*" { + continue + } + f, err := os.OpenFile(p, os.O_WRONLY|os.O_CREATE|os.O_EXCL, 0644) + if err != nil { + if errors.Is(err, os.ErrExist) { + return nil, errtypes.AlreadyExists(p) + } + return nil, err + } + if _, err := f.Write(req.Content); err != nil { + _ = f.Close() + return nil, err + } + if err := f.Close(); err != nil { + return nil, err + } + info, err := os.Stat(p) + if err != nil { + return nil, err + } + res := &UploadResponse{} + res.Etag, err = calcEtag(info.ModTime(), info.Size()) + if err != nil { + return nil, err + } + return res, nil + } + if req.IfMatchEtag != "" { info, err := os.Stat(p) if err != nil && !errors.Is(err, os.ErrNotExist) { @@ -170,7 +204,10 @@ func (disk *Disk) Download(_ context.Context, req DownloadRequest) (*DownloadRes // SimpleDownload reads a file from disk func (disk *Disk) SimpleDownload(ctx context.Context, downloadpath string) ([]byte, error) { res, err := disk.Download(ctx, DownloadRequest{Path: downloadpath}) - return res.Content, err + if err != nil { + return nil, err + } + return res.Content, nil } // Delete deletes a path diff --git a/vendor/github.com/opencloud-eu/reva/v2/pkg/utils/ldap/identity.go b/vendor/github.com/opencloud-eu/reva/v2/pkg/utils/ldap/identity.go index 9e9804157..fcbd1ae57 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/pkg/utils/ldap/identity.go +++ b/vendor/github.com/opencloud-eu/reva/v2/pkg/utils/ldap/identity.go @@ -266,15 +266,10 @@ func (i *Identity) GetLDAPUserByFilter(ctx context.Context, lc ldap.Client, filt res, err := lc.Search(searchRequest) if err != nil { log.Debug().Str("backend", "ldap").Err(err).Str("userfilter", filter).Msg("Error looking up user by filter") - var errmsg string - if lerr, ok := err.(*ldap.Error); ok { - if lerr.ResultCode == ldap.LDAPResultSizeLimitExceeded { - errmsg = fmt.Sprintf("too many results searching for user '%s'", filter) - } - } - span.SetAttributes(attribute.String("ldap.error", errmsg)) - span.SetStatus(codes.Error, errmsg) - return nil, errtypes.NotFound(errmsg) + classified := classifySearchError(err, fmt.Sprintf("too many results searching for user '%s'", filter)) + span.SetAttributes(attribute.String("ldap.error", classified.Error())) + span.SetStatus(codes.Error, classified.Error()) + return nil, classified } if len(res.Entries) == 0 { return nil, errtypes.NotFound(filter) @@ -306,9 +301,10 @@ func (i *Identity) GetLDAPUserByDN(ctx context.Context, lc ldap.Client, dn strin res, err := lc.Search(searchRequest) if err != nil { log.Debug().Str("backend", "ldap").Err(err).Str("dn", dn).Msg("Error looking up user by DN") - span.SetAttributes(attribute.String("ldap.error", err.Error())) - span.SetStatus(codes.Error, "") - return nil, errtypes.NotFound(dn) + classified := classifySearchError(err, "") + span.SetAttributes(attribute.String("ldap.error", classified.Error())) + span.SetStatus(codes.Error, classified.Error()) + return nil, classified } span.SetStatus(codes.Ok, "") if len(res.Entries) == 0 { @@ -337,9 +333,10 @@ func (i *Identity) GetLDAPUsers(ctx context.Context, lc ldap.Client, query, tena sr, err := lc.Search(searchRequest) if err != nil { log.Debug().Str("backend", "ldap").Err(err).Str("filter", filter).Msg("Error searching users") - span.SetAttributes(attribute.String("ldap.error", err.Error())) - span.SetStatus(codes.Error, "") - return nil, errtypes.NotFound(query) + classified := classifySearchError(err, "") + span.SetAttributes(attribute.String("ldap.error", classified.Error())) + span.SetStatus(codes.Error, classified.Error()) + return nil, classified } span.SetAttributes(attribute.Int("ldap.result_count", len(sr.Entries))) @@ -376,7 +373,8 @@ func (i *Identity) IsLDAPUserInDisabledGroup(ctx context.Context, lc ldap.Client sr, err := lc.Search(searchRequest) if err != nil { log.Error().Str("backend", "ldap").Err(err).Str("filter", filter).Msg("Error looking up error group") - // Err on the side of caution. + // Err on the side of caution: treat search failures (including network + // errors) as if the user is in the disabled group. span.SetAttributes(attribute.String("ldap.error", err.Error())) span.SetStatus(codes.Error, "") return true @@ -423,10 +421,10 @@ func (i *Identity) GetLDAPUserGroups(ctx context.Context, lc ldap.Client, userEn // not having any groups in LDAP return []string{}, nil } - - span.SetAttributes(attribute.String("ldap.error", err.Error())) - span.SetStatus(codes.Error, "") - return []string{}, err + classified := classifySearchError(err, "") + span.SetAttributes(attribute.String("ldap.error", classified.Error())) + span.SetStatus(codes.Error, classified.Error()) + return nil, classified } span.SetStatus(codes.Ok, "") span.SetAttributes(attribute.Int("ldap.result_count", len(sr.Entries))) @@ -504,15 +502,10 @@ func (i *Identity) GetLDAPGroupByFilter(ctx context.Context, lc ldap.Client, fil res, err := lc.Search(searchRequest) if err != nil { log.Debug().Str("backend", "ldap").Err(err).Str("filter", filter).Msg("Error looking up group by filter") - var errmsg string - if lerr, ok := err.(*ldap.Error); ok { - if lerr.ResultCode == ldap.LDAPResultSizeLimitExceeded { - errmsg = fmt.Sprintf("too many results searching for group '%s'", filter) - } - } - span.SetAttributes(attribute.String("ldap.error", errmsg)) - span.SetStatus(codes.Error, "") - return nil, errtypes.NotFound(errmsg) + classified := classifySearchError(err, fmt.Sprintf("too many results searching for group '%s'", filter)) + span.SetAttributes(attribute.String("ldap.error", classified.Error())) + span.SetStatus(codes.Error, classified.Error()) + return nil, classified } if len(res.Entries) == 0 { return nil, errtypes.NotFound(filter) @@ -543,10 +536,11 @@ func (i *Identity) GetLDAPGroups(ctx context.Context, lc ldap.Client, query stri setLDAPSearchSpanAttributes(span, searchRequest) sr, err := lc.Search(searchRequest) if err != nil { - span.SetAttributes(attribute.String("ldap.error", err.Error())) - span.SetStatus(codes.Error, "") log.Debug().Str("backend", "ldap").Err(err).Str("query", query).Msg("Error search for groups") - return nil, errtypes.NotFound(query) + classified := classifySearchError(err, "") + span.SetAttributes(attribute.String("ldap.error", classified.Error())) + span.SetStatus(codes.Error, classified.Error()) + return nil, classified } span.SetStatus(codes.Ok, "") return sr.Entries, nil @@ -919,15 +913,10 @@ func (i *Identity) GetLDAPTenantByFilter(ctx context.Context, lc ldap.Client, fi res, err := lc.Search(searchRequest) if err != nil { log.Debug().Str("backend", "ldap").Err(err).Str("tenantfilter", filter).Msg("Error looking up tenant by filter") - var errmsg string - if lerr, ok := err.(*ldap.Error); ok { - if lerr.ResultCode == ldap.LDAPResultSizeLimitExceeded { - errmsg = fmt.Sprintf("too many results searching for tenant '%s'", filter) - } - } - span.SetAttributes(attribute.String("ldap.error", errmsg)) - span.SetStatus(codes.Error, errmsg) - return nil, errtypes.NotFound(errmsg) + classified := classifySearchError(err, fmt.Sprintf("too many results searching for tenant '%s'", filter)) + span.SetAttributes(attribute.String("ldap.error", classified.Error())) + span.SetStatus(codes.Error, classified.Error()) + return nil, classified } if len(res.Entries) == 0 { return nil, errtypes.NotFound(filter) @@ -980,6 +969,24 @@ func (i *Identity) getTenantAttributeFilter(attribute, value string) (string, er ), nil } +// classifySearchError maps a raw error from lc.Search to the appropriate +// errtypes value: +// - ldap.ErrorNetwork → errtypes.Unavailable (transient; caller should retry) +// - ldap.LDAPResultSizeLimitExceeded → errtypes.NotFound(sizeExceededMsg) +// - anything else → errtypes.NotFound("") (preserving prior behaviour) +// +// The sizeExceededMsg is only used for the SizeLimitExceeded case; pass an +// empty string if the caller does not need a custom message for that case. +func classifySearchError(err error, sizeExceededMsg string) error { + if ldap.IsErrorWithCode(err, ldap.ErrorNetwork) { + return errtypes.Unavailable("ldap server unreachable: " + err.Error()) + } + if sizeExceededMsg != "" && ldap.IsErrorWithCode(err, ldap.LDAPResultSizeLimitExceeded) { + return errtypes.NotFound(sizeExceededMsg) + } + return errtypes.NotFound("") +} + func setLDAPSearchSpanAttributes(span trace.Span, request *ldap.SearchRequest) { span.SetAttributes( attribute.String("ldap.basedn", request.BaseDN), diff --git a/vendor/golang.org/x/crypto/ssh/cipher.go b/vendor/golang.org/x/crypto/ssh/cipher.go index 7554ed57a..ad2b37057 100644 --- a/vendor/golang.org/x/crypto/ssh/cipher.go +++ b/vendor/golang.org/x/crypto/ssh/cipher.go @@ -586,7 +586,7 @@ func (c *cbcCipher) writeCipherPacket(seqNum uint32, w io.Writer, rand io.Reader // Length of encrypted portion of the packet (header, payload, padding). // Enforce minimum padding and packet size. - encLength := maxUInt32(prefixLen+len(packet)+cbcMinPaddingSize, cbcMinPaddingSize) + encLength := maxUInt32(prefixLen+len(packet)+cbcMinPaddingSize, cbcMinPacketSize) // Enforce block size. encLength = (encLength + effectiveBlockSize - 1) / effectiveBlockSize * effectiveBlockSize diff --git a/vendor/golang.org/x/crypto/ssh/client_auth.go b/vendor/golang.org/x/crypto/ssh/client_auth.go index 3127e4990..4f2f75c36 100644 --- a/vendor/golang.org/x/crypto/ssh/client_auth.go +++ b/vendor/golang.org/x/crypto/ssh/client_auth.go @@ -274,10 +274,14 @@ func pickSignatureAlgorithm(signer Signer, extensions map[string][]byte) (MultiA } // Filter algorithms based on those supported by MultiAlgorithmSigner. + // Iterate over the signer's algorithms first to preserve its preference order. + supportedKeyAlgos := algorithmsForKeyFormat(keyFormat) var keyAlgos []string - for _, algo := range algorithmsForKeyFormat(keyFormat) { - if slices.Contains(as.Algorithms(), underlyingAlgo(algo)) { - keyAlgos = append(keyAlgos, algo) + for _, signerAlgo := range as.Algorithms() { + if idx := slices.IndexFunc(supportedKeyAlgos, func(algo string) bool { + return underlyingAlgo(algo) == signerAlgo + }); idx >= 0 { + keyAlgos = append(keyAlgos, supportedKeyAlgos[idx]) } } diff --git a/vendor/golang.org/x/tools/go/packages/golist.go b/vendor/golang.org/x/tools/go/packages/golist.go index 680a70ca8..a6c17cf63 100644 --- a/vendor/golang.org/x/tools/go/packages/golist.go +++ b/vendor/golang.org/x/tools/go/packages/golist.go @@ -61,13 +61,42 @@ func (r *responseDeduper) addAll(dr *DriverResponse) { } func (r *responseDeduper) addPackage(p *Package) { - if r.seenPackages[p.ID] != nil { + if prev := r.seenPackages[p.ID]; prev != nil { + // Package already seen in a previous response. Merge the file lists, + // removing duplicates. This can happen when the same package appears + // in multiple driver responses that are being merged together. + prev.GoFiles = appendUniqueStrings(prev.GoFiles, p.GoFiles) + prev.CompiledGoFiles = appendUniqueStrings(prev.CompiledGoFiles, p.CompiledGoFiles) + prev.OtherFiles = appendUniqueStrings(prev.OtherFiles, p.OtherFiles) + prev.IgnoredFiles = appendUniqueStrings(prev.IgnoredFiles, p.IgnoredFiles) + prev.EmbedFiles = appendUniqueStrings(prev.EmbedFiles, p.EmbedFiles) + prev.EmbedPatterns = appendUniqueStrings(prev.EmbedPatterns, p.EmbedPatterns) return } r.seenPackages[p.ID] = p r.dr.Packages = append(r.dr.Packages, p) } +// appendUniqueStrings appends elements from src to dst, skipping duplicates. +func appendUniqueStrings(dst, src []string) []string { + if len(src) == 0 { + return dst + } + + seen := make(map[string]bool, len(dst)) + for _, s := range dst { + seen[s] = true + } + + for _, s := range src { + if !seen[s] { + dst = append(dst, s) + } + } + + return dst +} + func (r *responseDeduper) addRoot(id string) { if r.seenRoots[id] { return @@ -832,6 +861,8 @@ func golistargs(cfg *Config, words []string, goVersion int) []string { // go list doesn't let you pass -test and -find together, // probably because you'd just get the TestMain. fmt.Sprintf("-find=%t", !cfg.Tests && cfg.Mode&findFlags == 0 && !usesExportData(cfg)), + // VCS information is not needed when not printing Stale or StaleReason fields + "-buildvcs=false", } // golang/go#60456: with go1.21 and later, go list serves pgo variants, which diff --git a/vendor/golang.org/x/tools/go/packages/packages.go b/vendor/golang.org/x/tools/go/packages/packages.go index b249a5c7e..412ba06b5 100644 --- a/vendor/golang.org/x/tools/go/packages/packages.go +++ b/vendor/golang.org/x/tools/go/packages/packages.go @@ -403,6 +403,10 @@ func mergeResponses(responses ...*DriverResponse) *DriverResponse { if len(responses) == 0 { return nil } + // No dedup needed + if len(responses) == 1 { + return responses[0] + } response := newDeduper() response.dr.NotHandled = false response.dr.Compiler = responses[0].Compiler diff --git a/vendor/modules.txt b/vendor/modules.txt index 062a535c8..d007dea58 100644 --- a/vendor/modules.txt +++ b/vendor/modules.txt @@ -4,8 +4,8 @@ contrib.go.opencensus.io/exporter/prometheus # dario.cat/mergo v1.0.2 ## explicit; go 1.13 dario.cat/mergo -# filippo.io/edwards25519 v1.1.1 -## explicit; go 1.20 +# filippo.io/edwards25519 v1.2.0 +## explicit; go 1.24.0 filippo.io/edwards25519 filippo.io/edwards25519/field # github.com/Azure/go-ansiterm v0.0.0-20250102033503-faa5f7b0171c @@ -93,8 +93,8 @@ github.com/alexedwards/argon2id # github.com/amoghe/go-crypt v0.0.0-20220222110647-20eada5f5964 ## explicit github.com/amoghe/go-crypt -# github.com/antithesishq/antithesis-sdk-go v0.6.0-default-no-op -## explicit; go 1.20 +# github.com/antithesishq/antithesis-sdk-go v0.7.0-default-no-op +## explicit; go 1.24.0 github.com/antithesishq/antithesis-sdk-go/assert github.com/antithesishq/antithesis-sdk-go/internal # github.com/armon/go-radix v1.0.0 @@ -624,8 +624,8 @@ github.com/go-redis/redis/v8/internal/util ## explicit; go 1.23.0 github.com/go-resty/resty/v2 github.com/go-resty/resty/v2/shellescape -# github.com/go-sql-driver/mysql v1.9.3 -## explicit; go 1.21.0 +# github.com/go-sql-driver/mysql v1.10.0 +## explicit; go 1.24.0 github.com/go-sql-driver/mysql # github.com/go-task/slim-sprig v0.0.0-20230315185526-52ccab3ef572 ## explicit; go 1.13 @@ -1050,7 +1050,7 @@ github.com/mileusna/useragent # github.com/minio/crc64nvme v1.1.1 ## explicit; go 1.22 github.com/minio/crc64nvme -# github.com/minio/highwayhash v1.0.4-0.20251030100505-070ab1a87a76 +# github.com/minio/highwayhash v1.0.4 ## explicit; go 1.15 github.com/minio/highwayhash # github.com/minio/md5-simd v1.1.2 @@ -1158,7 +1158,7 @@ github.com/munnerz/goautoneg # github.com/nats-io/jwt/v2 v2.8.1 ## explicit; go 1.25.0 github.com/nats-io/jwt/v2 -# github.com/nats-io/nats-server/v2 v2.12.6 +# github.com/nats-io/nats-server/v2 v2.14.0 ## explicit; go 1.25.0 github.com/nats-io/nats-server/v2/conf github.com/nats-io/nats-server/v2/internal/fastrand @@ -1273,7 +1273,7 @@ github.com/onsi/ginkgo/v2/internal/reporters github.com/onsi/ginkgo/v2/internal/testingtproxy github.com/onsi/ginkgo/v2/reporters github.com/onsi/ginkgo/v2/types -# github.com/onsi/gomega v1.39.1 +# github.com/onsi/gomega v1.40.0 ## explicit; go 1.24.0 github.com/onsi/gomega github.com/onsi/gomega/format @@ -1371,7 +1371,7 @@ github.com/opencloud-eu/icap-client # github.com/opencloud-eu/libre-graph-api-go v1.0.8-0.20260310090739-853d972b282d ## explicit; go 1.18 github.com/opencloud-eu/libre-graph-api-go -# github.com/opencloud-eu/reva/v2 v2.43.1-0.20260424125411-c5db28365753 +# github.com/opencloud-eu/reva/v2 v2.43.1-0.20260512061040-cd4be86c66b0 ## explicit; go 1.25.0 github.com/opencloud-eu/reva/v2/cmd/revad/internal/grace github.com/opencloud-eu/reva/v2/cmd/revad/runtime @@ -1606,6 +1606,7 @@ github.com/opencloud-eu/reva/v2/pkg/share/cache github.com/opencloud-eu/reva/v2/pkg/share/cache/warmup/loader github.com/opencloud-eu/reva/v2/pkg/share/cache/warmup/registry github.com/opencloud-eu/reva/v2/pkg/share/manager/jsoncs3 +github.com/opencloud-eu/reva/v2/pkg/share/manager/jsoncs3/migrations github.com/opencloud-eu/reva/v2/pkg/share/manager/jsoncs3/providercache github.com/opencloud-eu/reva/v2/pkg/share/manager/jsoncs3/receivedsharecache github.com/opencloud-eu/reva/v2/pkg/share/manager/jsoncs3/sharecache @@ -2413,7 +2414,7 @@ go.yaml.in/yaml/v2 # go.yaml.in/yaml/v3 v3.0.4 ## explicit; go 1.16 go.yaml.in/yaml/v3 -# golang.org/x/crypto v0.49.0 +# golang.org/x/crypto v0.50.0 ## explicit; go 1.25.0 golang.org/x/crypto/argon2 golang.org/x/crypto/bcrypt @@ -2465,8 +2466,8 @@ golang.org/x/image/vector golang.org/x/image/vp8 golang.org/x/image/vp8l golang.org/x/image/webp -# golang.org/x/mod v0.33.0 -## explicit; go 1.24.0 +# golang.org/x/mod v0.34.0 +## explicit; go 1.25.0 golang.org/x/mod/internal/lazyregexp golang.org/x/mod/module golang.org/x/mod/semver @@ -2515,10 +2516,10 @@ golang.org/x/sys/windows/registry golang.org/x/sys/windows/svc golang.org/x/sys/windows/svc/eventlog golang.org/x/sys/windows/svc/mgr -# golang.org/x/term v0.41.0 +# golang.org/x/term v0.42.0 ## explicit; go 1.25.0 golang.org/x/term -# golang.org/x/text v0.35.0 +# golang.org/x/text v0.36.0 ## explicit; go 1.25.0 golang.org/x/text/cases golang.org/x/text/collate @@ -2548,8 +2549,8 @@ golang.org/x/text/width # golang.org/x/time v0.15.0 ## explicit; go 1.25.0 golang.org/x/time/rate -# golang.org/x/tools v0.42.0 -## explicit; go 1.24.0 +# golang.org/x/tools v0.43.0 +## explicit; go 1.25.0 golang.org/x/tools/cover golang.org/x/tools/go/ast/astutil golang.org/x/tools/go/ast/edge From 1e88251a2b4f60629585d7f2437a3b4f6e58b436 Mon Sep 17 00:00:00 2001 From: Ralf Haferkamp Date: Mon, 11 May 2026 16:34:56 +0200 Subject: [PATCH 8/9] feat(sharing): Require service account to be configured for sharing service In order to be able to run migrations, the "sharing" service now needs the "service_account_id" and -"_secret" to be configured. This is a "breaking/backwards incompatible" change. --- opencloud/pkg/command/shares.go | 10 +++++----- opencloud/pkg/init/init.go | 3 +++ opencloud/pkg/init/structs.go | 3 ++- services/sharing/pkg/config/config.go | 10 +++++++++- services/sharing/pkg/config/parser/parse.go | 8 ++++++++ services/sharing/pkg/revaconfig/config.go | 16 +++++++++------- 6 files changed, 36 insertions(+), 14 deletions(-) diff --git a/opencloud/pkg/command/shares.go b/opencloud/pkg/command/shares.go index 59e391ff2..98cee2da4 100644 --- a/opencloud/pkg/command/shares.go +++ b/opencloud/pkg/command/shares.go @@ -85,12 +85,16 @@ func cleanup(_ *cobra.Command, cfg *config.Config) error { return configlog.ReturnError(errors.New("cleanup is only implemented for the jsoncs3 share manager")) } + l := logger() + + zerolog.SetGlobalLevel(zerolog.InfoLevel) + rcfg := revaShareConfig(cfg.Sharing) f, ok := registry.NewFuncs[driver] if !ok { return configlog.ReturnError(errors.New("Unknown share manager type '" + driver + "'")) } - mgr, err := f(rcfg[driver].(map[string]any)) + mgr, err := f(rcfg[driver].(map[string]any), l) if err != nil { return configlog.ReturnError(err) } @@ -115,10 +119,6 @@ func cleanup(_ *cobra.Command, cfg *config.Config) error { if err != nil { return configlog.ReturnError(err) } - - l := logger() - - zerolog.SetGlobalLevel(zerolog.InfoLevel) serviceUserCtx = l.WithContext(serviceUserCtx) mgr.(*jsoncs3.Manager).CleanupStaleShares(serviceUserCtx) diff --git a/opencloud/pkg/init/init.go b/opencloud/pkg/init/init.go index 6d53b78f4..938205e6d 100644 --- a/opencloud/pkg/init/init.go +++ b/opencloud/pkg/init/init.go @@ -272,6 +272,9 @@ func CreateConfig(insecure, forceOverwrite, diff bool, configPath, adminPassword Activitylog: Activitylog{ ServiceAccount: serviceAccount, }, + Sharing: Sharing{ + ServiceAccount: serviceAccount, + }, } if insecure { diff --git a/opencloud/pkg/init/structs.go b/opencloud/pkg/init/structs.go index b49ae8726..3e6d0ae4f 100644 --- a/opencloud/pkg/init/structs.go +++ b/opencloud/pkg/init/structs.go @@ -204,7 +204,8 @@ type SettingsService struct { // Sharing is the configuration for the sharing service type Sharing struct { - Events Events + Events Events + ServiceAccount ServiceAccount `yaml:"service_account"` } // StorageRegistry is the configuration for the storage registry diff --git a/services/sharing/pkg/config/config.go b/services/sharing/pkg/config/config.go index 0ba4a330f..2f3f7178e 100644 --- a/services/sharing/pkg/config/config.go +++ b/services/sharing/pkg/config/config.go @@ -18,7 +18,8 @@ type Config struct { Reva *shared.Reva `yaml:"reva"` Events Events `yaml:"events"` - SkipUserGroupsInToken bool `yaml:"skip_user_groups_in_token" env:"SHARING_SKIP_USER_GROUPS_IN_TOKEN" desc:"Disables the loading of user's group memberships from the reva access token." introductionVersion:"1.0.0"` + ServiceAccount ServiceAccount `yaml:"service_account"` + SkipUserGroupsInToken bool `yaml:"skip_user_groups_in_token" env:"SHARING_SKIP_USER_GROUPS_IN_TOKEN" desc:"Disables the loading of user's group memberships from the reva access token." introductionVersion:"1.0.0"` UserSharingDriver string `yaml:"user_sharing_driver" env:"SHARING_USER_DRIVER" desc:"Driver to be used to persist shares. Supported values are 'jsoncs3', 'json', 'cs3' (deprecated) and 'owncloudsql'." introductionVersion:"1.0.0"` UserSharingDrivers UserSharingDrivers `yaml:"user_sharing_drivers"` @@ -100,6 +101,13 @@ type UserSharingJSONCS3Driver struct { CacheTTL int `yaml:"cache_ttl" env:"SHARING_USER_JSONCS3_CACHE_TTL" desc:"TTL for the internal caches in seconds." introductionVersion:"1.0.0"` MaxConcurrency int `yaml:"max_concurrency" env:"OC_MAX_CONCURRENCY;SHARING_USER_JSONCS3_MAX_CONCURRENCY" desc:"Maximum number of concurrent go-routines. Higher values can potentially get work done faster but will also cause more load on the system. Values of 0 or below will be ignored and the default value will be used." introductionVersion:"1.0.0"` } + +// ServiceAccount is the configuration for the used service account +type ServiceAccount struct { + ServiceAccountID string `yaml:"service_account_id" env:"OC_SERVICE_ACCOUNT_ID;SHARING_SERVICE_ACCOUNT" desc:"The ID of the service account the service should use. See the 'auth-service' service description for more details." introductionVersion:"%%NEXT%%"` + ServiceAccountSecret string `yaml:"service_account_secret" env:"OC_SERVICE_ACCOUNT_SECRET;SHARING_SERVICE_ACCOUNT_SECRET" desc:"The service account secret." introductionVersion:"%%NEXT%%"` +} + type PublicSharingDrivers struct { JSON PublicSharingJSONDriver `yaml:"json"` JSONCS3 PublicSharingJSONCS3Driver `yaml:"jsoncs3"` diff --git a/services/sharing/pkg/config/parser/parse.go b/services/sharing/pkg/config/parser/parse.go index 678f50d25..96adde279 100644 --- a/services/sharing/pkg/config/parser/parse.go +++ b/services/sharing/pkg/config/parser/parse.go @@ -58,5 +58,13 @@ func Validate(cfg *config.Config) error { return shared.MissingSystemUserID(cfg.Service.Name) } + if cfg.ServiceAccount.ServiceAccountID == "" { + return shared.MissingServiceAccountID(cfg.Service.Name) + } + + if cfg.ServiceAccount.ServiceAccountSecret == "" { + return shared.MissingServiceAccountSecret(cfg.Service.Name) + } + return nil } diff --git a/services/sharing/pkg/revaconfig/config.go b/services/sharing/pkg/revaconfig/config.go index 57b12b9b0..b7244e37b 100644 --- a/services/sharing/pkg/revaconfig/config.go +++ b/services/sharing/pkg/revaconfig/config.go @@ -71,13 +71,15 @@ func SharingConfigFromStruct(cfg *config.Config, logger log.Logger) (map[string] "machine_auth_apikey": cfg.UserSharingDrivers.CS3.SystemUserAPIKey, }, "jsoncs3": map[string]any{ - "gateway_addr": cfg.Reva.Address, - "provider_addr": cfg.UserSharingDrivers.JSONCS3.ProviderAddr, - "service_user_id": cfg.UserSharingDrivers.JSONCS3.SystemUserID, - "service_user_idp": cfg.UserSharingDrivers.JSONCS3.SystemUserIDP, - "machine_auth_apikey": cfg.UserSharingDrivers.JSONCS3.SystemUserAPIKey, - "ttl": cfg.UserSharingDrivers.JSONCS3.CacheTTL, - "max_concurrency": cfg.UserSharingDrivers.JSONCS3.MaxConcurrency, + "gateway_addr": cfg.Reva.Address, + "provider_addr": cfg.UserSharingDrivers.JSONCS3.ProviderAddr, + "system_user_id": cfg.UserSharingDrivers.JSONCS3.SystemUserID, + "system_user_idp": cfg.UserSharingDrivers.JSONCS3.SystemUserIDP, + "machine_auth_apikey": cfg.UserSharingDrivers.JSONCS3.SystemUserAPIKey, + "ttl": cfg.UserSharingDrivers.JSONCS3.CacheTTL, + "max_concurrency": cfg.UserSharingDrivers.JSONCS3.MaxConcurrency, + "service_account_id": cfg.ServiceAccount.ServiceAccountID, + "service_account_secret": cfg.ServiceAccount.ServiceAccountSecret, "events": map[string]any{ "natsaddress": cfg.Events.Addr, "natsclusterid": cfg.Events.ClusterID, From 0511ab26903a23484a6f864b04600ea0f7c87668 Mon Sep 17 00:00:00 2001 From: Ralf Haferkamp Date: Wed, 13 May 2026 14:39:31 +0200 Subject: [PATCH 9/9] bump reva to latest main after feature/guest-links was merged --- go.mod | 14 +- go.sum | 28 +- .../cyphar/filepath-securejoin/.golangci.yml | 4 + .../cyphar/filepath-securejoin/CHANGELOG.md | 54 +- .../cyphar/filepath-securejoin/VERSION | 2 +- .../filepath-securejoin/deprecated_linux.go | 48 - .../filepath-securejoin/pathrs-lite/README.md | 33 - .../filepath-securejoin/pathrs-lite/doc.go | 14 - .../pathrs-lite/internal/assert/assert.go | 30 - .../pathrs-lite/internal/errors_linux.go | 41 - .../pathrs-lite/internal/fd/at_linux.go | 148 - .../pathrs-lite/internal/fd/fd.go | 55 - .../pathrs-lite/internal/fd/fd_linux.go | 78 - .../pathrs-lite/internal/fd/mount_linux.go | 54 - .../pathrs-lite/internal/fd/openat2_linux.go | 62 - .../pathrs-lite/internal/gocompat/README.md | 10 - .../pathrs-lite/internal/gocompat/doc.go | 13 - .../gocompat/gocompat_errors_go120.go | 19 - .../gocompat/gocompat_errors_unsupported.go | 40 - .../gocompat/gocompat_generics_go121.go | 53 - .../gocompat/gocompat_generics_unsupported.go | 187 -- .../internal/kernelversion/kernel_linux.go | 123 - .../pathrs-lite/internal/linux/doc.go | 12 - .../pathrs-lite/internal/linux/mount_linux.go | 47 - .../internal/linux/openat2_linux.go | 31 - .../internal/procfs/procfs_linux.go | 544 ---- .../internal/procfs/procfs_lookup_linux.go | 222 -- .../pathrs-lite/lookup_linux.go | 399 --- .../pathrs-lite/mkdir_linux.go | 246 -- .../pathrs-lite/open_linux.go | 74 - .../pathrs-lite/openat2_linux.go | 101 - .../pathrs-lite/procfs/procfs_linux.go | 157 - .../github.com/go-git/go-billy/v5/README.md | 4 + .../go-billy/v5/helper/chroot/chroot.go | 208 +- .../github.com/go-git/go-billy/v5/osfs/os.go | 5 + .../go-git/go-billy/v5/osfs/os_bound.go | 100 +- .../go-git/go-billy/v5/osfs/os_chroot.go | 10 + .../go-git/go-billy/v5/util/util.go | 43 +- .../go-git/v5/plumbing/object/commit.go | 207 +- .../v5/plumbing/object/commit_scanner.go | 377 +++ .../go-git/v5/plumbing/object/signature.go | 122 +- .../go-git/go-git/v5/plumbing/object/tag.go | 135 +- .../go-git/v5/plumbing/object/tag_scanner.go | 237 ++ .../go-git/go-git/v5/plumbing/object/tree.go | 128 +- .../github.com/klauspost/cpuid/v2/README.md | 6 +- vendor/github.com/klauspost/cpuid/v2/cpuid.go | 104 +- .../klauspost/cpuid/v2/detect_x86.go | 4 + .../klauspost/cpuid/v2/featureid_string.go | 178 +- .../pkg/storage/fs/posix/tree/assimilation.go | 3 + vendor/github.com/pjbgf/sha1cd/Dockerfile.arm | 2 +- .../github.com/pjbgf/sha1cd/Dockerfile.arm64 | 2 +- vendor/github.com/pjbgf/sha1cd/Makefile | 7 +- vendor/github.com/pjbgf/sha1cd/README.md | 3 +- vendor/github.com/pjbgf/sha1cd/sha1cd.go | 47 +- .../pjbgf/sha1cd/sha1cdblock_amd64.go | 46 +- .../pjbgf/sha1cd/sha1cdblock_amd64.s | 2531 ++--------------- .../pjbgf/sha1cd/sha1cdblock_arm64.go | 48 + .../pjbgf/sha1cd/sha1cdblock_arm64.s | 249 ++ .../pjbgf/sha1cd/sha1cdblock_generic.go | 70 +- .../pjbgf/sha1cd/sha1cdblock_noasm.go | 3 +- vendor/github.com/pjbgf/sha1cd/ubc/ubc.go | 373 ++- .../github.com/pjbgf/sha1cd/ubc/ubc_amd64.go | 14 - .../github.com/pjbgf/sha1cd/ubc/ubc_amd64.s | 1897 ------------ .../pjbgf/sha1cd/ubc/ubc_generic.go | 368 --- .../github.com/pjbgf/sha1cd/ubc/ubc_noasm.go | 12 - vendor/golang.org/x/exp/maps/maps.go | 30 +- vendor/golang.org/x/exp/slices/slices.go | 41 +- vendor/golang.org/x/exp/slices/sort.go | 25 +- vendor/modules.txt | 31 +- 69 files changed, 2766 insertions(+), 7847 deletions(-) delete mode 100644 vendor/github.com/cyphar/filepath-securejoin/deprecated_linux.go delete mode 100644 vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/README.md delete mode 100644 vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/doc.go delete mode 100644 vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/assert/assert.go delete mode 100644 vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/errors_linux.go delete mode 100644 vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/fd/at_linux.go delete mode 100644 vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/fd/fd.go delete mode 100644 vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/fd/fd_linux.go delete mode 100644 vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/fd/mount_linux.go delete mode 100644 vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/fd/openat2_linux.go delete mode 100644 vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/gocompat/README.md delete mode 100644 vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/gocompat/doc.go delete mode 100644 vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/gocompat/gocompat_errors_go120.go delete mode 100644 vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/gocompat/gocompat_errors_unsupported.go delete mode 100644 vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/gocompat/gocompat_generics_go121.go delete mode 100644 vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/gocompat/gocompat_generics_unsupported.go delete mode 100644 vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/kernelversion/kernel_linux.go delete mode 100644 vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/linux/doc.go delete mode 100644 vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/linux/mount_linux.go delete mode 100644 vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/linux/openat2_linux.go delete mode 100644 vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/procfs/procfs_linux.go delete mode 100644 vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/procfs/procfs_lookup_linux.go delete mode 100644 vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/lookup_linux.go delete mode 100644 vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/mkdir_linux.go delete mode 100644 vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/open_linux.go delete mode 100644 vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/openat2_linux.go delete mode 100644 vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/procfs/procfs_linux.go create mode 100644 vendor/github.com/go-git/go-git/v5/plumbing/object/commit_scanner.go create mode 100644 vendor/github.com/go-git/go-git/v5/plumbing/object/tag_scanner.go create mode 100644 vendor/github.com/pjbgf/sha1cd/sha1cdblock_arm64.go create mode 100644 vendor/github.com/pjbgf/sha1cd/sha1cdblock_arm64.s delete mode 100644 vendor/github.com/pjbgf/sha1cd/ubc/ubc_amd64.go delete mode 100644 vendor/github.com/pjbgf/sha1cd/ubc/ubc_amd64.s delete mode 100644 vendor/github.com/pjbgf/sha1cd/ubc/ubc_generic.go delete mode 100644 vendor/github.com/pjbgf/sha1cd/ubc/ubc_noasm.go diff --git a/go.mod b/go.mod index c2dcf6d2e..ca7872fc7 100644 --- a/go.mod +++ b/go.mod @@ -64,7 +64,7 @@ require ( github.com/open-policy-agent/opa v1.15.2 github.com/opencloud-eu/icap-client v0.0.0-20250930132611-28a2afe62d89 github.com/opencloud-eu/libre-graph-api-go v1.0.8-0.20260310090739-853d972b282d - github.com/opencloud-eu/reva/v2 v2.43.1-0.20260512061040-cd4be86c66b0 + github.com/opencloud-eu/reva/v2 v2.44.1-0.20260513122109-583a11875721 github.com/opensearch-project/opensearch-go/v4 v4.6.0 github.com/orcaman/concurrent-map v1.0.0 github.com/pkg/errors v0.9.1 @@ -103,7 +103,7 @@ require ( go.opentelemetry.io/otel/sdk v1.43.0 go.opentelemetry.io/otel/trace v1.43.0 golang.org/x/crypto v0.50.0 - golang.org/x/exp v0.0.0-20250210185358-939b2ce775ac + golang.org/x/exp v0.0.0-20260410095643-746e56fc9e2f golang.org/x/image v0.38.0 golang.org/x/net v0.53.0 golang.org/x/oauth2 v0.36.0 @@ -179,7 +179,7 @@ require ( github.com/cpuguy83/go-md2man/v2 v2.0.7 // indirect github.com/crewjam/httperr v0.2.0 // indirect github.com/crewjam/saml v0.4.14 // indirect - github.com/cyphar/filepath-securejoin v0.5.1 // indirect + github.com/cyphar/filepath-securejoin v0.6.1 // indirect github.com/davecgh/go-spew v1.1.2-0.20180830191138-d8f796af33cc // indirect github.com/deckarep/golang-set v1.8.0 // indirect github.com/decred/dcrd/dcrec/secp256k1/v4 v4.4.0 // indirect @@ -204,8 +204,8 @@ require ( github.com/go-acme/lego/v4 v4.4.0 // indirect github.com/go-asn1-ber/asn1-ber v1.5.8-0.20250403174932-29230038a667 // indirect github.com/go-git/gcfg v1.5.1-0.20230307220236-3a3c6141e376 // indirect - github.com/go-git/go-billy/v5 v5.8.0 // indirect - github.com/go-git/go-git/v5 v5.18.0 // indirect + github.com/go-git/go-billy/v5 v5.9.0 // indirect + github.com/go-git/go-git/v5 v5.19.0 // indirect github.com/go-ini/ini v1.67.0 // indirect github.com/go-jose/go-jose/v4 v4.1.4 // indirect github.com/go-kit/log v0.2.1 // indirect @@ -258,7 +258,7 @@ require ( github.com/juliangruber/go-intersect v1.1.0 // indirect github.com/kevinburke/ssh_config v1.2.0 // indirect github.com/klauspost/compress v1.18.5 // indirect - github.com/klauspost/cpuid/v2 v2.2.11 // indirect + github.com/klauspost/cpuid/v2 v2.3.0 // indirect github.com/klauspost/crc32 v1.3.0 // indirect github.com/kovidgoyal/go-parallel v1.1.1 // indirect github.com/kovidgoyal/go-shm v1.0.0 // indirect @@ -321,7 +321,7 @@ require ( github.com/pelletier/go-toml/v2 v2.2.4 // indirect github.com/philhofer/fwd v1.2.0 // indirect github.com/pierrec/lz4/v4 v4.1.15 // indirect - github.com/pjbgf/sha1cd v0.3.2 // indirect + github.com/pjbgf/sha1cd v0.6.0 // indirect github.com/pmezard/go-difflib v1.0.1-0.20181226105442-5d4384ee4fb2 // indirect github.com/power-devops/perfstat v0.0.0-20240221224432-82ca36839d55 // indirect github.com/pquerna/cachecontrol v0.2.0 // indirect diff --git a/go.sum b/go.sum index 6c728f46f..b477a9f09 100644 --- a/go.sum +++ b/go.sum @@ -267,8 +267,8 @@ github.com/crewjam/saml v0.4.14/go.mod h1:UVSZCf18jJkk6GpWNVqcyQJMD5HsRugBPf4I1n github.com/cs3org/go-cs3apis v0.0.0-20260424072047-8d9ef7076ae9 h1:8WtMb7TKKx1AJM3j+uR+H25y4v+b8o8GIQg/2ooCyRo= github.com/cs3org/go-cs3apis v0.0.0-20260424072047-8d9ef7076ae9/go.mod h1:DedpcqXl193qF/08Y04IO0PpxyyMu8+GrkD6kWK2MEQ= github.com/cyberdelia/templates v0.0.0-20141128023046-ca7fffd4298c/go.mod h1:GyV+0YP4qX0UQ7r2MoYZ+AvYDp12OF5yg4q8rGnyNh4= -github.com/cyphar/filepath-securejoin v0.5.1 h1:eYgfMq5yryL4fbWfkLpFFy2ukSELzaJOTaUTuh+oF48= -github.com/cyphar/filepath-securejoin v0.5.1/go.mod h1:Sdj7gXlvMcPZsbhwhQ33GguGLDGQL7h7bg04C/+u9jI= +github.com/cyphar/filepath-securejoin v0.6.1 h1:5CeZ1jPXEiYt3+Z6zqprSAgSWiggmpVyciv8syjIpVE= +github.com/cyphar/filepath-securejoin v0.6.1/go.mod h1:A8hd4EnAeyujCJRrICiOWqjS1AX0a9kM5XL+NwKoYSc= github.com/davecgh/go-spew v1.1.0/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38= github.com/davecgh/go-spew v1.1.1/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38= github.com/davecgh/go-spew v1.1.2-0.20180830191138-d8f796af33cc h1:U9qPSI2PIWSS1VwoXQT9A3Wy9MM3WgvqSxFWenqJduM= @@ -382,12 +382,12 @@ github.com/go-cmd/cmd v1.0.5/go.mod h1:y8q8qlK5wQibcw63djSl/ntiHUHXHGdCkPk0j4QeW github.com/go-errors/errors v1.0.1/go.mod h1:f4zRHt4oKfwPJE5k8C9vpYG+aDHdBFUsgrm6/TyX73Q= github.com/go-git/gcfg v1.5.1-0.20230307220236-3a3c6141e376 h1:+zs/tPmkDkHx3U66DAb0lQFJrpS6731Oaa12ikc+DiI= github.com/go-git/gcfg v1.5.1-0.20230307220236-3a3c6141e376/go.mod h1:an3vInlBmSxCcxctByoQdvwPiA7DTK7jaaFDBTtu0ic= -github.com/go-git/go-billy/v5 v5.8.0 h1:I8hjc3LbBlXTtVuFNJuwYuMiHvQJDq1AT6u4DwDzZG0= -github.com/go-git/go-billy/v5 v5.8.0/go.mod h1:RpvI/rw4Vr5QA+Z60c6d6LXH0rYJo0uD5SqfmrrheCY= +github.com/go-git/go-billy/v5 v5.9.0 h1:jItGXszUDRtR/AlferWPTMN4j38BQ88XnXKbilmmBPA= +github.com/go-git/go-billy/v5 v5.9.0/go.mod h1:jCnQMLj9eUgGU7+ludSTYoZL/GGmii14RxKFj7ROgHw= github.com/go-git/go-git-fixtures/v4 v4.3.2-0.20231010084843-55a94097c399 h1:eMje31YglSBqCdIqdhKBW8lokaMrL3uTkpGYlE2OOT4= github.com/go-git/go-git-fixtures/v4 v4.3.2-0.20231010084843-55a94097c399/go.mod h1:1OCfN199q1Jm3HZlxleg+Dw/mwps2Wbk9frAWm+4FII= -github.com/go-git/go-git/v5 v5.18.0 h1:O831KI+0PR51hM2kep6T8k+w0/LIAD490gvqMCvL5hM= -github.com/go-git/go-git/v5 v5.18.0/go.mod h1:pW/VmeqkanRFqR6AljLcs7EA7FbZaN5MQqO7oZADXpo= +github.com/go-git/go-git/v5 v5.19.0 h1:+WkVUQZSy/F1Gb13udrMKjIM2PrzsNfDKFSfo5tkMtc= +github.com/go-git/go-git/v5 v5.19.0/go.mod h1:Pb1v0c7/g8aGQJwx9Us09W85yGoyvSwuhEGMH7zjDKQ= github.com/go-gl/glfw v0.0.0-20190409004039-e6da0acd62b1/go.mod h1:vR7hzQXu2zJy9AVAgeJqvqgH9Q5CA+iKCZ2gyEVpxRU= github.com/go-gl/glfw/v3.3/glfw v0.0.0-20191125211704-12ad95a8df72/go.mod h1:tQ2UAYgL5IevRw8kRxooKSPJfGvJ9fJQFa0TUsXzTg8= github.com/go-gl/glfw/v3.3/glfw v0.0.0-20200222043503-6f7a984d4dc4/go.mod h1:tQ2UAYgL5IevRw8kRxooKSPJfGvJ9fJQFa0TUsXzTg8= @@ -722,8 +722,8 @@ github.com/kisielk/gotool v1.0.0/go.mod h1:XhKaO+MFFWcvkIS/tQcRk01m1F5IRFswLeQ+o github.com/klauspost/compress v1.18.5 h1:/h1gH5Ce+VWNLSWqPzOVn6XBO+vJbCNGvjoaGBFW2IE= github.com/klauspost/compress v1.18.5/go.mod h1:cwPg85FWrGar70rWktvGQj8/hthj3wpl0PGDogxkrSQ= github.com/klauspost/cpuid/v2 v2.0.1/go.mod h1:FInQzS24/EEf25PyTYn52gqo7WaD8xa0213Md/qVLRg= -github.com/klauspost/cpuid/v2 v2.2.11 h1:0OwqZRYI2rFrjS4kvkDnqJkKHdHaRnCm68/DY4OxRzU= -github.com/klauspost/cpuid/v2 v2.2.11/go.mod h1:hqwkgyIinND0mEev00jJYCxPNVRVXFQeu1XKlok6oO0= +github.com/klauspost/cpuid/v2 v2.3.0 h1:S4CRMLnYUhGeDFDqkGriYKdfoFlDnMtqTiI/sFzhA9Y= +github.com/klauspost/cpuid/v2 v2.3.0/go.mod h1:hqwkgyIinND0mEev00jJYCxPNVRVXFQeu1XKlok6oO0= github.com/klauspost/crc32 v1.3.0 h1:sSmTt3gUt81RP655XGZPElI0PelVTZ6YwCRnPSupoFM= github.com/klauspost/crc32 v1.3.0/go.mod h1:D7kQaZhnkX/Y0tstFGf8VUzv2UofNGqCjnC3zdHB0Hw= github.com/kobergj/gowebdav v0.0.0-20250102091030-aa65266db202 h1:A1xJ2NKgiYFiaHiLl9B5yw/gUBACSs9crDykTS3GuQI= @@ -952,8 +952,8 @@ github.com/opencloud-eu/inotifywaitgo v0.0.0-20251111171128-a390bae3c5e9 h1:dIft github.com/opencloud-eu/inotifywaitgo v0.0.0-20251111171128-a390bae3c5e9/go.mod h1:JWyDC6H+5oZRdUJUgKuaye+8Ph5hEs6HVzVoPKzWSGI= github.com/opencloud-eu/libre-graph-api-go v1.0.8-0.20260310090739-853d972b282d h1:JcqGDiyrcaQwVyV861TUyQgO7uEmsjkhfm7aQd84dOw= github.com/opencloud-eu/libre-graph-api-go v1.0.8-0.20260310090739-853d972b282d/go.mod h1:pzatilMEHZFT3qV7C/X3MqOa3NlRQuYhlRhZTL+hN6Q= -github.com/opencloud-eu/reva/v2 v2.43.1-0.20260512061040-cd4be86c66b0 h1:e4w34sW1gXixTKi9z+odF6IKGyvisvu97xfYEXOvRGE= -github.com/opencloud-eu/reva/v2 v2.43.1-0.20260512061040-cd4be86c66b0/go.mod h1:SoRYtNJ9ha83YdUUep5wYF7F5/OIhgED7ZSgqudhpNo= +github.com/opencloud-eu/reva/v2 v2.44.1-0.20260513122109-583a11875721 h1:PH9Ia0HwdvpfaThYCid2atc5y+uwn4EJxvJU6L9wU6M= +github.com/opencloud-eu/reva/v2 v2.44.1-0.20260513122109-583a11875721/go.mod h1:tUL2X47YxLHrnBDArHrIP73UJliMI0PaY/3tPs31dTM= github.com/opencloud-eu/secure v0.0.0-20260312082735-b6f5cb2244e4 h1:l2oB/RctH+t8r7QBj5p8thfEHCM/jF35aAY3WQ3hADI= github.com/opencloud-eu/secure v0.0.0-20260312082735-b6f5cb2244e4/go.mod h1:BmF5hyM6tXczk3MpQkFf1hpKSRqCyhqcbiQtiAF7+40= github.com/opencontainers/go-digest v1.0.0 h1:apOUWs51W5PlhuyGyz9FCeeBIOUDA/6nW8Oi/yOhh5U= @@ -988,8 +988,8 @@ github.com/philhofer/fwd v1.2.0/go.mod h1:RqIHx9QI14HlwKwm98g9Re5prTQ6LdeRQn+gXJ github.com/pierrec/lz4 v2.0.5+incompatible/go.mod h1:pdkljMzZIN41W+lC3N2tnIh5sFi+IEE17M5jbnwPHcY= github.com/pierrec/lz4/v4 v4.1.15 h1:MO0/ucJhngq7299dKLwIMtgTfbkoSPF6AoMYDd8Q4q0= github.com/pierrec/lz4/v4 v4.1.15/go.mod h1:gZWDp/Ze/IJXGXf23ltt2EXimqmTUXEy0GFuRQyBid4= -github.com/pjbgf/sha1cd v0.3.2 h1:a9wb0bp1oC2TGwStyn0Umc/IGKQnEgF0vVaZ8QF8eo4= -github.com/pjbgf/sha1cd v0.3.2/go.mod h1:zQWigSxVmsHEZow5qaLtPYxpcKMMQpa09ixqBxuCS6A= +github.com/pjbgf/sha1cd v0.6.0 h1:3WJ8Wz8gvDz29quX1OcEmkAlUg9diU4GxJHqs0/XiwU= +github.com/pjbgf/sha1cd v0.6.0/go.mod h1:lhpGlyHLpQZoxMv8HcgXvZEhcGs0PG/vsZnEJ7H0iCM= github.com/pkg/errors v0.8.0/go.mod h1:bwawxfHBFNV+L2hUp1rHADufV3IMtnDRdf1r5NINEl0= github.com/pkg/errors v0.8.1/go.mod h1:bwawxfHBFNV+L2hUp1rHADufV3IMtnDRdf1r5NINEl0= github.com/pkg/errors v0.9.1 h1:FEBLx1zS214owpjy7qsBeixbURkuhQAwrK5UwLGTwt4= @@ -1374,8 +1374,8 @@ golang.org/x/exp v0.0.0-20191227195350-da58074b4299/go.mod h1:2RIsYlXP63K8oxa1u0 golang.org/x/exp v0.0.0-20200119233911-0405dc783f0a/go.mod h1:2RIsYlXP63K8oxa1u096TMicItID8zy7Y6sNkU49FU4= golang.org/x/exp v0.0.0-20200207192155-f17229e696bd/go.mod h1:J/WKrq2StrnmMY6+EHIKF9dgMWnmCNThgcyBT1FY9mM= golang.org/x/exp v0.0.0-20200224162631-6cc2880d07d6/go.mod h1:3jZMyOhIsHpP37uCMkUooju7aAi5cS1Q23tOzKc+0MU= -golang.org/x/exp v0.0.0-20250210185358-939b2ce775ac h1:l5+whBCLH3iH2ZNHYLbAe58bo7yrN4mVcnkHDYz5vvs= -golang.org/x/exp v0.0.0-20250210185358-939b2ce775ac/go.mod h1:hH+7mtFmImwwcMvScyxUhjuVHR3HGaDPMn9rMSUUbxo= +golang.org/x/exp v0.0.0-20260410095643-746e56fc9e2f h1:W3F4c+6OLc6H2lb//N1q4WpJkhzJCK5J6kUi1NTVXfM= +golang.org/x/exp v0.0.0-20260410095643-746e56fc9e2f/go.mod h1:J1xhfL/vlindoeF/aINzNzt2Bket5bjo9sdOYzOsU80= golang.org/x/image v0.0.0-20190227222117-0694c2d4d067/go.mod h1:kZ7UVZpmo3dzQBMxlp+ypCbDeSB+sBbTgSJuh5dn5js= golang.org/x/image v0.0.0-20190802002840-cff245a6509b/go.mod h1:FeLwcggjj3mMvU+oOTbSwawSJRM1uh48EjtB4UJZlP0= golang.org/x/image v0.38.0 h1:5l+q+Y9JDC7mBOMjo4/aPhMDcxEptsX+Tt3GgRQRPuE= diff --git a/vendor/github.com/cyphar/filepath-securejoin/.golangci.yml b/vendor/github.com/cyphar/filepath-securejoin/.golangci.yml index e965034ed..3e8dd99bd 100644 --- a/vendor/github.com/cyphar/filepath-securejoin/.golangci.yml +++ b/vendor/github.com/cyphar/filepath-securejoin/.golangci.yml @@ -9,6 +9,10 @@ version: "2" +run: + build-tags: + - libpathrs + linters: enable: - asasalint diff --git a/vendor/github.com/cyphar/filepath-securejoin/CHANGELOG.md b/vendor/github.com/cyphar/filepath-securejoin/CHANGELOG.md index 3faee0bc5..6d016d05c 100644 --- a/vendor/github.com/cyphar/filepath-securejoin/CHANGELOG.md +++ b/vendor/github.com/cyphar/filepath-securejoin/CHANGELOG.md @@ -4,7 +4,54 @@ All notable changes to this project will be documented in this file. The format is based on [Keep a Changelog](http://keepachangelog.com/) and this project adheres to [Semantic Versioning](http://semver.org/). -## [Unreleased 0.5.z] ## +## [Unreleased] ## + +## [0.6.1] - 2025-11-19 ## + +> At last up jumped the cunning spider, and fiercely held her fast. + +### Fixed ### +- Our logic for deciding whether to use `openat2(2)` or fallback to an `O_PATH` + resolver would cache the result to avoid doing needless test runs of + `openat2(2)`. However, this causes issues when `pathrs-lite` is being used by + a program that applies new seccomp-bpf filters onto itself -- if the filter + denies `openat2(2)` then we would return that error rather than falling back + to the `O_PATH` resolver. To resolve this issue, we no longer cache the + result if `openat2(2)` was successful, only if there was an error. +- A file descriptor leak in our `openat2` wrapper (when doing the necessary + `dup` for `RESOLVE_IN_ROOT`) has been removed. + +## [0.5.2] - 2025-11-19 ## + +> "Will you walk into my parlour?" said a spider to a fly. + +### Fixed ### +- Our logic for deciding whether to use `openat2(2)` or fallback to an `O_PATH` + resolver would cache the result to avoid doing needless test runs of + `openat2(2)`. However, this causes issues when `pathrs-lite` is being used by + a program that applies new seccomp-bpf filters onto itself -- if the filter + denies `openat2(2)` then we would return that error rather than falling back + to the `O_PATH` resolver. To resolve this issue, we no longer cache the + result if `openat2(2)` was successful, only if there was an error. +- A file descriptor leak in our `openat2` wrapper (when doing the necessary + `dup` for `RESOLVE_IN_ROOT`) has been removed. + +## [0.6.0] - 2025-11-03 ## + +> By the Power of Greyskull! + +### Breaking ### +- The deprecated `MkdirAll`, `MkdirAllHandle`, `OpenInRoot`, `OpenatInRoot` and + `Reopen` wrappers have been removed. Please switch to using `pathrs-lite` + directly. + +### Added ### +- `pathrs-lite` now has support for using libpathrs as a backend. This is + opt-in and can be enabled at build time with the `libpathrs` build tag. The + intention is to allow for downstream libraries and other projects to make use + of the pure-Go `github.com/cyphar/filepath-securejoin/pathrs-lite` package + and distributors can then opt-in to using `libpathrs` for the entire binary + if they wish. ## [0.5.1] - 2025-10-31 ## @@ -383,7 +430,10 @@ This is our first release of `github.com/cyphar/filepath-securejoin`, containing a full implementation with a coverage of 93.5% (the only missing cases are the error cases, which are hard to mocktest at the moment). -[Unreleased 0.5.z]: https://github.com/cyphar/filepath-securejoin/compare/v0.5.1...release-0.5 +[Unreleased]: https://github.com/cyphar/filepath-securejoin/compare/v0.6.1...HEAD +[0.6.1]: https://github.com/cyphar/filepath-securejoin/compare/v0.6.0...v0.6.1 +[0.6.0]: https://github.com/cyphar/filepath-securejoin/compare/v0.5.0...v0.6.0 +[0.5.2]: https://github.com/cyphar/filepath-securejoin/compare/v0.5.1...v0.5.2 [0.5.1]: https://github.com/cyphar/filepath-securejoin/compare/v0.5.0...v0.5.1 [0.5.0]: https://github.com/cyphar/filepath-securejoin/compare/v0.4.1...v0.5.0 [0.4.1]: https://github.com/cyphar/filepath-securejoin/compare/v0.4.0...v0.4.1 diff --git a/vendor/github.com/cyphar/filepath-securejoin/VERSION b/vendor/github.com/cyphar/filepath-securejoin/VERSION index 4b9fcbec1..ee6cdce3c 100644 --- a/vendor/github.com/cyphar/filepath-securejoin/VERSION +++ b/vendor/github.com/cyphar/filepath-securejoin/VERSION @@ -1 +1 @@ -0.5.1 +0.6.1 diff --git a/vendor/github.com/cyphar/filepath-securejoin/deprecated_linux.go b/vendor/github.com/cyphar/filepath-securejoin/deprecated_linux.go deleted file mode 100644 index 3e427b164..000000000 --- a/vendor/github.com/cyphar/filepath-securejoin/deprecated_linux.go +++ /dev/null @@ -1,48 +0,0 @@ -// SPDX-License-Identifier: MPL-2.0 - -//go:build linux - -// Copyright (C) 2024-2025 Aleksa Sarai -// Copyright (C) 2024-2025 SUSE LLC -// -// This Source Code Form is subject to the terms of the Mozilla Public -// License, v. 2.0. If a copy of the MPL was not distributed with this -// file, You can obtain one at https://mozilla.org/MPL/2.0/. - -package securejoin - -import ( - "github.com/cyphar/filepath-securejoin/pathrs-lite" -) - -var ( - // MkdirAll is a wrapper around [pathrs.MkdirAll]. - // - // Deprecated: You should use [pathrs.MkdirAll] directly instead. This - // wrapper will be removed in filepath-securejoin v0.6. - MkdirAll = pathrs.MkdirAll - - // MkdirAllHandle is a wrapper around [pathrs.MkdirAllHandle]. - // - // Deprecated: You should use [pathrs.MkdirAllHandle] directly instead. - // This wrapper will be removed in filepath-securejoin v0.6. - MkdirAllHandle = pathrs.MkdirAllHandle - - // OpenInRoot is a wrapper around [pathrs.OpenInRoot]. - // - // Deprecated: You should use [pathrs.OpenInRoot] directly instead. This - // wrapper will be removed in filepath-securejoin v0.6. - OpenInRoot = pathrs.OpenInRoot - - // OpenatInRoot is a wrapper around [pathrs.OpenatInRoot]. - // - // Deprecated: You should use [pathrs.OpenatInRoot] directly instead. This - // wrapper will be removed in filepath-securejoin v0.6. - OpenatInRoot = pathrs.OpenatInRoot - - // Reopen is a wrapper around [pathrs.Reopen]. - // - // Deprecated: You should use [pathrs.Reopen] directly instead. This - // wrapper will be removed in filepath-securejoin v0.6. - Reopen = pathrs.Reopen -) diff --git a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/README.md b/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/README.md deleted file mode 100644 index 1be727e75..000000000 --- a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/README.md +++ /dev/null @@ -1,33 +0,0 @@ -## `pathrs-lite` ## - -`github.com/cyphar/filepath-securejoin/pathrs-lite` provides a minimal **pure -Go** implementation of the core bits of [libpathrs][]. This is not intended to -be a complete replacement for libpathrs, instead it is mainly intended to be -useful as a transition tool for existing Go projects. - -The long-term plan for `pathrs-lite` is to provide a build tag that will cause -all `pathrs-lite` operations to call into libpathrs directly, thus removing -code duplication for projects that wish to make use of libpathrs (and providing -the ability for software packagers to opt-in to libpathrs support without -needing to patch upstream). - -[libpathrs]: https://github.com/cyphar/libpathrs - -### License ### - -Most of this subpackage is licensed under the Mozilla Public License (version -2.0). For more information, see the top-level [COPYING.md][] and -[LICENSE.MPL-2.0][] files, as well as the individual license headers for each -file. - -``` -Copyright (C) 2024-2025 Aleksa Sarai -Copyright (C) 2024-2025 SUSE LLC - -This Source Code Form is subject to the terms of the Mozilla Public -License, v. 2.0. If a copy of the MPL was not distributed with this -file, You can obtain one at https://mozilla.org/MPL/2.0/. -``` - -[COPYING.md]: ../COPYING.md -[LICENSE.MPL-2.0]: ../LICENSE.MPL-2.0 diff --git a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/doc.go b/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/doc.go deleted file mode 100644 index d3d745175..000000000 --- a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/doc.go +++ /dev/null @@ -1,14 +0,0 @@ -// SPDX-License-Identifier: MPL-2.0 - -//go:build linux - -// Copyright (C) 2024-2025 Aleksa Sarai -// Copyright (C) 2024-2025 SUSE LLC -// -// This Source Code Form is subject to the terms of the Mozilla Public -// License, v. 2.0. If a copy of the MPL was not distributed with this -// file, You can obtain one at https://mozilla.org/MPL/2.0/. - -// Package pathrs (pathrs-lite) is a less complete pure Go implementation of -// some of the APIs provided by [libpathrs]. -package pathrs diff --git a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/assert/assert.go b/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/assert/assert.go deleted file mode 100644 index 595dfbf1a..000000000 --- a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/assert/assert.go +++ /dev/null @@ -1,30 +0,0 @@ -// SPDX-License-Identifier: MPL-2.0 - -// Copyright (C) 2025 Aleksa Sarai -// Copyright (C) 2025 SUSE LLC -// -// This Source Code Form is subject to the terms of the Mozilla Public -// License, v. 2.0. If a copy of the MPL was not distributed with this -// file, You can obtain one at https://mozilla.org/MPL/2.0/. - -// Package assert provides some basic assertion helpers for Go. -package assert - -import ( - "fmt" -) - -// Assert panics if the predicate is false with the provided argument. -func Assert(predicate bool, msg any) { - if !predicate { - panic(msg) - } -} - -// Assertf panics if the predicate is false and formats the message using the -// same formatting as [fmt.Printf]. -// -// [fmt.Printf]: https://pkg.go.dev/fmt#Printf -func Assertf(predicate bool, fmtMsg string, args ...any) { - Assert(predicate, fmt.Sprintf(fmtMsg, args...)) -} diff --git a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/errors_linux.go b/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/errors_linux.go deleted file mode 100644 index d0b200f4f..000000000 --- a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/errors_linux.go +++ /dev/null @@ -1,41 +0,0 @@ -// SPDX-License-Identifier: MPL-2.0 - -//go:build linux - -// Copyright (C) 2024-2025 Aleksa Sarai -// Copyright (C) 2024-2025 SUSE LLC -// -// This Source Code Form is subject to the terms of the Mozilla Public -// License, v. 2.0. If a copy of the MPL was not distributed with this -// file, You can obtain one at https://mozilla.org/MPL/2.0/. - -// Package internal contains unexported common code for filepath-securejoin. -package internal - -import ( - "errors" - - "golang.org/x/sys/unix" -) - -type xdevErrorish struct { - description string -} - -func (err xdevErrorish) Error() string { return err.description } -func (err xdevErrorish) Is(target error) bool { return target == unix.EXDEV } - -var ( - // ErrPossibleAttack indicates that some attack was detected. - ErrPossibleAttack error = xdevErrorish{"possible attack detected"} - - // ErrPossibleBreakout indicates that during an operation we ended up in a - // state that could be a breakout but we detected it. - ErrPossibleBreakout error = xdevErrorish{"possible breakout detected"} - - // ErrInvalidDirectory indicates an unlinked directory. - ErrInvalidDirectory = errors.New("wandered into deleted directory") - - // ErrDeletedInode indicates an unlinked file (non-directory). - ErrDeletedInode = errors.New("cannot verify path of deleted inode") -) diff --git a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/fd/at_linux.go b/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/fd/at_linux.go deleted file mode 100644 index 091054913..000000000 --- a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/fd/at_linux.go +++ /dev/null @@ -1,148 +0,0 @@ -// SPDX-License-Identifier: MPL-2.0 - -//go:build linux - -// Copyright (C) 2024-2025 Aleksa Sarai -// Copyright (C) 2024-2025 SUSE LLC -// -// This Source Code Form is subject to the terms of the Mozilla Public -// License, v. 2.0. If a copy of the MPL was not distributed with this -// file, You can obtain one at https://mozilla.org/MPL/2.0/. - -package fd - -import ( - "fmt" - "os" - "path/filepath" - "runtime" - - "golang.org/x/sys/unix" - - "github.com/cyphar/filepath-securejoin/pathrs-lite/internal/gocompat" -) - -// prepareAtWith returns -EBADF (an invalid fd) if dir is nil, otherwise using -// the dir.Fd(). We use -EBADF because in filepath-securejoin we generally -// don't want to allow relative-to-cwd paths. The returned path is an -// *informational* string that describes a reasonable pathname for the given -// *at(2) arguments. You must not use the full path for any actual filesystem -// operations. -func prepareAt(dir Fd, path string) (dirFd int, unsafeUnmaskedPath string) { - dirFd, dirPath := -int(unix.EBADF), "." - if dir != nil { - dirFd, dirPath = int(dir.Fd()), dir.Name() - } - if !filepath.IsAbs(path) { - // only prepend the dirfd path for relative paths - path = dirPath + "/" + path - } - // NOTE: If path is "." or "", the returned path won't be filepath.Clean, - // but that's okay since this path is either used for errors (in which case - // a trailing "/" or "/." is important information) or will be - // filepath.Clean'd later (in the case of fd.Openat). - return dirFd, path -} - -// Openat is an [Fd]-based wrapper around unix.Openat. -func Openat(dir Fd, path string, flags int, mode int) (*os.File, error) { //nolint:unparam // wrapper func - dirFd, fullPath := prepareAt(dir, path) - // Make sure we always set O_CLOEXEC. - flags |= unix.O_CLOEXEC - fd, err := unix.Openat(dirFd, path, flags, uint32(mode)) - if err != nil { - return nil, &os.PathError{Op: "openat", Path: fullPath, Err: err} - } - runtime.KeepAlive(dir) - // openat is only used with lexically-safe paths so we can use - // filepath.Clean here, and also the path itself is not going to be used - // for actual path operations. - fullPath = filepath.Clean(fullPath) - return os.NewFile(uintptr(fd), fullPath), nil -} - -// Fstatat is an [Fd]-based wrapper around unix.Fstatat. -func Fstatat(dir Fd, path string, flags int) (unix.Stat_t, error) { - dirFd, fullPath := prepareAt(dir, path) - var stat unix.Stat_t - if err := unix.Fstatat(dirFd, path, &stat, flags); err != nil { - return stat, &os.PathError{Op: "fstatat", Path: fullPath, Err: err} - } - runtime.KeepAlive(dir) - return stat, nil -} - -// Faccessat is an [Fd]-based wrapper around unix.Faccessat. -func Faccessat(dir Fd, path string, mode uint32, flags int) error { - dirFd, fullPath := prepareAt(dir, path) - err := unix.Faccessat(dirFd, path, mode, flags) - if err != nil { - err = &os.PathError{Op: "faccessat", Path: fullPath, Err: err} - } - runtime.KeepAlive(dir) - return err -} - -// Readlinkat is an [Fd]-based wrapper around unix.Readlinkat. -func Readlinkat(dir Fd, path string) (string, error) { - dirFd, fullPath := prepareAt(dir, path) - size := 4096 - for { - linkBuf := make([]byte, size) - n, err := unix.Readlinkat(dirFd, path, linkBuf) - if err != nil { - return "", &os.PathError{Op: "readlinkat", Path: fullPath, Err: err} - } - runtime.KeepAlive(dir) - if n != size { - return string(linkBuf[:n]), nil - } - // Possible truncation, resize the buffer. - size *= 2 - } -} - -const ( - // STATX_MNT_ID_UNIQUE is provided in golang.org/x/sys@v0.20.0, but in order to - // avoid bumping the requirement for a single constant we can just define it - // ourselves. - _STATX_MNT_ID_UNIQUE = 0x4000 //nolint:revive // unix.* name - - // We don't care which mount ID we get. The kernel will give us the unique - // one if it is supported. If the kernel doesn't support - // STATX_MNT_ID_UNIQUE, the bit is ignored and the returned request mask - // will only contain STATX_MNT_ID (if supported). - wantStatxMntMask = _STATX_MNT_ID_UNIQUE | unix.STATX_MNT_ID -) - -var hasStatxMountID = gocompat.SyncOnceValue(func() bool { - var stx unix.Statx_t - err := unix.Statx(-int(unix.EBADF), "/", 0, wantStatxMntMask, &stx) - return err == nil && stx.Mask&wantStatxMntMask != 0 -}) - -// GetMountID gets the mount identifier associated with the fd and path -// combination. It is effectively a wrapper around fetching -// STATX_MNT_ID{,_UNIQUE} with unix.Statx, but with a fallback to 0 if the -// kernel doesn't support the feature. -func GetMountID(dir Fd, path string) (uint64, error) { - // If we don't have statx(STATX_MNT_ID*) support, we can't do anything. - if !hasStatxMountID() { - return 0, nil - } - - dirFd, fullPath := prepareAt(dir, path) - - var stx unix.Statx_t - err := unix.Statx(dirFd, path, unix.AT_EMPTY_PATH|unix.AT_SYMLINK_NOFOLLOW, wantStatxMntMask, &stx) - if stx.Mask&wantStatxMntMask == 0 { - // It's not a kernel limitation, for some reason we couldn't get a - // mount ID. Assume it's some kind of attack. - err = fmt.Errorf("could not get mount id: %w", err) - } - if err != nil { - return 0, &os.PathError{Op: "statx(STATX_MNT_ID_...)", Path: fullPath, Err: err} - } - runtime.KeepAlive(dir) - return stx.Mnt_id, nil -} diff --git a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/fd/fd.go b/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/fd/fd.go deleted file mode 100644 index d2206a386..000000000 --- a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/fd/fd.go +++ /dev/null @@ -1,55 +0,0 @@ -// SPDX-License-Identifier: MPL-2.0 - -// Copyright (C) 2025 Aleksa Sarai -// Copyright (C) 2025 SUSE LLC -// -// This Source Code Form is subject to the terms of the Mozilla Public -// License, v. 2.0. If a copy of the MPL was not distributed with this -// file, You can obtain one at https://mozilla.org/MPL/2.0/. - -// Package fd provides a drop-in interface-based replacement of [*os.File] that -// allows for things like noop-Close wrappers to be used. -// -// [*os.File]: https://pkg.go.dev/os#File -package fd - -import ( - "io" - "os" -) - -// Fd is an interface that mirrors most of the API of [*os.File], allowing you -// to create wrappers that can be used in place of [*os.File]. -// -// [*os.File]: https://pkg.go.dev/os#File -type Fd interface { - io.Closer - Name() string - Fd() uintptr -} - -// Compile-time interface checks. -var ( - _ Fd = (*os.File)(nil) - _ Fd = noClose{} -) - -type noClose struct{ inner Fd } - -func (f noClose) Name() string { return f.inner.Name() } -func (f noClose) Fd() uintptr { return f.inner.Fd() } - -func (f noClose) Close() error { return nil } - -// NopCloser returns an [*os.File]-like object where the [Close] method is now -// a no-op. -// -// Note that for [*os.File] and similar objects, the Go garbage collector will -// still call [Close] on the underlying file unless you use -// [runtime.SetFinalizer] to disable this behaviour. This is up to the caller -// to do (if necessary). -// -// [*os.File]: https://pkg.go.dev/os#File -// [Close]: https://pkg.go.dev/io#Closer -// [runtime.SetFinalizer]: https://pkg.go.dev/runtime#SetFinalizer -func NopCloser(f Fd) Fd { return noClose{inner: f} } diff --git a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/fd/fd_linux.go b/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/fd/fd_linux.go deleted file mode 100644 index e1ec3c0b8..000000000 --- a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/fd/fd_linux.go +++ /dev/null @@ -1,78 +0,0 @@ -// SPDX-License-Identifier: MPL-2.0 - -//go:build linux - -// Copyright (C) 2024-2025 Aleksa Sarai -// Copyright (C) 2024-2025 SUSE LLC -// -// This Source Code Form is subject to the terms of the Mozilla Public -// License, v. 2.0. If a copy of the MPL was not distributed with this -// file, You can obtain one at https://mozilla.org/MPL/2.0/. - -package fd - -import ( - "fmt" - "os" - "runtime" - - "golang.org/x/sys/unix" - - "github.com/cyphar/filepath-securejoin/pathrs-lite/internal" -) - -// DupWithName creates a new file descriptor referencing the same underlying -// file, but with the provided name instead of fd.Name(). -func DupWithName(fd Fd, name string) (*os.File, error) { - fd2, err := unix.FcntlInt(fd.Fd(), unix.F_DUPFD_CLOEXEC, 0) - if err != nil { - return nil, os.NewSyscallError("fcntl(F_DUPFD_CLOEXEC)", err) - } - runtime.KeepAlive(fd) - return os.NewFile(uintptr(fd2), name), nil -} - -// Dup creates a new file description referencing the same underlying file. -func Dup(fd Fd) (*os.File, error) { - return DupWithName(fd, fd.Name()) -} - -// Fstat is an [Fd]-based wrapper around unix.Fstat. -func Fstat(fd Fd) (unix.Stat_t, error) { - var stat unix.Stat_t - if err := unix.Fstat(int(fd.Fd()), &stat); err != nil { - return stat, &os.PathError{Op: "fstat", Path: fd.Name(), Err: err} - } - runtime.KeepAlive(fd) - return stat, nil -} - -// Fstatfs is an [Fd]-based wrapper around unix.Fstatfs. -func Fstatfs(fd Fd) (unix.Statfs_t, error) { - var statfs unix.Statfs_t - if err := unix.Fstatfs(int(fd.Fd()), &statfs); err != nil { - return statfs, &os.PathError{Op: "fstatfs", Path: fd.Name(), Err: err} - } - runtime.KeepAlive(fd) - return statfs, nil -} - -// IsDeadInode detects whether the file has been unlinked from a filesystem and -// is thus a "dead inode" from the kernel's perspective. -func IsDeadInode(file Fd) error { - // If the nlink of a file drops to 0, there is an attacker deleting - // directories during our walk, which could result in weird /proc values. - // It's better to error out in this case. - stat, err := Fstat(file) - if err != nil { - return fmt.Errorf("check for dead inode: %w", err) - } - if stat.Nlink == 0 { - err := internal.ErrDeletedInode - if stat.Mode&unix.S_IFMT == unix.S_IFDIR { - err = internal.ErrInvalidDirectory - } - return fmt.Errorf("%w %q", err, file.Name()) - } - return nil -} diff --git a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/fd/mount_linux.go b/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/fd/mount_linux.go deleted file mode 100644 index 77549c7a9..000000000 --- a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/fd/mount_linux.go +++ /dev/null @@ -1,54 +0,0 @@ -// SPDX-License-Identifier: MPL-2.0 - -//go:build linux - -// Copyright (C) 2024-2025 Aleksa Sarai -// Copyright (C) 2024-2025 SUSE LLC -// -// This Source Code Form is subject to the terms of the Mozilla Public -// License, v. 2.0. If a copy of the MPL was not distributed with this -// file, You can obtain one at https://mozilla.org/MPL/2.0/. - -package fd - -import ( - "os" - "runtime" - - "golang.org/x/sys/unix" -) - -// Fsopen is an [Fd]-based wrapper around unix.Fsopen. -func Fsopen(fsName string, flags int) (*os.File, error) { - // Make sure we always set O_CLOEXEC. - flags |= unix.FSOPEN_CLOEXEC - fd, err := unix.Fsopen(fsName, flags) - if err != nil { - return nil, os.NewSyscallError("fsopen "+fsName, err) - } - return os.NewFile(uintptr(fd), "fscontext:"+fsName), nil -} - -// Fsmount is an [Fd]-based wrapper around unix.Fsmount. -func Fsmount(ctx Fd, flags, mountAttrs int) (*os.File, error) { - // Make sure we always set O_CLOEXEC. - flags |= unix.FSMOUNT_CLOEXEC - fd, err := unix.Fsmount(int(ctx.Fd()), flags, mountAttrs) - if err != nil { - return nil, os.NewSyscallError("fsmount "+ctx.Name(), err) - } - return os.NewFile(uintptr(fd), "fsmount:"+ctx.Name()), nil -} - -// OpenTree is an [Fd]-based wrapper around unix.OpenTree. -func OpenTree(dir Fd, path string, flags uint) (*os.File, error) { - dirFd, fullPath := prepareAt(dir, path) - // Make sure we always set O_CLOEXEC. - flags |= unix.OPEN_TREE_CLOEXEC - fd, err := unix.OpenTree(dirFd, path, flags) - if err != nil { - return nil, &os.PathError{Op: "open_tree", Path: fullPath, Err: err} - } - runtime.KeepAlive(dir) - return os.NewFile(uintptr(fd), fullPath), nil -} diff --git a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/fd/openat2_linux.go b/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/fd/openat2_linux.go deleted file mode 100644 index 3e937fe3c..000000000 --- a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/fd/openat2_linux.go +++ /dev/null @@ -1,62 +0,0 @@ -// SPDX-License-Identifier: MPL-2.0 - -//go:build linux - -// Copyright (C) 2024-2025 Aleksa Sarai -// Copyright (C) 2024-2025 SUSE LLC -// -// This Source Code Form is subject to the terms of the Mozilla Public -// License, v. 2.0. If a copy of the MPL was not distributed with this -// file, You can obtain one at https://mozilla.org/MPL/2.0/. - -package fd - -import ( - "errors" - "os" - "runtime" - - "golang.org/x/sys/unix" -) - -func scopedLookupShouldRetry(how *unix.OpenHow, err error) bool { - // RESOLVE_IN_ROOT (and RESOLVE_BENEATH) can return -EAGAIN if we resolve - // ".." while a mount or rename occurs anywhere on the system. This could - // happen spuriously, or as the result of an attacker trying to mess with - // us during lookup. - // - // In addition, scoped lookups have a "safety check" at the end of - // complete_walk which will return -EXDEV if the final path is not in the - // root. - return how.Resolve&(unix.RESOLVE_IN_ROOT|unix.RESOLVE_BENEATH) != 0 && - (errors.Is(err, unix.EAGAIN) || errors.Is(err, unix.EXDEV)) -} - -// This is a fairly arbitrary limit we have just to avoid an attacker being -// able to make us spin in an infinite retry loop -- callers can choose to -// retry on EAGAIN if they prefer. -const scopedLookupMaxRetries = 128 - -// Openat2 is an [Fd]-based wrapper around unix.Openat2, but with some retry -// logic in case of EAGAIN errors. -func Openat2(dir Fd, path string, how *unix.OpenHow) (*os.File, error) { - dirFd, fullPath := prepareAt(dir, path) - // Make sure we always set O_CLOEXEC. - how.Flags |= unix.O_CLOEXEC - var tries int - for { - fd, err := unix.Openat2(dirFd, path, how) - if err != nil { - if scopedLookupShouldRetry(how, err) && tries < scopedLookupMaxRetries { - // We retry a couple of times to avoid the spurious errors, and - // if we are being attacked then returning -EAGAIN is the best - // we can do. - tries++ - continue - } - return nil, &os.PathError{Op: "openat2", Path: fullPath, Err: err} - } - runtime.KeepAlive(dir) - return os.NewFile(uintptr(fd), fullPath), nil - } -} diff --git a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/gocompat/README.md b/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/gocompat/README.md deleted file mode 100644 index 5dcb6ae00..000000000 --- a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/gocompat/README.md +++ /dev/null @@ -1,10 +0,0 @@ -## gocompat ## - -This directory contains backports of stdlib functions from later Go versions so -the filepath-securejoin can continue to be used by projects that are stuck with -Go 1.18 support. Note that often filepath-securejoin is added in security -patches for old releases, so avoiding the need to bump Go compiler requirements -is a huge plus to downstreams. - -The source code is licensed under the same license as the Go stdlib. See the -source files for the precise license information. diff --git a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/gocompat/doc.go b/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/gocompat/doc.go deleted file mode 100644 index 4b1803f58..000000000 --- a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/gocompat/doc.go +++ /dev/null @@ -1,13 +0,0 @@ -// SPDX-License-Identifier: BSD-3-Clause -//go:build linux && go1.20 - -// Copyright (C) 2025 SUSE LLC. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// Package gocompat includes compatibility shims (backported from future Go -// stdlib versions) to permit filepath-securejoin to be used with older Go -// versions (often filepath-securejoin is added in security patches for old -// releases, so avoiding the need to bump Go compiler requirements is a huge -// plus to downstreams). -package gocompat diff --git a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/gocompat/gocompat_errors_go120.go b/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/gocompat/gocompat_errors_go120.go deleted file mode 100644 index 4a114bd3d..000000000 --- a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/gocompat/gocompat_errors_go120.go +++ /dev/null @@ -1,19 +0,0 @@ -// SPDX-License-Identifier: BSD-3-Clause -//go:build linux && go1.20 - -// Copyright (C) 2024 SUSE LLC. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package gocompat - -import ( - "fmt" -) - -// WrapBaseError is a helper that is equivalent to fmt.Errorf("%w: %w"), except -// that on pre-1.20 Go versions only errors.Is() works properly (errors.Unwrap) -// is only guaranteed to give you baseErr. -func WrapBaseError(baseErr, extraErr error) error { - return fmt.Errorf("%w: %w", extraErr, baseErr) -} diff --git a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/gocompat/gocompat_errors_unsupported.go b/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/gocompat/gocompat_errors_unsupported.go deleted file mode 100644 index 3061016a6..000000000 --- a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/gocompat/gocompat_errors_unsupported.go +++ /dev/null @@ -1,40 +0,0 @@ -// SPDX-License-Identifier: BSD-3-Clause - -//go:build linux && !go1.20 - -// Copyright (C) 2024 SUSE LLC. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package gocompat - -import ( - "fmt" -) - -type wrappedError struct { - inner error - isError error -} - -func (err wrappedError) Is(target error) bool { - return err.isError == target -} - -func (err wrappedError) Unwrap() error { - return err.inner -} - -func (err wrappedError) Error() string { - return fmt.Sprintf("%v: %v", err.isError, err.inner) -} - -// WrapBaseError is a helper that is equivalent to fmt.Errorf("%w: %w"), except -// that on pre-1.20 Go versions only errors.Is() works properly (errors.Unwrap) -// is only guaranteed to give you baseErr. -func WrapBaseError(baseErr, extraErr error) error { - return wrappedError{ - inner: baseErr, - isError: extraErr, - } -} diff --git a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/gocompat/gocompat_generics_go121.go b/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/gocompat/gocompat_generics_go121.go deleted file mode 100644 index d4a938186..000000000 --- a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/gocompat/gocompat_generics_go121.go +++ /dev/null @@ -1,53 +0,0 @@ -// SPDX-License-Identifier: BSD-3-Clause - -//go:build linux && go1.21 - -// Copyright (C) 2024-2025 SUSE LLC. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package gocompat - -import ( - "cmp" - "slices" - "sync" -) - -// SlicesDeleteFunc is equivalent to Go 1.21's slices.DeleteFunc. -func SlicesDeleteFunc[S ~[]E, E any](slice S, delFn func(E) bool) S { - return slices.DeleteFunc(slice, delFn) -} - -// SlicesContains is equivalent to Go 1.21's slices.Contains. -func SlicesContains[S ~[]E, E comparable](slice S, val E) bool { - return slices.Contains(slice, val) -} - -// SlicesClone is equivalent to Go 1.21's slices.Clone. -func SlicesClone[S ~[]E, E any](slice S) S { - return slices.Clone(slice) -} - -// SyncOnceValue is equivalent to Go 1.21's sync.OnceValue. -func SyncOnceValue[T any](f func() T) func() T { - return sync.OnceValue(f) -} - -// SyncOnceValues is equivalent to Go 1.21's sync.OnceValues. -func SyncOnceValues[T1, T2 any](f func() (T1, T2)) func() (T1, T2) { - return sync.OnceValues(f) -} - -// CmpOrdered is equivalent to Go 1.21's cmp.Ordered generic type definition. -type CmpOrdered = cmp.Ordered - -// CmpCompare is equivalent to Go 1.21's cmp.Compare. -func CmpCompare[T CmpOrdered](x, y T) int { - return cmp.Compare(x, y) -} - -// Max2 is equivalent to Go 1.21's max builtin (but only for two parameters). -func Max2[T CmpOrdered](x, y T) T { - return max(x, y) -} diff --git a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/gocompat/gocompat_generics_unsupported.go b/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/gocompat/gocompat_generics_unsupported.go deleted file mode 100644 index 0ea6218aa..000000000 --- a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/gocompat/gocompat_generics_unsupported.go +++ /dev/null @@ -1,187 +0,0 @@ -// SPDX-License-Identifier: BSD-3-Clause - -//go:build linux && !go1.21 - -// Copyright (C) 2021, 2022 The Go Authors. All rights reserved. -// Copyright (C) 2024-2025 SUSE LLC. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE.BSD file. - -package gocompat - -import ( - "sync" -) - -// These are very minimal implementations of functions that appear in Go 1.21's -// stdlib, included so that we can build on older Go versions. Most are -// borrowed directly from the stdlib, and a few are modified to be "obviously -// correct" without needing to copy too many other helpers. - -// clearSlice is equivalent to Go 1.21's builtin clear. -// Copied from the Go 1.24 stdlib implementation. -func clearSlice[S ~[]E, E any](slice S) { - var zero E - for i := range slice { - slice[i] = zero - } -} - -// slicesIndexFunc is equivalent to Go 1.21's slices.IndexFunc. -// Copied from the Go 1.24 stdlib implementation. -func slicesIndexFunc[S ~[]E, E any](s S, f func(E) bool) int { - for i := range s { - if f(s[i]) { - return i - } - } - return -1 -} - -// SlicesDeleteFunc is equivalent to Go 1.21's slices.DeleteFunc. -// Copied from the Go 1.24 stdlib implementation. -func SlicesDeleteFunc[S ~[]E, E any](s S, del func(E) bool) S { - i := slicesIndexFunc(s, del) - if i == -1 { - return s - } - // Don't start copying elements until we find one to delete. - for j := i + 1; j < len(s); j++ { - if v := s[j]; !del(v) { - s[i] = v - i++ - } - } - clearSlice(s[i:]) // zero/nil out the obsolete elements, for GC - return s[:i] -} - -// SlicesContains is equivalent to Go 1.21's slices.Contains. -// Similar to the stdlib slices.Contains, except that we don't have -// slices.Index so we need to use slices.IndexFunc for this non-Func helper. -func SlicesContains[S ~[]E, E comparable](s S, v E) bool { - return slicesIndexFunc(s, func(e E) bool { return e == v }) >= 0 -} - -// SlicesClone is equivalent to Go 1.21's slices.Clone. -// Copied from the Go 1.24 stdlib implementation. -func SlicesClone[S ~[]E, E any](s S) S { - // Preserve nil in case it matters. - if s == nil { - return nil - } - return append(S([]E{}), s...) -} - -// SyncOnceValue is equivalent to Go 1.21's sync.OnceValue. -// Copied from the Go 1.25 stdlib implementation. -func SyncOnceValue[T any](f func() T) func() T { - // Use a struct so that there's a single heap allocation. - d := struct { - f func() T - once sync.Once - valid bool - p any - result T - }{ - f: f, - } - return func() T { - d.once.Do(func() { - defer func() { - d.f = nil - d.p = recover() - if !d.valid { - panic(d.p) - } - }() - d.result = d.f() - d.valid = true - }) - if !d.valid { - panic(d.p) - } - return d.result - } -} - -// SyncOnceValues is equivalent to Go 1.21's sync.OnceValues. -// Copied from the Go 1.25 stdlib implementation. -func SyncOnceValues[T1, T2 any](f func() (T1, T2)) func() (T1, T2) { - // Use a struct so that there's a single heap allocation. - d := struct { - f func() (T1, T2) - once sync.Once - valid bool - p any - r1 T1 - r2 T2 - }{ - f: f, - } - return func() (T1, T2) { - d.once.Do(func() { - defer func() { - d.f = nil - d.p = recover() - if !d.valid { - panic(d.p) - } - }() - d.r1, d.r2 = d.f() - d.valid = true - }) - if !d.valid { - panic(d.p) - } - return d.r1, d.r2 - } -} - -// CmpOrdered is equivalent to Go 1.21's cmp.Ordered generic type definition. -// Copied from the Go 1.25 stdlib implementation. -type CmpOrdered interface { - ~int | ~int8 | ~int16 | ~int32 | ~int64 | - ~uint | ~uint8 | ~uint16 | ~uint32 | ~uint64 | ~uintptr | - ~float32 | ~float64 | - ~string -} - -// isNaN reports whether x is a NaN without requiring the math package. -// This will always return false if T is not floating-point. -// Copied from the Go 1.25 stdlib implementation. -func isNaN[T CmpOrdered](x T) bool { - return x != x -} - -// CmpCompare is equivalent to Go 1.21's cmp.Compare. -// Copied from the Go 1.25 stdlib implementation. -func CmpCompare[T CmpOrdered](x, y T) int { - xNaN := isNaN(x) - yNaN := isNaN(y) - if xNaN { - if yNaN { - return 0 - } - return -1 - } - if yNaN { - return +1 - } - if x < y { - return -1 - } - if x > y { - return +1 - } - return 0 -} - -// Max2 is equivalent to Go 1.21's max builtin for two parameters. -func Max2[T CmpOrdered](x, y T) T { - m := x - if y > m { - m = y - } - return m -} diff --git a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/kernelversion/kernel_linux.go b/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/kernelversion/kernel_linux.go deleted file mode 100644 index cb6de4186..000000000 --- a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/kernelversion/kernel_linux.go +++ /dev/null @@ -1,123 +0,0 @@ -// SPDX-License-Identifier: BSD-3-Clause - -// Copyright (C) 2022 The Go Authors. All rights reserved. -// Copyright (C) 2025 SUSE LLC. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE.BSD file. - -// The parsing logic is very loosely based on the Go stdlib's -// src/internal/syscall/unix/kernel_version_linux.go but with an API that looks -// a bit like runc's libcontainer/system/kernelversion. -// -// TODO(cyphar): This API has been copied around to a lot of different projects -// (Docker, containerd, runc, and now filepath-securejoin) -- maybe we should -// put it in a separate project? - -// Package kernelversion provides a simple mechanism for checking whether the -// running kernel is at least as new as some baseline kernel version. This is -// often useful when checking for features that would be too complicated to -// test support for (or in cases where we know that some kernel features in -// backport-heavy kernels are broken and need to be avoided). -package kernelversion - -import ( - "bytes" - "errors" - "fmt" - "strconv" - "strings" - - "golang.org/x/sys/unix" - - "github.com/cyphar/filepath-securejoin/pathrs-lite/internal/gocompat" -) - -// KernelVersion is a numeric representation of the key numerical elements of a -// kernel version (for instance, "4.1.2-default-1" would be represented as -// KernelVersion{4, 1, 2}). -type KernelVersion []uint64 - -func (kver KernelVersion) String() string { - var str strings.Builder - for idx, elem := range kver { - if idx != 0 { - _, _ = str.WriteRune('.') - } - _, _ = str.WriteString(strconv.FormatUint(elem, 10)) - } - return str.String() -} - -var errInvalidKernelVersion = errors.New("invalid kernel version") - -// parseKernelVersion parses a string and creates a KernelVersion based on it. -func parseKernelVersion(kverStr string) (KernelVersion, error) { - kver := make(KernelVersion, 1, 3) - for idx, ch := range kverStr { - if '0' <= ch && ch <= '9' { - v := &kver[len(kver)-1] - *v = (*v * 10) + uint64(ch-'0') - } else { - if idx == 0 || kverStr[idx-1] < '0' || '9' < kverStr[idx-1] { - // "." must be preceded by a digit while in version section - return nil, fmt.Errorf("%w %q: kernel version has dot(s) followed by non-digit in version section", errInvalidKernelVersion, kverStr) - } - if ch != '.' { - break - } - kver = append(kver, 0) - } - } - if len(kver) < 2 { - return nil, fmt.Errorf("%w %q: kernel versions must contain at least two components", errInvalidKernelVersion, kverStr) - } - return kver, nil -} - -// getKernelVersion gets the current kernel version. -var getKernelVersion = gocompat.SyncOnceValues(func() (KernelVersion, error) { - var uts unix.Utsname - if err := unix.Uname(&uts); err != nil { - return nil, err - } - // Remove the \x00 from the release. - release := uts.Release[:] - return parseKernelVersion(string(release[:bytes.IndexByte(release, 0)])) -}) - -// GreaterEqualThan returns true if the the host kernel version is greater than -// or equal to the provided [KernelVersion]. When doing this comparison, any -// non-numerical suffixes of the host kernel version are ignored. -// -// If the number of components provided is not equal to the number of numerical -// components of the host kernel version, any missing components are treated as -// 0. This means that GreaterEqualThan(KernelVersion{4}) will be treated the -// same as GreaterEqualThan(KernelVersion{4, 0, 0, ..., 0, 0}), and that if the -// host kernel version is "4" then GreaterEqualThan(KernelVersion{4, 1}) will -// return false (because the host version will be treated as "4.0"). -func GreaterEqualThan(wantKver KernelVersion) (bool, error) { - hostKver, err := getKernelVersion() - if err != nil { - return false, err - } - - // Pad out the kernel version lengths to match one another. - cmpLen := gocompat.Max2(len(hostKver), len(wantKver)) - hostKver = append(hostKver, make(KernelVersion, cmpLen-len(hostKver))...) - wantKver = append(wantKver, make(KernelVersion, cmpLen-len(wantKver))...) - - for i := 0; i < cmpLen; i++ { - switch gocompat.CmpCompare(hostKver[i], wantKver[i]) { - case -1: - // host < want - return false, nil - case +1: - // host > want - return true, nil - case 0: - continue - } - } - // equal version values - return true, nil -} diff --git a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/linux/doc.go b/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/linux/doc.go deleted file mode 100644 index 4635714f6..000000000 --- a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/linux/doc.go +++ /dev/null @@ -1,12 +0,0 @@ -// SPDX-License-Identifier: MPL-2.0 - -// Copyright (C) 2024-2025 Aleksa Sarai -// Copyright (C) 2024-2025 SUSE LLC -// -// This Source Code Form is subject to the terms of the Mozilla Public -// License, v. 2.0. If a copy of the MPL was not distributed with this -// file, You can obtain one at https://mozilla.org/MPL/2.0/. - -// Package linux returns information about what features are supported on the -// running kernel. -package linux diff --git a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/linux/mount_linux.go b/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/linux/mount_linux.go deleted file mode 100644 index b29905bff..000000000 --- a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/linux/mount_linux.go +++ /dev/null @@ -1,47 +0,0 @@ -// SPDX-License-Identifier: MPL-2.0 - -//go:build linux - -// Copyright (C) 2024-2025 Aleksa Sarai -// Copyright (C) 2024-2025 SUSE LLC -// -// This Source Code Form is subject to the terms of the Mozilla Public -// License, v. 2.0. If a copy of the MPL was not distributed with this -// file, You can obtain one at https://mozilla.org/MPL/2.0/. - -package linux - -import ( - "golang.org/x/sys/unix" - - "github.com/cyphar/filepath-securejoin/pathrs-lite/internal/gocompat" - "github.com/cyphar/filepath-securejoin/pathrs-lite/internal/kernelversion" -) - -// HasNewMountAPI returns whether the new fsopen(2) mount API is supported on -// the running kernel. -var HasNewMountAPI = gocompat.SyncOnceValue(func() bool { - // All of the pieces of the new mount API we use (fsopen, fsconfig, - // fsmount, open_tree) were added together in Linux 5.2[1,2], so we can - // just check for one of the syscalls and the others should also be - // available. - // - // Just try to use open_tree(2) to open a file without OPEN_TREE_CLONE. - // This is equivalent to openat(2), but tells us if open_tree is - // available (and thus all of the other basic new mount API syscalls). - // open_tree(2) is most light-weight syscall to test here. - // - // [1]: merge commit 400913252d09 - // [2]: - fd, err := unix.OpenTree(-int(unix.EBADF), "/", unix.OPEN_TREE_CLOEXEC) - if err != nil { - return false - } - _ = unix.Close(fd) - - // RHEL 8 has a backport of fsopen(2) that appears to have some very - // difficult to debug performance pathology. As such, it seems prudent to - // simply reject pre-5.2 kernels. - isNotBackport, _ := kernelversion.GreaterEqualThan(kernelversion.KernelVersion{5, 2}) - return isNotBackport -}) diff --git a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/linux/openat2_linux.go b/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/linux/openat2_linux.go deleted file mode 100644 index 399609dc3..000000000 --- a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/linux/openat2_linux.go +++ /dev/null @@ -1,31 +0,0 @@ -// SPDX-License-Identifier: MPL-2.0 - -//go:build linux - -// Copyright (C) 2024-2025 Aleksa Sarai -// Copyright (C) 2024-2025 SUSE LLC -// -// This Source Code Form is subject to the terms of the Mozilla Public -// License, v. 2.0. If a copy of the MPL was not distributed with this -// file, You can obtain one at https://mozilla.org/MPL/2.0/. - -package linux - -import ( - "golang.org/x/sys/unix" - - "github.com/cyphar/filepath-securejoin/pathrs-lite/internal/gocompat" -) - -// HasOpenat2 returns whether openat2(2) is supported on the running kernel. -var HasOpenat2 = gocompat.SyncOnceValue(func() bool { - fd, err := unix.Openat2(unix.AT_FDCWD, ".", &unix.OpenHow{ - Flags: unix.O_PATH | unix.O_CLOEXEC, - Resolve: unix.RESOLVE_NO_SYMLINKS | unix.RESOLVE_IN_ROOT, - }) - if err != nil { - return false - } - _ = unix.Close(fd) - return true -}) diff --git a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/procfs/procfs_linux.go b/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/procfs/procfs_linux.go deleted file mode 100644 index 21e0a62e8..000000000 --- a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/procfs/procfs_linux.go +++ /dev/null @@ -1,544 +0,0 @@ -// SPDX-License-Identifier: MPL-2.0 - -//go:build linux - -// Copyright (C) 2024-2025 Aleksa Sarai -// Copyright (C) 2024-2025 SUSE LLC -// -// This Source Code Form is subject to the terms of the Mozilla Public -// License, v. 2.0. If a copy of the MPL was not distributed with this -// file, You can obtain one at https://mozilla.org/MPL/2.0/. - -// Package procfs provides a safe API for operating on /proc on Linux. Note -// that this is the *internal* procfs API, mainy needed due to Go's -// restrictions on cyclic dependencies and its incredibly minimal visibility -// system without making a separate internal/ package. -package procfs - -import ( - "errors" - "fmt" - "io" - "os" - "runtime" - "strconv" - - "golang.org/x/sys/unix" - - "github.com/cyphar/filepath-securejoin/pathrs-lite/internal" - "github.com/cyphar/filepath-securejoin/pathrs-lite/internal/assert" - "github.com/cyphar/filepath-securejoin/pathrs-lite/internal/fd" - "github.com/cyphar/filepath-securejoin/pathrs-lite/internal/gocompat" - "github.com/cyphar/filepath-securejoin/pathrs-lite/internal/linux" -) - -// The kernel guarantees that the root inode of a procfs mount has an -// f_type of PROC_SUPER_MAGIC and st_ino of PROC_ROOT_INO. -const ( - procSuperMagic = 0x9fa0 // PROC_SUPER_MAGIC - procRootIno = 1 // PROC_ROOT_INO -) - -// verifyProcHandle checks that the handle is from a procfs filesystem. -// Contrast this to [verifyProcRoot], which also verifies that the handle is -// the root of a procfs mount. -func verifyProcHandle(procHandle fd.Fd) error { - if statfs, err := fd.Fstatfs(procHandle); err != nil { - return err - } else if statfs.Type != procSuperMagic { - return fmt.Errorf("%w: incorrect procfs root filesystem type 0x%x", errUnsafeProcfs, statfs.Type) - } - return nil -} - -// verifyProcRoot verifies that the handle is the root of a procfs filesystem. -// Contrast this to [verifyProcHandle], which only verifies if the handle is -// some file on procfs (regardless of what file it is). -func verifyProcRoot(procRoot fd.Fd) error { - if err := verifyProcHandle(procRoot); err != nil { - return err - } - if stat, err := fd.Fstat(procRoot); err != nil { - return err - } else if stat.Ino != procRootIno { - return fmt.Errorf("%w: incorrect procfs root inode number %d", errUnsafeProcfs, stat.Ino) - } - return nil -} - -type procfsFeatures struct { - // hasSubsetPid was added in Linux 5.8, along with hidepid=ptraceable (and - // string-based hidepid= values). Before this patchset, it was not really - // safe to try to modify procfs superblock flags because the superblock was - // shared -- so if this feature is not available, **you should not set any - // superblock flags**. - // - // 6814ef2d992a ("proc: add option to mount only a pids subset") - // fa10fed30f25 ("proc: allow to mount many instances of proc in one pid namespace") - // 24a71ce5c47f ("proc: instantiate only pids that we can ptrace on 'hidepid=4' mount option") - // 1c6c4d112e81 ("proc: use human-readable values for hidepid") - // 9ff7258575d5 ("Merge branch 'proc-linus' of git://git.kernel.org/pub/scm/linux/kernel/git/ebiederm/user-namespace") - hasSubsetPid bool -} - -var getProcfsFeatures = gocompat.SyncOnceValue(func() procfsFeatures { - if !linux.HasNewMountAPI() { - return procfsFeatures{} - } - procfsCtx, err := fd.Fsopen("proc", unix.FSOPEN_CLOEXEC) - if err != nil { - return procfsFeatures{} - } - defer procfsCtx.Close() //nolint:errcheck // close failures aren't critical here - - return procfsFeatures{ - hasSubsetPid: unix.FsconfigSetString(int(procfsCtx.Fd()), "subset", "pid") == nil, - } -}) - -func newPrivateProcMount(subset bool) (_ *Handle, Err error) { - procfsCtx, err := fd.Fsopen("proc", unix.FSOPEN_CLOEXEC) - if err != nil { - return nil, err - } - defer procfsCtx.Close() //nolint:errcheck // close failures aren't critical here - - if subset && getProcfsFeatures().hasSubsetPid { - // Try to configure hidepid=ptraceable,subset=pid if possible, but - // ignore errors. - _ = unix.FsconfigSetString(int(procfsCtx.Fd()), "hidepid", "ptraceable") - _ = unix.FsconfigSetString(int(procfsCtx.Fd()), "subset", "pid") - } - - // Get an actual handle. - if err := unix.FsconfigCreate(int(procfsCtx.Fd())); err != nil { - return nil, os.NewSyscallError("fsconfig create procfs", err) - } - // TODO: Output any information from the fscontext log to debug logs. - procRoot, err := fd.Fsmount(procfsCtx, unix.FSMOUNT_CLOEXEC, unix.MS_NODEV|unix.MS_NOEXEC|unix.MS_NOSUID) - if err != nil { - return nil, err - } - defer func() { - if Err != nil { - _ = procRoot.Close() - } - }() - return newHandle(procRoot) -} - -func clonePrivateProcMount() (_ *Handle, Err error) { - // Try to make a clone without using AT_RECURSIVE if we can. If this works, - // we can be sure there are no over-mounts and so if the root is valid then - // we're golden. Otherwise, we have to deal with over-mounts. - procRoot, err := fd.OpenTree(nil, "/proc", unix.OPEN_TREE_CLONE) - if err != nil || hookForcePrivateProcRootOpenTreeAtRecursive(procRoot) { - procRoot, err = fd.OpenTree(nil, "/proc", unix.OPEN_TREE_CLONE|unix.AT_RECURSIVE) - } - if err != nil { - return nil, fmt.Errorf("creating a detached procfs clone: %w", err) - } - defer func() { - if Err != nil { - _ = procRoot.Close() - } - }() - return newHandle(procRoot) -} - -func privateProcRoot(subset bool) (*Handle, error) { - if !linux.HasNewMountAPI() || hookForceGetProcRootUnsafe() { - return nil, fmt.Errorf("new mount api: %w", unix.ENOTSUP) - } - // Try to create a new procfs mount from scratch if we can. This ensures we - // can get a procfs mount even if /proc is fake (for whatever reason). - procRoot, err := newPrivateProcMount(subset) - if err != nil || hookForcePrivateProcRootOpenTree(procRoot) { - // Try to clone /proc then... - procRoot, err = clonePrivateProcMount() - } - return procRoot, err -} - -func unsafeHostProcRoot() (_ *Handle, Err error) { - procRoot, err := os.OpenFile("/proc", unix.O_PATH|unix.O_NOFOLLOW|unix.O_DIRECTORY|unix.O_CLOEXEC, 0) - if err != nil { - return nil, err - } - defer func() { - if Err != nil { - _ = procRoot.Close() - } - }() - return newHandle(procRoot) -} - -// Handle is a wrapper around an *os.File handle to "/proc", which can be used -// to do further procfs-related operations in a safe way. -type Handle struct { - Inner fd.Fd - // Does this handle have subset=pid set? - isSubset bool -} - -func newHandle(procRoot fd.Fd) (*Handle, error) { - if err := verifyProcRoot(procRoot); err != nil { - // This is only used in methods that - _ = procRoot.Close() - return nil, err - } - proc := &Handle{Inner: procRoot} - // With subset=pid we can be sure that /proc/uptime will not exist. - if err := fd.Faccessat(proc.Inner, "uptime", unix.F_OK, unix.AT_SYMLINK_NOFOLLOW); err != nil { - proc.isSubset = errors.Is(err, os.ErrNotExist) - } - return proc, nil -} - -// Close closes the underlying file for the Handle. -func (proc *Handle) Close() error { return proc.Inner.Close() } - -var getCachedProcRoot = gocompat.SyncOnceValue(func() *Handle { - procRoot, err := getProcRoot(true) - if err != nil { - return nil // just don't cache if we see an error - } - if !procRoot.isSubset { - return nil // we only cache verified subset=pid handles - } - - // Disarm (*Handle).Close() to stop someone from accidentally closing - // the global handle. - procRoot.Inner = fd.NopCloser(procRoot.Inner) - return procRoot -}) - -// OpenProcRoot tries to open a "safer" handle to "/proc". -func OpenProcRoot() (*Handle, error) { - if proc := getCachedProcRoot(); proc != nil { - return proc, nil - } - return getProcRoot(true) -} - -// OpenUnsafeProcRoot opens a handle to "/proc" without any overmounts or -// masked paths (but also without "subset=pid"). -func OpenUnsafeProcRoot() (*Handle, error) { return getProcRoot(false) } - -func getProcRoot(subset bool) (*Handle, error) { - proc, err := privateProcRoot(subset) - if err != nil { - // Fall back to using a /proc handle if making a private mount failed. - // If we have openat2, at least we can avoid some kinds of over-mount - // attacks, but without openat2 there's not much we can do. - proc, err = unsafeHostProcRoot() - } - return proc, err -} - -var hasProcThreadSelf = gocompat.SyncOnceValue(func() bool { - return unix.Access("/proc/thread-self/", unix.F_OK) == nil -}) - -var errUnsafeProcfs = errors.New("unsafe procfs detected") - -// lookup is a very minimal wrapper around [procfsLookupInRoot] which is -// intended to be called from the external API. -func (proc *Handle) lookup(subpath string) (*os.File, error) { - handle, err := procfsLookupInRoot(proc.Inner, subpath) - if err != nil { - return nil, err - } - return handle, nil -} - -// procfsBase is an enum indicating the prefix of a subpath in operations -// involving [Handle]s. -type procfsBase string - -const ( - // ProcRoot refers to the root of the procfs (i.e., "/proc/"). - ProcRoot procfsBase = "/proc" - // ProcSelf refers to the current process' subdirectory (i.e., - // "/proc/self/"). - ProcSelf procfsBase = "/proc/self" - // ProcThreadSelf refers to the current thread's subdirectory (i.e., - // "/proc/thread-self/"). In multi-threaded programs (i.e., all Go - // programs) where one thread has a different CLONE_FS, it is possible for - // "/proc/self" to point the wrong thread and so "/proc/thread-self" may be - // necessary. Note that on pre-3.17 kernels, "/proc/thread-self" doesn't - // exist and so a fallback will be used in that case. - ProcThreadSelf procfsBase = "/proc/thread-self" - // TODO: Switch to an interface setup so we can have a more type-safe - // version of ProcPid and remove the need to worry about invalid string - // values. -) - -// prefix returns a prefix that can be used with the given [Handle]. -func (base procfsBase) prefix(proc *Handle) (string, error) { - switch base { - case ProcRoot: - return ".", nil - case ProcSelf: - return "self", nil - case ProcThreadSelf: - threadSelf := "thread-self" - if !hasProcThreadSelf() || hookForceProcSelfTask() { - // Pre-3.17 kernels don't have /proc/thread-self, so do it - // manually. - threadSelf = "self/task/" + strconv.Itoa(unix.Gettid()) - if err := fd.Faccessat(proc.Inner, threadSelf, unix.F_OK, unix.AT_SYMLINK_NOFOLLOW); err != nil || hookForceProcSelf() { - // In this case, we running in a pid namespace that doesn't - // match the /proc mount we have. This can happen inside runc. - // - // Unfortunately, there is no nice way to get the correct TID - // to use here because of the age of the kernel, so we have to - // just use /proc/self and hope that it works. - threadSelf = "self" - } - } - return threadSelf, nil - } - return "", fmt.Errorf("invalid procfs base %q", base) -} - -// ProcThreadSelfCloser is a callback that needs to be called when you are done -// operating on an [os.File] fetched using [ProcThreadSelf]. -// -// [os.File]: https://pkg.go.dev/os#File -type ProcThreadSelfCloser func() - -// open is the core lookup operation for [Handle]. It returns a handle to -// "/proc//". If the returned [ProcThreadSelfCloser] is non-nil, -// you should call it after you are done interacting with the returned handle. -// -// In general you should use prefer to use the other helpers, as they remove -// the need to interact with [procfsBase] and do not return a nil -// [ProcThreadSelfCloser] for [procfsBase] values other than [ProcThreadSelf] -// where it is necessary. -func (proc *Handle) open(base procfsBase, subpath string) (_ *os.File, closer ProcThreadSelfCloser, Err error) { - prefix, err := base.prefix(proc) - if err != nil { - return nil, nil, err - } - subpath = prefix + "/" + subpath - - switch base { - case ProcRoot: - file, err := proc.lookup(subpath) - if errors.Is(err, os.ErrNotExist) { - // The Handle handle in use might be a subset=pid one, which will - // result in spurious errors. In this case, just open a temporary - // unmasked procfs handle for this operation. - proc, err2 := OpenUnsafeProcRoot() // !subset=pid - if err2 != nil { - return nil, nil, err - } - defer proc.Close() //nolint:errcheck // close failures aren't critical here - - file, err = proc.lookup(subpath) - } - return file, nil, err - - case ProcSelf: - file, err := proc.lookup(subpath) - return file, nil, err - - case ProcThreadSelf: - // We need to lock our thread until the caller is done with the handle - // because between getting the handle and using it we could get - // interrupted by the Go runtime and hit the case where the underlying - // thread is swapped out and the original thread is killed, resulting - // in pull-your-hair-out-hard-to-debug issues in the caller. - runtime.LockOSThread() - defer func() { - if Err != nil { - runtime.UnlockOSThread() - closer = nil - } - }() - - file, err := proc.lookup(subpath) - return file, runtime.UnlockOSThread, err - } - // should never be reached - return nil, nil, fmt.Errorf("[internal error] invalid procfs base %q", base) -} - -// OpenThreadSelf returns a handle to "/proc/thread-self/" (or an -// equivalent handle on older kernels where "/proc/thread-self" doesn't exist). -// Once finished with the handle, you must call the returned closer function -// (runtime.UnlockOSThread). You must not pass the returned *os.File to other -// Go threads or use the handle after calling the closer. -func (proc *Handle) OpenThreadSelf(subpath string) (_ *os.File, _ ProcThreadSelfCloser, Err error) { - return proc.open(ProcThreadSelf, subpath) -} - -// OpenSelf returns a handle to /proc/self/. -func (proc *Handle) OpenSelf(subpath string) (*os.File, error) { - file, closer, err := proc.open(ProcSelf, subpath) - assert.Assert(closer == nil, "closer for ProcSelf must be nil") - return file, err -} - -// OpenRoot returns a handle to /proc/. -func (proc *Handle) OpenRoot(subpath string) (*os.File, error) { - file, closer, err := proc.open(ProcRoot, subpath) - assert.Assert(closer == nil, "closer for ProcRoot must be nil") - return file, err -} - -// OpenPid returns a handle to /proc/$pid/ (pid can be a pid or tid). -// This is mainly intended for usage when operating on other processes. -func (proc *Handle) OpenPid(pid int, subpath string) (*os.File, error) { - return proc.OpenRoot(strconv.Itoa(pid) + "/" + subpath) -} - -// checkSubpathOvermount checks if the dirfd and path combination is on the -// same mount as the given root. -func checkSubpathOvermount(root, dir fd.Fd, path string) error { - // Get the mntID of our procfs handle. - expectedMountID, err := fd.GetMountID(root, "") - if err != nil { - return fmt.Errorf("get root mount id: %w", err) - } - // Get the mntID of the target magic-link. - gotMountID, err := fd.GetMountID(dir, path) - if err != nil { - return fmt.Errorf("get subpath mount id: %w", err) - } - // As long as the directory mount is alive, even with wrapping mount IDs, - // we would expect to see a different mount ID here. (Of course, if we're - // using unsafeHostProcRoot() then an attaker could change this after we - // did this check.) - if expectedMountID != gotMountID { - return fmt.Errorf("%w: subpath %s/%s has an overmount obscuring the real path (mount ids do not match %d != %d)", - errUnsafeProcfs, dir.Name(), path, expectedMountID, gotMountID) - } - return nil -} - -// Readlink performs a readlink operation on "/proc//" in a way -// that should be free from race attacks. This is most commonly used to get the -// real path of a file by looking at "/proc/self/fd/$n", with the same safety -// protections as [Open] (as well as some additional checks against -// overmounts). -func (proc *Handle) Readlink(base procfsBase, subpath string) (string, error) { - link, closer, err := proc.open(base, subpath) - if closer != nil { - defer closer() - } - if err != nil { - return "", fmt.Errorf("get safe %s/%s handle: %w", base, subpath, err) - } - defer link.Close() //nolint:errcheck // close failures aren't critical here - - // Try to detect if there is a mount on top of the magic-link. This should - // be safe in general (a mount on top of the path afterwards would not - // affect the handle itself) and will definitely be safe if we are using - // privateProcRoot() (at least since Linux 5.12[1], when anonymous mount - // namespaces were completely isolated from external mounts including mount - // propagation events). - // - // [1]: Linux commit ee2e3f50629f ("mount: fix mounting of detached mounts - // onto targets that reside on shared mounts"). - if err := checkSubpathOvermount(proc.Inner, link, ""); err != nil { - return "", fmt.Errorf("check safety of %s/%s magiclink: %w", base, subpath, err) - } - - // readlinkat implies AT_EMPTY_PATH since Linux 2.6.39. See Linux commit - // 65cfc6722361 ("readlinkat(), fchownat() and fstatat() with empty - // relative pathnames"). - return fd.Readlinkat(link, "") -} - -// ProcSelfFdReadlink gets the real path of the given file by looking at -// readlink(/proc/thread-self/fd/$n). -// -// This is just a wrapper around [Handle.Readlink]. -func ProcSelfFdReadlink(fd fd.Fd) (string, error) { - procRoot, err := OpenProcRoot() // subset=pid - if err != nil { - return "", err - } - defer procRoot.Close() //nolint:errcheck // close failures aren't critical here - - fdPath := "fd/" + strconv.Itoa(int(fd.Fd())) - return procRoot.Readlink(ProcThreadSelf, fdPath) -} - -// CheckProcSelfFdPath returns whether the given file handle matches the -// expected path. (This is inherently racy.) -func CheckProcSelfFdPath(path string, file fd.Fd) error { - if err := fd.IsDeadInode(file); err != nil { - return err - } - actualPath, err := ProcSelfFdReadlink(file) - if err != nil { - return fmt.Errorf("get path of handle: %w", err) - } - if actualPath != path { - return fmt.Errorf("%w: handle path %q doesn't match expected path %q", internal.ErrPossibleBreakout, actualPath, path) - } - return nil -} - -// ReopenFd takes an existing file descriptor and "re-opens" it through -// /proc/thread-self/fd/. This allows for O_PATH file descriptors to be -// upgraded to regular file descriptors, as well as changing the open mode of a -// regular file descriptor. Some filesystems have unique handling of open(2) -// which make this incredibly useful (such as /dev/ptmx). -func ReopenFd(handle fd.Fd, flags int) (*os.File, error) { - procRoot, err := OpenProcRoot() // subset=pid - if err != nil { - return nil, err - } - defer procRoot.Close() //nolint:errcheck // close failures aren't critical here - - // We can't operate on /proc/thread-self/fd/$n directly when doing a - // re-open, so we need to open /proc/thread-self/fd and then open a single - // final component. - procFdDir, closer, err := procRoot.OpenThreadSelf("fd/") - if err != nil { - return nil, fmt.Errorf("get safe /proc/thread-self/fd handle: %w", err) - } - defer procFdDir.Close() //nolint:errcheck // close failures aren't critical here - defer closer() - - // Try to detect if there is a mount on top of the magic-link we are about - // to open. If we are using unsafeHostProcRoot(), this could change after - // we check it (and there's nothing we can do about that) but for - // privateProcRoot() this should be guaranteed to be safe (at least since - // Linux 5.12[1], when anonymous mount namespaces were completely isolated - // from external mounts including mount propagation events). - // - // [1]: Linux commit ee2e3f50629f ("mount: fix mounting of detached mounts - // onto targets that reside on shared mounts"). - fdStr := strconv.Itoa(int(handle.Fd())) - if err := checkSubpathOvermount(procRoot.Inner, procFdDir, fdStr); err != nil { - return nil, fmt.Errorf("check safety of /proc/thread-self/fd/%s magiclink: %w", fdStr, err) - } - - flags |= unix.O_CLOEXEC - // Rather than just wrapping fd.Openat, open-code it so we can copy - // handle.Name(). - reopenFd, err := unix.Openat(int(procFdDir.Fd()), fdStr, flags, 0) - if err != nil { - return nil, fmt.Errorf("reopen fd %d: %w", handle.Fd(), err) - } - return os.NewFile(uintptr(reopenFd), handle.Name()), nil -} - -// Test hooks used in the procfs tests to verify that the fallback logic works. -// See testing_mocks_linux_test.go and procfs_linux_test.go for more details. -var ( - hookForcePrivateProcRootOpenTree = hookDummyFile - hookForcePrivateProcRootOpenTreeAtRecursive = hookDummyFile - hookForceGetProcRootUnsafe = hookDummy - - hookForceProcSelfTask = hookDummy - hookForceProcSelf = hookDummy -) - -func hookDummy() bool { return false } -func hookDummyFile(_ io.Closer) bool { return false } diff --git a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/procfs/procfs_lookup_linux.go b/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/procfs/procfs_lookup_linux.go deleted file mode 100644 index 1ad1f18ee..000000000 --- a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/internal/procfs/procfs_lookup_linux.go +++ /dev/null @@ -1,222 +0,0 @@ -// SPDX-License-Identifier: MPL-2.0 - -//go:build linux - -// Copyright (C) 2024-2025 Aleksa Sarai -// Copyright (C) 2024-2025 SUSE LLC -// -// This Source Code Form is subject to the terms of the Mozilla Public -// License, v. 2.0. If a copy of the MPL was not distributed with this -// file, You can obtain one at https://mozilla.org/MPL/2.0/. - -// This code is adapted to be a minimal version of the libpathrs proc resolver -// . -// As we only need O_PATH|O_NOFOLLOW support, this is not too much to port. - -package procfs - -import ( - "fmt" - "os" - "path" - "path/filepath" - "strings" - - "golang.org/x/sys/unix" - - "github.com/cyphar/filepath-securejoin/internal/consts" - "github.com/cyphar/filepath-securejoin/pathrs-lite/internal" - "github.com/cyphar/filepath-securejoin/pathrs-lite/internal/fd" - "github.com/cyphar/filepath-securejoin/pathrs-lite/internal/gocompat" - "github.com/cyphar/filepath-securejoin/pathrs-lite/internal/linux" -) - -// procfsLookupInRoot is a stripped down version of completeLookupInRoot, -// entirely designed to support the very small set of features necessary to -// make procfs handling work. Unlike completeLookupInRoot, we always have -// O_PATH|O_NOFOLLOW behaviour for trailing symlinks. -// -// The main restrictions are: -// -// - ".." is not supported (as it requires either os.Root-style replays, -// which is more bug-prone; or procfs verification, which is not possible -// due to re-entrancy issues). -// - Absolute symlinks for the same reason (and all absolute symlinks in -// procfs are magic-links, which we want to skip anyway). -// - If statx is supported (checkSymlinkOvermount), any mount-point crossings -// (which is the main attack of concern against /proc). -// - Partial lookups are not supported, so the symlink stack is not needed. -// - Trailing slash special handling is not necessary in most cases (if we -// operating on procfs, it's usually with programmer-controlled strings -// that will then be re-opened), so we skip it since whatever re-opens it -// can deal with it. It's a creature comfort anyway. -// -// If the system supports openat2(), this is implemented using equivalent flags -// (RESOLVE_BENEATH | RESOLVE_NO_XDEV | RESOLVE_NO_MAGICLINKS). -func procfsLookupInRoot(procRoot fd.Fd, unsafePath string) (Handle *os.File, _ error) { - unsafePath = filepath.ToSlash(unsafePath) // noop - - // Make sure that an empty unsafe path still returns something sane, even - // with openat2 (which doesn't have AT_EMPTY_PATH semantics yet). - if unsafePath == "" { - unsafePath = "." - } - - // This is already checked by getProcRoot, but make sure here since the - // core security of this lookup is based on this assumption. - if err := verifyProcRoot(procRoot); err != nil { - return nil, err - } - - if linux.HasOpenat2() { - // We prefer being able to use RESOLVE_NO_XDEV if we can, to be - // absolutely sure we are operating on a clean /proc handle that - // doesn't have any cheeky overmounts that could trick us (including - // symlink mounts on top of /proc/thread-self). RESOLVE_BENEATH isn't - // strictly needed, but just use it since we have it. - // - // NOTE: /proc/self is technically a magic-link (the contents of the - // symlink are generated dynamically), but it doesn't use - // nd_jump_link() so RESOLVE_NO_MAGICLINKS allows it. - // - // TODO: It would be nice to have RESOLVE_NO_DOTDOT, purely for - // self-consistency with the backup O_PATH resolver. - handle, err := fd.Openat2(procRoot, unsafePath, &unix.OpenHow{ - Flags: unix.O_PATH | unix.O_NOFOLLOW | unix.O_CLOEXEC, - Resolve: unix.RESOLVE_BENEATH | unix.RESOLVE_NO_XDEV | unix.RESOLVE_NO_MAGICLINKS, - }) - if err != nil { - // TODO: Once we bump the minimum Go version to 1.20, we can use - // multiple %w verbs for this wrapping. For now we need to use a - // compatibility shim for older Go versions. - // err = fmt.Errorf("%w: %w", errUnsafeProcfs, err) - return nil, gocompat.WrapBaseError(err, errUnsafeProcfs) - } - return handle, nil - } - - // To mirror openat2(RESOLVE_BENEATH), we need to return an error if the - // path is absolute. - if path.IsAbs(unsafePath) { - return nil, fmt.Errorf("%w: cannot resolve absolute paths in procfs resolver", internal.ErrPossibleBreakout) - } - - currentDir, err := fd.Dup(procRoot) - if err != nil { - return nil, fmt.Errorf("clone root fd: %w", err) - } - defer func() { - // If a handle is not returned, close the internal handle. - if Handle == nil { - _ = currentDir.Close() - } - }() - - var ( - linksWalked int - currentPath string - remainingPath = unsafePath - ) - for remainingPath != "" { - // Get the next path component. - var part string - if i := strings.IndexByte(remainingPath, '/'); i == -1 { - part, remainingPath = remainingPath, "" - } else { - part, remainingPath = remainingPath[:i], remainingPath[i+1:] - } - if part == "" { - // no-op component, but treat it the same as "." - part = "." - } - if part == ".." { - // not permitted - return nil, fmt.Errorf("%w: cannot walk into '..' in procfs resolver", internal.ErrPossibleBreakout) - } - - // Apply the component lexically to the path we are building. - // currentPath does not contain any symlinks, and we are lexically - // dealing with a single component, so it's okay to do a filepath.Clean - // here. (Not to mention that ".." isn't allowed.) - nextPath := path.Join("/", currentPath, part) - // If we logically hit the root, just clone the root rather than - // opening the part and doing all of the other checks. - if nextPath == "/" { - // Jump to root. - rootClone, err := fd.Dup(procRoot) - if err != nil { - return nil, fmt.Errorf("clone root fd: %w", err) - } - _ = currentDir.Close() - currentDir = rootClone - currentPath = nextPath - continue - } - - // Try to open the next component. - nextDir, err := fd.Openat(currentDir, part, unix.O_PATH|unix.O_NOFOLLOW|unix.O_CLOEXEC, 0) - if err != nil { - return nil, err - } - - // Make sure we are still on procfs and haven't crossed mounts. - if err := verifyProcHandle(nextDir); err != nil { - _ = nextDir.Close() - return nil, fmt.Errorf("check %q component is on procfs: %w", part, err) - } - if err := checkSubpathOvermount(procRoot, nextDir, ""); err != nil { - _ = nextDir.Close() - return nil, fmt.Errorf("check %q component is not overmounted: %w", part, err) - } - - // We are emulating O_PATH|O_NOFOLLOW, so we only need to traverse into - // trailing symlinks if we are not the final component. Otherwise we - // can just return the currentDir. - if remainingPath != "" { - st, err := nextDir.Stat() - if err != nil { - _ = nextDir.Close() - return nil, fmt.Errorf("stat component %q: %w", part, err) - } - - if st.Mode()&os.ModeType == os.ModeSymlink { - // readlinkat implies AT_EMPTY_PATH since Linux 2.6.39. See - // Linux commit 65cfc6722361 ("readlinkat(), fchownat() and - // fstatat() with empty relative pathnames"). - linkDest, err := fd.Readlinkat(nextDir, "") - // We don't need the handle anymore. - _ = nextDir.Close() - if err != nil { - return nil, err - } - - linksWalked++ - if linksWalked > consts.MaxSymlinkLimit { - return nil, &os.PathError{Op: "securejoin.procfsLookupInRoot", Path: "/proc/" + unsafePath, Err: unix.ELOOP} - } - - // Update our logical remaining path. - remainingPath = linkDest + "/" + remainingPath - // Absolute symlinks are probably magiclinks, we reject them. - if path.IsAbs(linkDest) { - return nil, fmt.Errorf("%w: cannot jump to / in procfs resolver -- possible magiclink", internal.ErrPossibleBreakout) - } - continue - } - } - - // Walk into the next component. - _ = currentDir.Close() - currentDir = nextDir - currentPath = nextPath - } - - // One final sanity-check. - if err := verifyProcHandle(currentDir); err != nil { - return nil, fmt.Errorf("check final handle is on procfs: %w", err) - } - if err := checkSubpathOvermount(procRoot, currentDir, ""); err != nil { - return nil, fmt.Errorf("check final handle is not overmounted: %w", err) - } - return currentDir, nil -} diff --git a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/lookup_linux.go b/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/lookup_linux.go deleted file mode 100644 index f47504e66..000000000 --- a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/lookup_linux.go +++ /dev/null @@ -1,399 +0,0 @@ -// SPDX-License-Identifier: MPL-2.0 - -//go:build linux - -// Copyright (C) 2024-2025 Aleksa Sarai -// Copyright (C) 2024-2025 SUSE LLC -// -// This Source Code Form is subject to the terms of the Mozilla Public -// License, v. 2.0. If a copy of the MPL was not distributed with this -// file, You can obtain one at https://mozilla.org/MPL/2.0/. - -package pathrs - -import ( - "errors" - "fmt" - "os" - "path" - "path/filepath" - "strings" - - "golang.org/x/sys/unix" - - "github.com/cyphar/filepath-securejoin/internal/consts" - "github.com/cyphar/filepath-securejoin/pathrs-lite/internal/fd" - "github.com/cyphar/filepath-securejoin/pathrs-lite/internal/gocompat" - "github.com/cyphar/filepath-securejoin/pathrs-lite/internal/linux" - "github.com/cyphar/filepath-securejoin/pathrs-lite/internal/procfs" -) - -type symlinkStackEntry struct { - // (dir, remainingPath) is what we would've returned if the link didn't - // exist. This matches what openat2(RESOLVE_IN_ROOT) would return in - // this case. - dir *os.File - remainingPath string - // linkUnwalked is the remaining path components from the original - // Readlink which we have yet to walk. When this slice is empty, we - // drop the link from the stack. - linkUnwalked []string -} - -func (se symlinkStackEntry) String() string { - return fmt.Sprintf("<%s>/%s [->%s]", se.dir.Name(), se.remainingPath, strings.Join(se.linkUnwalked, "/")) -} - -func (se symlinkStackEntry) Close() { - _ = se.dir.Close() -} - -type symlinkStack []*symlinkStackEntry - -func (s *symlinkStack) IsEmpty() bool { - return s == nil || len(*s) == 0 -} - -func (s *symlinkStack) Close() { - if s != nil { - for _, link := range *s { - link.Close() - } - // TODO: Switch to clear once we switch to Go 1.21. - *s = nil - } -} - -var ( - errEmptyStack = errors.New("[internal] stack is empty") - errBrokenSymlinkStack = errors.New("[internal error] broken symlink stack") -) - -func (s *symlinkStack) popPart(part string) error { - if s == nil || s.IsEmpty() { - // If there is nothing in the symlink stack, then the part was from the - // real path provided by the user, and this is a no-op. - return errEmptyStack - } - if part == "." { - // "." components are no-ops -- we drop them when doing SwapLink. - return nil - } - - tailEntry := (*s)[len(*s)-1] - - // Double-check that we are popping the component we expect. - if len(tailEntry.linkUnwalked) == 0 { - return fmt.Errorf("%w: trying to pop component %q of empty stack entry %s", errBrokenSymlinkStack, part, tailEntry) - } - headPart := tailEntry.linkUnwalked[0] - if headPart != part { - return fmt.Errorf("%w: trying to pop component %q but the last stack entry is %s (%q)", errBrokenSymlinkStack, part, tailEntry, headPart) - } - - // Drop the component, but keep the entry around in case we are dealing - // with a "tail-chained" symlink. - tailEntry.linkUnwalked = tailEntry.linkUnwalked[1:] - return nil -} - -func (s *symlinkStack) PopPart(part string) error { - if err := s.popPart(part); err != nil { - if errors.Is(err, errEmptyStack) { - // Skip empty stacks. - err = nil - } - return err - } - - // Clean up any of the trailing stack entries that are empty. - for lastGood := len(*s) - 1; lastGood >= 0; lastGood-- { - entry := (*s)[lastGood] - if len(entry.linkUnwalked) > 0 { - break - } - entry.Close() - (*s) = (*s)[:lastGood] - } - return nil -} - -func (s *symlinkStack) push(dir *os.File, remainingPath, linkTarget string) error { - if s == nil { - return nil - } - // Split the link target and clean up any "" parts. - linkTargetParts := gocompat.SlicesDeleteFunc( - strings.Split(linkTarget, "/"), - func(part string) bool { return part == "" || part == "." }) - - // Copy the directory so the caller doesn't close our copy. - dirCopy, err := fd.Dup(dir) - if err != nil { - return err - } - - // Add to the stack. - *s = append(*s, &symlinkStackEntry{ - dir: dirCopy, - remainingPath: remainingPath, - linkUnwalked: linkTargetParts, - }) - return nil -} - -func (s *symlinkStack) SwapLink(linkPart string, dir *os.File, remainingPath, linkTarget string) error { - // If we are currently inside a symlink resolution, remove the symlink - // component from the last symlink entry, but don't remove the entry even - // if it's empty. If we are a "tail-chained" symlink (a trailing symlink we - // hit during a symlink resolution) we need to keep the old symlink until - // we finish the resolution. - if err := s.popPart(linkPart); err != nil { - if !errors.Is(err, errEmptyStack) { - return err - } - // Push the component regardless of whether the stack was empty. - } - return s.push(dir, remainingPath, linkTarget) -} - -func (s *symlinkStack) PopTopSymlink() (*os.File, string, bool) { - if s == nil || s.IsEmpty() { - return nil, "", false - } - tailEntry := (*s)[0] - *s = (*s)[1:] - return tailEntry.dir, tailEntry.remainingPath, true -} - -// partialLookupInRoot tries to lookup as much of the request path as possible -// within the provided root (a-la RESOLVE_IN_ROOT) and opens the final existing -// component of the requested path, returning a file handle to the final -// existing component and a string containing the remaining path components. -func partialLookupInRoot(root fd.Fd, unsafePath string) (*os.File, string, error) { - return lookupInRoot(root, unsafePath, true) -} - -func completeLookupInRoot(root fd.Fd, unsafePath string) (*os.File, error) { - handle, remainingPath, err := lookupInRoot(root, unsafePath, false) - if remainingPath != "" && err == nil { - // should never happen - err = fmt.Errorf("[bug] non-empty remaining path when doing a non-partial lookup: %q", remainingPath) - } - // lookupInRoot(partial=false) will always close the handle if an error is - // returned, so no need to double-check here. - return handle, err -} - -func lookupInRoot(root fd.Fd, unsafePath string, partial bool) (Handle *os.File, _ string, _ error) { - unsafePath = filepath.ToSlash(unsafePath) // noop - - // This is very similar to SecureJoin, except that we operate on the - // components using file descriptors. We then return the last component we - // managed open, along with the remaining path components not opened. - - // Try to use openat2 if possible. - if linux.HasOpenat2() { - return lookupOpenat2(root, unsafePath, partial) - } - - // Get the "actual" root path from /proc/self/fd. This is necessary if the - // root is some magic-link like /proc/$pid/root, in which case we want to - // make sure when we do procfs.CheckProcSelfFdPath that we are using the - // correct root path. - logicalRootPath, err := procfs.ProcSelfFdReadlink(root) - if err != nil { - return nil, "", fmt.Errorf("get real root path: %w", err) - } - - currentDir, err := fd.Dup(root) - if err != nil { - return nil, "", fmt.Errorf("clone root fd: %w", err) - } - defer func() { - // If a handle is not returned, close the internal handle. - if Handle == nil { - _ = currentDir.Close() - } - }() - - // symlinkStack is used to emulate how openat2(RESOLVE_IN_ROOT) treats - // dangling symlinks. If we hit a non-existent path while resolving a - // symlink, we need to return the (dir, remainingPath) that we had when we - // hit the symlink (treating the symlink as though it were a regular file). - // The set of (dir, remainingPath) sets is stored within the symlinkStack - // and we add and remove parts when we hit symlink and non-symlink - // components respectively. We need a stack because of recursive symlinks - // (symlinks that contain symlink components in their target). - // - // Note that the stack is ONLY used for book-keeping. All of the actual - // path walking logic is still based on currentPath/remainingPath and - // currentDir (as in SecureJoin). - var symStack *symlinkStack - if partial { - symStack = new(symlinkStack) - defer symStack.Close() - } - - var ( - linksWalked int - currentPath string - remainingPath = unsafePath - ) - for remainingPath != "" { - // Save the current remaining path so if the part is not real we can - // return the path including the component. - oldRemainingPath := remainingPath - - // Get the next path component. - var part string - if i := strings.IndexByte(remainingPath, '/'); i == -1 { - part, remainingPath = remainingPath, "" - } else { - part, remainingPath = remainingPath[:i], remainingPath[i+1:] - } - // If we hit an empty component, we need to treat it as though it is - // "." so that trailing "/" and "//" components on a non-directory - // correctly return the right error code. - if part == "" { - part = "." - } - - // Apply the component lexically to the path we are building. - // currentPath does not contain any symlinks, and we are lexically - // dealing with a single component, so it's okay to do a filepath.Clean - // here. - nextPath := path.Join("/", currentPath, part) - // If we logically hit the root, just clone the root rather than - // opening the part and doing all of the other checks. - if nextPath == "/" { - if err := symStack.PopPart(part); err != nil { - return nil, "", fmt.Errorf("walking into root with part %q failed: %w", part, err) - } - // Jump to root. - rootClone, err := fd.Dup(root) - if err != nil { - return nil, "", fmt.Errorf("clone root fd: %w", err) - } - _ = currentDir.Close() - currentDir = rootClone - currentPath = nextPath - continue - } - - // Try to open the next component. - nextDir, err := fd.Openat(currentDir, part, unix.O_PATH|unix.O_NOFOLLOW|unix.O_CLOEXEC, 0) - switch err { - case nil: - st, err := nextDir.Stat() - if err != nil { - _ = nextDir.Close() - return nil, "", fmt.Errorf("stat component %q: %w", part, err) - } - - switch st.Mode() & os.ModeType { //nolint:exhaustive // just a glorified if statement - case os.ModeSymlink: - // readlinkat implies AT_EMPTY_PATH since Linux 2.6.39. See - // Linux commit 65cfc6722361 ("readlinkat(), fchownat() and - // fstatat() with empty relative pathnames"). - linkDest, err := fd.Readlinkat(nextDir, "") - // We don't need the handle anymore. - _ = nextDir.Close() - if err != nil { - return nil, "", err - } - - linksWalked++ - if linksWalked > consts.MaxSymlinkLimit { - return nil, "", &os.PathError{Op: "securejoin.lookupInRoot", Path: logicalRootPath + "/" + unsafePath, Err: unix.ELOOP} - } - - // Swap out the symlink's component for the link entry itself. - if err := symStack.SwapLink(part, currentDir, oldRemainingPath, linkDest); err != nil { - return nil, "", fmt.Errorf("walking into symlink %q failed: push symlink: %w", part, err) - } - - // Update our logical remaining path. - remainingPath = linkDest + "/" + remainingPath - // Absolute symlinks reset any work we've already done. - if path.IsAbs(linkDest) { - // Jump to root. - rootClone, err := fd.Dup(root) - if err != nil { - return nil, "", fmt.Errorf("clone root fd: %w", err) - } - _ = currentDir.Close() - currentDir = rootClone - currentPath = "/" - } - - default: - // If we are dealing with a directory, simply walk into it. - _ = currentDir.Close() - currentDir = nextDir - currentPath = nextPath - - // The part was real, so drop it from the symlink stack. - if err := symStack.PopPart(part); err != nil { - return nil, "", fmt.Errorf("walking into directory %q failed: %w", part, err) - } - - // If we are operating on a .., make sure we haven't escaped. - // We only have to check for ".." here because walking down - // into a regular component component cannot cause you to - // escape. This mirrors the logic in RESOLVE_IN_ROOT, except we - // have to check every ".." rather than only checking after a - // rename or mount on the system. - if part == ".." { - // Make sure the root hasn't moved. - if err := procfs.CheckProcSelfFdPath(logicalRootPath, root); err != nil { - return nil, "", fmt.Errorf("root path moved during lookup: %w", err) - } - // Make sure the path is what we expect. - fullPath := logicalRootPath + nextPath - if err := procfs.CheckProcSelfFdPath(fullPath, currentDir); err != nil { - return nil, "", fmt.Errorf("walking into %q had unexpected result: %w", part, err) - } - } - } - - default: - if !partial { - return nil, "", err - } - // If there are any remaining components in the symlink stack, we - // are still within a symlink resolution and thus we hit a dangling - // symlink. So pretend that the first symlink in the stack we hit - // was an ENOENT (to match openat2). - if oldDir, remainingPath, ok := symStack.PopTopSymlink(); ok { - _ = currentDir.Close() - return oldDir, remainingPath, err - } - // We have hit a final component that doesn't exist, so we have our - // partial open result. Note that we have to use the OLD remaining - // path, since the lookup failed. - return currentDir, oldRemainingPath, err - } - } - - // If the unsafePath had a trailing slash, we need to make sure we try to - // do a relative "." open so that we will correctly return an error when - // the final component is a non-directory (to match openat2). In the - // context of openat2, a trailing slash and a trailing "/." are completely - // equivalent. - if strings.HasSuffix(unsafePath, "/") { - nextDir, err := fd.Openat(currentDir, ".", unix.O_PATH|unix.O_NOFOLLOW|unix.O_CLOEXEC, 0) - if err != nil { - if !partial { - _ = currentDir.Close() - currentDir = nil - } - return currentDir, "", err - } - _ = currentDir.Close() - currentDir = nextDir - } - - // All of the components existed! - return currentDir, "", nil -} diff --git a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/mkdir_linux.go b/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/mkdir_linux.go deleted file mode 100644 index f3c62b0da..000000000 --- a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/mkdir_linux.go +++ /dev/null @@ -1,246 +0,0 @@ -// SPDX-License-Identifier: MPL-2.0 - -//go:build linux - -// Copyright (C) 2024-2025 Aleksa Sarai -// Copyright (C) 2024-2025 SUSE LLC -// -// This Source Code Form is subject to the terms of the Mozilla Public -// License, v. 2.0. If a copy of the MPL was not distributed with this -// file, You can obtain one at https://mozilla.org/MPL/2.0/. - -package pathrs - -import ( - "errors" - "fmt" - "os" - "path/filepath" - "strings" - - "golang.org/x/sys/unix" - - "github.com/cyphar/filepath-securejoin/pathrs-lite/internal/fd" - "github.com/cyphar/filepath-securejoin/pathrs-lite/internal/gocompat" - "github.com/cyphar/filepath-securejoin/pathrs-lite/internal/linux" -) - -var errInvalidMode = errors.New("invalid permission mode") - -// modePermExt is like os.ModePerm except that it also includes the set[ug]id -// and sticky bits. -const modePermExt = os.ModePerm | os.ModeSetuid | os.ModeSetgid | os.ModeSticky - -//nolint:cyclop // this function needs to handle a lot of cases -func toUnixMode(mode os.FileMode) (uint32, error) { - sysMode := uint32(mode.Perm()) - if mode&os.ModeSetuid != 0 { - sysMode |= unix.S_ISUID - } - if mode&os.ModeSetgid != 0 { - sysMode |= unix.S_ISGID - } - if mode&os.ModeSticky != 0 { - sysMode |= unix.S_ISVTX - } - // We don't allow file type bits. - if mode&os.ModeType != 0 { - return 0, fmt.Errorf("%w %+.3o (%s): type bits not permitted", errInvalidMode, mode, mode) - } - // We don't allow other unknown modes. - if mode&^modePermExt != 0 || sysMode&unix.S_IFMT != 0 { - return 0, fmt.Errorf("%w %+.3o (%s): unknown mode bits", errInvalidMode, mode, mode) - } - return sysMode, nil -} - -// MkdirAllHandle is equivalent to [MkdirAll], except that it is safer to use -// in two respects: -// -// - The caller provides the root directory as an *[os.File] (preferably O_PATH) -// handle. This means that the caller can be sure which root directory is -// being used. Note that this can be emulated by using /proc/self/fd/... as -// the root path with [os.MkdirAll]. -// -// - Once all of the directories have been created, an *[os.File] O_PATH handle -// to the directory at unsafePath is returned to the caller. This is done in -// an effectively-race-free way (an attacker would only be able to swap the -// final directory component), which is not possible to emulate with -// [MkdirAll]. -// -// In addition, the returned handle is obtained far more efficiently than doing -// a brand new lookup of unsafePath (such as with [SecureJoin] or openat2) after -// doing [MkdirAll]. If you intend to open the directory after creating it, you -// should use MkdirAllHandle. -// -// [SecureJoin]: https://pkg.go.dev/github.com/cyphar/filepath-securejoin#SecureJoin -func MkdirAllHandle(root *os.File, unsafePath string, mode os.FileMode) (_ *os.File, Err error) { - unixMode, err := toUnixMode(mode) - if err != nil { - return nil, err - } - // On Linux, mkdirat(2) (and os.Mkdir) silently ignore the suid and sgid - // bits. We could also silently ignore them but since we have very few - // users it seems more prudent to return an error so users notice that - // these bits will not be set. - if unixMode&^0o1777 != 0 { - return nil, fmt.Errorf("%w for mkdir %+.3o: suid and sgid are ignored by mkdir", errInvalidMode, mode) - } - - // Try to open as much of the path as possible. - currentDir, remainingPath, err := partialLookupInRoot(root, unsafePath) - defer func() { - if Err != nil { - _ = currentDir.Close() - } - }() - if err != nil && !errors.Is(err, unix.ENOENT) { - return nil, fmt.Errorf("find existing subpath of %q: %w", unsafePath, err) - } - - // If there is an attacker deleting directories as we walk into them, - // detect this proactively. Note this is guaranteed to detect if the - // attacker deleted any part of the tree up to currentDir. - // - // Once we walk into a dead directory, partialLookupInRoot would not be - // able to walk further down the tree (directories must be empty before - // they are deleted), and if the attacker has removed the entire tree we - // can be sure that anything that was originally inside a dead directory - // must also be deleted and thus is a dead directory in its own right. - // - // This is mostly a quality-of-life check, because mkdir will simply fail - // later if the attacker deletes the tree after this check. - if err := fd.IsDeadInode(currentDir); err != nil { - return nil, fmt.Errorf("finding existing subpath of %q: %w", unsafePath, err) - } - - // Re-open the path to match the O_DIRECTORY reopen loop later (so that we - // always return a non-O_PATH handle). We also check that we actually got a - // directory. - if reopenDir, err := Reopen(currentDir, unix.O_DIRECTORY|unix.O_CLOEXEC); errors.Is(err, unix.ENOTDIR) { - return nil, fmt.Errorf("cannot create subdirectories in %q: %w", currentDir.Name(), unix.ENOTDIR) - } else if err != nil { - return nil, fmt.Errorf("re-opening handle to %q: %w", currentDir.Name(), err) - } else { //nolint:revive // indent-error-flow lint doesn't make sense here - _ = currentDir.Close() - currentDir = reopenDir - } - - remainingParts := strings.Split(remainingPath, string(filepath.Separator)) - if gocompat.SlicesContains(remainingParts, "..") { - // The path contained ".." components after the end of the "real" - // components. We could try to safely resolve ".." here but that would - // add a bunch of extra logic for something that it's not clear even - // needs to be supported. So just return an error. - // - // If we do filepath.Clean(remainingPath) then we end up with the - // problem that ".." can erase a trailing dangling symlink and produce - // a path that doesn't quite match what the user asked for. - return nil, fmt.Errorf("%w: yet-to-be-created path %q contains '..' components", unix.ENOENT, remainingPath) - } - - // Create the remaining components. - for _, part := range remainingParts { - switch part { - case "", ".": - // Skip over no-op paths. - continue - } - - // NOTE: mkdir(2) will not follow trailing symlinks, so we can safely - // create the final component without worrying about symlink-exchange - // attacks. - // - // If we get -EEXIST, it's possible that another program created the - // directory at the same time as us. In that case, just continue on as - // if we created it (if the created inode is not a directory, the - // following open call will fail). - if err := unix.Mkdirat(int(currentDir.Fd()), part, unixMode); err != nil && !errors.Is(err, unix.EEXIST) { - err = &os.PathError{Op: "mkdirat", Path: currentDir.Name() + "/" + part, Err: err} - // Make the error a bit nicer if the directory is dead. - if deadErr := fd.IsDeadInode(currentDir); deadErr != nil { - // TODO: Once we bump the minimum Go version to 1.20, we can use - // multiple %w verbs for this wrapping. For now we need to use a - // compatibility shim for older Go versions. - // err = fmt.Errorf("%w (%w)", err, deadErr) - err = gocompat.WrapBaseError(err, deadErr) - } - return nil, err - } - - // Get a handle to the next component. O_DIRECTORY means we don't need - // to use O_PATH. - var nextDir *os.File - if linux.HasOpenat2() { - nextDir, err = openat2(currentDir, part, &unix.OpenHow{ - Flags: unix.O_NOFOLLOW | unix.O_DIRECTORY | unix.O_CLOEXEC, - Resolve: unix.RESOLVE_BENEATH | unix.RESOLVE_NO_SYMLINKS | unix.RESOLVE_NO_XDEV, - }) - } else { - nextDir, err = fd.Openat(currentDir, part, unix.O_NOFOLLOW|unix.O_DIRECTORY|unix.O_CLOEXEC, 0) - } - if err != nil { - return nil, err - } - _ = currentDir.Close() - currentDir = nextDir - - // It's possible that the directory we just opened was swapped by an - // attacker. Unfortunately there isn't much we can do to protect - // against this, and MkdirAll's behaviour is that we will reuse - // existing directories anyway so the need to protect against this is - // incredibly limited (and arguably doesn't even deserve mention here). - // - // Ideally we might want to check that the owner and mode match what we - // would've created -- unfortunately, it is non-trivial to verify that - // the owner and mode of the created directory match. While plain Unix - // DAC rules seem simple enough to emulate, there are a bunch of other - // factors that can change the mode or owner of created directories - // (default POSIX ACLs, mount options like uid=1,gid=2,umask=0 on - // filesystems like vfat, etc etc). We used to try to verify this but - // it just lead to a series of spurious errors. - // - // We could also check that the directory is non-empty, but - // unfortunately some pseduofilesystems (like cgroupfs) create - // non-empty directories, which would result in different spurious - // errors. - } - return currentDir, nil -} - -// MkdirAll is a race-safe alternative to the [os.MkdirAll] function, -// where the new directory is guaranteed to be within the root directory (if an -// attacker can move directories from inside the root to outside the root, the -// created directory tree might be outside of the root but the key constraint -// is that at no point will we walk outside of the directory tree we are -// creating). -// -// Effectively, MkdirAll(root, unsafePath, mode) is equivalent to -// -// path, _ := securejoin.SecureJoin(root, unsafePath) -// err := os.MkdirAll(path, mode) -// -// But is much safer. The above implementation is unsafe because if an attacker -// can modify the filesystem tree between [SecureJoin] and [os.MkdirAll], it is -// possible for MkdirAll to resolve unsafe symlink components and create -// directories outside of the root. -// -// If you plan to open the directory after you have created it or want to use -// an open directory handle as the root, you should use [MkdirAllHandle] instead. -// This function is a wrapper around [MkdirAllHandle]. -// -// [SecureJoin]: https://pkg.go.dev/github.com/cyphar/filepath-securejoin#SecureJoin -func MkdirAll(root, unsafePath string, mode os.FileMode) error { - rootDir, err := os.OpenFile(root, unix.O_PATH|unix.O_DIRECTORY|unix.O_CLOEXEC, 0) - if err != nil { - return err - } - defer rootDir.Close() //nolint:errcheck // close failures aren't critical here - - f, err := MkdirAllHandle(rootDir, unsafePath, mode) - if err != nil { - return err - } - _ = f.Close() - return nil -} diff --git a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/open_linux.go b/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/open_linux.go deleted file mode 100644 index 7492d8cfa..000000000 --- a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/open_linux.go +++ /dev/null @@ -1,74 +0,0 @@ -// SPDX-License-Identifier: MPL-2.0 - -//go:build linux - -// Copyright (C) 2024-2025 Aleksa Sarai -// Copyright (C) 2024-2025 SUSE LLC -// -// This Source Code Form is subject to the terms of the Mozilla Public -// License, v. 2.0. If a copy of the MPL was not distributed with this -// file, You can obtain one at https://mozilla.org/MPL/2.0/. - -package pathrs - -import ( - "os" - - "golang.org/x/sys/unix" - - "github.com/cyphar/filepath-securejoin/pathrs-lite/internal/procfs" -) - -// OpenatInRoot is equivalent to [OpenInRoot], except that the root is provided -// using an *[os.File] handle, to ensure that the correct root directory is used. -func OpenatInRoot(root *os.File, unsafePath string) (*os.File, error) { - handle, err := completeLookupInRoot(root, unsafePath) - if err != nil { - return nil, &os.PathError{Op: "securejoin.OpenInRoot", Path: unsafePath, Err: err} - } - return handle, nil -} - -// OpenInRoot safely opens the provided unsafePath within the root. -// Effectively, OpenInRoot(root, unsafePath) is equivalent to -// -// path, _ := securejoin.SecureJoin(root, unsafePath) -// handle, err := os.OpenFile(path, unix.O_PATH|unix.O_CLOEXEC) -// -// But is much safer. The above implementation is unsafe because if an attacker -// can modify the filesystem tree between [SecureJoin] and [os.OpenFile], it is -// possible for the returned file to be outside of the root. -// -// Note that the returned handle is an O_PATH handle, meaning that only a very -// limited set of operations will work on the handle. This is done to avoid -// accidentally opening an untrusted file that could cause issues (such as a -// disconnected TTY that could cause a DoS, or some other issue). In order to -// use the returned handle, you can "upgrade" it to a proper handle using -// [Reopen]. -// -// [SecureJoin]: https://pkg.go.dev/github.com/cyphar/filepath-securejoin#SecureJoin -func OpenInRoot(root, unsafePath string) (*os.File, error) { - rootDir, err := os.OpenFile(root, unix.O_PATH|unix.O_DIRECTORY|unix.O_CLOEXEC, 0) - if err != nil { - return nil, err - } - defer rootDir.Close() //nolint:errcheck // close failures aren't critical here - return OpenatInRoot(rootDir, unsafePath) -} - -// Reopen takes an *[os.File] handle and re-opens it through /proc/self/fd. -// Reopen(file, flags) is effectively equivalent to -// -// fdPath := fmt.Sprintf("/proc/self/fd/%d", file.Fd()) -// os.OpenFile(fdPath, flags|unix.O_CLOEXEC) -// -// But with some extra hardenings to ensure that we are not tricked by a -// maliciously-configured /proc mount. While this attack scenario is not -// common, in container runtimes it is possible for higher-level runtimes to be -// tricked into configuring an unsafe /proc that can be used to attack file -// operations. See [CVE-2019-19921] for more details. -// -// [CVE-2019-19921]: https://github.com/advisories/GHSA-fh74-hm69-rqjw -func Reopen(handle *os.File, flags int) (*os.File, error) { - return procfs.ReopenFd(handle, flags) -} diff --git a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/openat2_linux.go b/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/openat2_linux.go deleted file mode 100644 index 937bc435f..000000000 --- a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/openat2_linux.go +++ /dev/null @@ -1,101 +0,0 @@ -// SPDX-License-Identifier: MPL-2.0 - -//go:build linux - -// Copyright (C) 2024-2025 Aleksa Sarai -// Copyright (C) 2024-2025 SUSE LLC -// -// This Source Code Form is subject to the terms of the Mozilla Public -// License, v. 2.0. If a copy of the MPL was not distributed with this -// file, You can obtain one at https://mozilla.org/MPL/2.0/. - -package pathrs - -import ( - "errors" - "fmt" - "os" - "path/filepath" - "strings" - - "golang.org/x/sys/unix" - - "github.com/cyphar/filepath-securejoin/pathrs-lite/internal/fd" - "github.com/cyphar/filepath-securejoin/pathrs-lite/procfs" -) - -func openat2(dir fd.Fd, path string, how *unix.OpenHow) (*os.File, error) { - file, err := fd.Openat2(dir, path, how) - if err != nil { - return nil, err - } - // If we are using RESOLVE_IN_ROOT, the name we generated may be wrong. - if how.Resolve&unix.RESOLVE_IN_ROOT == unix.RESOLVE_IN_ROOT { - if actualPath, err := procfs.ProcSelfFdReadlink(file); err == nil { - // TODO: Ideally we would not need to dup the fd, but you cannot - // easily just swap an *os.File with one from the same fd - // (the GC will close the old one, and you cannot clear the - // finaliser easily because it is associated with an internal - // field of *os.File not *os.File itself). - newFile, err := fd.DupWithName(file, actualPath) - if err != nil { - return nil, err - } - file = newFile - } - } - return file, nil -} - -func lookupOpenat2(root fd.Fd, unsafePath string, partial bool) (*os.File, string, error) { - if !partial { - file, err := openat2(root, unsafePath, &unix.OpenHow{ - Flags: unix.O_PATH | unix.O_CLOEXEC, - Resolve: unix.RESOLVE_IN_ROOT | unix.RESOLVE_NO_MAGICLINKS, - }) - return file, "", err - } - return partialLookupOpenat2(root, unsafePath) -} - -// partialLookupOpenat2 is an alternative implementation of -// partialLookupInRoot, using openat2(RESOLVE_IN_ROOT) to more safely get a -// handle to the deepest existing child of the requested path within the root. -func partialLookupOpenat2(root fd.Fd, unsafePath string) (*os.File, string, error) { - // TODO: Implement this as a git-bisect-like binary search. - - unsafePath = filepath.ToSlash(unsafePath) // noop - endIdx := len(unsafePath) - var lastError error - for endIdx > 0 { - subpath := unsafePath[:endIdx] - - handle, err := openat2(root, subpath, &unix.OpenHow{ - Flags: unix.O_PATH | unix.O_CLOEXEC, - Resolve: unix.RESOLVE_IN_ROOT | unix.RESOLVE_NO_MAGICLINKS, - }) - if err == nil { - // Jump over the slash if we have a non-"" remainingPath. - if endIdx < len(unsafePath) { - endIdx++ - } - // We found a subpath! - return handle, unsafePath[endIdx:], lastError - } - if errors.Is(err, unix.ENOENT) || errors.Is(err, unix.ENOTDIR) { - // That path doesn't exist, let's try the next directory up. - endIdx = strings.LastIndexByte(subpath, '/') - lastError = err - continue - } - return nil, "", fmt.Errorf("open subpath: %w", err) - } - // If we couldn't open anything, the whole subpath is missing. Return a - // copy of the root fd so that the caller doesn't close this one by - // accident. - rootClone, err := fd.Dup(root) - if err != nil { - return nil, "", err - } - return rootClone, unsafePath, lastError -} diff --git a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/procfs/procfs_linux.go b/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/procfs/procfs_linux.go deleted file mode 100644 index ec187a414..000000000 --- a/vendor/github.com/cyphar/filepath-securejoin/pathrs-lite/procfs/procfs_linux.go +++ /dev/null @@ -1,157 +0,0 @@ -// SPDX-License-Identifier: MPL-2.0 - -//go:build linux - -// Copyright (C) 2024-2025 Aleksa Sarai -// Copyright (C) 2024-2025 SUSE LLC -// -// This Source Code Form is subject to the terms of the Mozilla Public -// License, v. 2.0. If a copy of the MPL was not distributed with this -// file, You can obtain one at https://mozilla.org/MPL/2.0/. - -// Package procfs provides a safe API for operating on /proc on Linux. -package procfs - -import ( - "os" - - "github.com/cyphar/filepath-securejoin/pathrs-lite/internal/procfs" -) - -// This package mostly just wraps internal/procfs APIs. This is necessary -// because we are forced to export some things from internal/procfs in order to -// avoid some dependency cycle issues, but we don't want users to see or use -// them. - -// ProcThreadSelfCloser is a callback that needs to be called when you are done -// operating on an [os.File] fetched using [Handle.OpenThreadSelf]. -// -// [os.File]: https://pkg.go.dev/os#File -type ProcThreadSelfCloser = procfs.ProcThreadSelfCloser - -// Handle is a wrapper around an *os.File handle to "/proc", which can be used -// to do further procfs-related operations in a safe way. -type Handle struct { - inner *procfs.Handle -} - -// Close close the resources associated with this [Handle]. Note that if this -// [Handle] was created with [OpenProcRoot], on some kernels the underlying -// procfs handle is cached and so this Close operation may be a no-op. However, -// you should always call Close on [Handle]s once you are done with them. -func (proc *Handle) Close() error { return proc.inner.Close() } - -// OpenProcRoot tries to open a "safer" handle to "/proc" (i.e., one with the -// "subset=pid" mount option applied, available from Linux 5.8). Unless you -// plan to do many [Handle.OpenRoot] operations, users should prefer to use -// this over [OpenUnsafeProcRoot] which is far more dangerous to keep open. -// -// If a safe handle cannot be opened, OpenProcRoot will fall back to opening a -// regular "/proc" handle. -// -// Note that using [Handle.OpenRoot] will still work with handles returned by -// this function. If a subpath cannot be operated on with a safe "/proc" -// handle, then [OpenUnsafeProcRoot] will be called internally and a temporary -// unsafe handle will be used. -func OpenProcRoot() (*Handle, error) { - proc, err := procfs.OpenProcRoot() - if err != nil { - return nil, err - } - return &Handle{inner: proc}, nil -} - -// OpenUnsafeProcRoot opens a handle to "/proc" without any overmounts or -// masked paths. You must be extremely careful to make sure this handle is -// never leaked to a container and that you program cannot be tricked into -// writing to arbitrary paths within it. -// -// This is not necessary if you just wish to use [Handle.OpenRoot], as handles -// returned by [OpenProcRoot] will fall back to using a *temporary* unsafe -// handle in that case. You should only really use this if you need to do many -// operations with [Handle.OpenRoot] and the performance overhead of making -// many procfs handles is an issue. If you do use OpenUnsafeProcRoot, you -// should make sure to close the handle as soon as possible to avoid -// known-fd-number attacks. -func OpenUnsafeProcRoot() (*Handle, error) { - proc, err := procfs.OpenUnsafeProcRoot() - if err != nil { - return nil, err - } - return &Handle{inner: proc}, nil -} - -// OpenThreadSelf returns a handle to "/proc/thread-self/" (or an -// equivalent handle on older kernels where "/proc/thread-self" doesn't exist). -// Once finished with the handle, you must call the returned closer function -// ([runtime.UnlockOSThread]). You must not pass the returned *os.File to other -// Go threads or use the handle after calling the closer. -// -// [runtime.UnlockOSThread]: https://pkg.go.dev/runtime#UnlockOSThread -func (proc *Handle) OpenThreadSelf(subpath string) (*os.File, ProcThreadSelfCloser, error) { - return proc.inner.OpenThreadSelf(subpath) -} - -// OpenSelf returns a handle to /proc/self/. -// -// Note that in Go programs with non-homogenous threads, this may result in -// spurious errors. If you are monkeying around with APIs that are -// thread-specific, you probably want to use [Handle.OpenThreadSelf] instead -// which will guarantee that the handle refers to the same thread as the caller -// is executing on. -func (proc *Handle) OpenSelf(subpath string) (*os.File, error) { - return proc.inner.OpenSelf(subpath) -} - -// OpenRoot returns a handle to /proc/. -// -// You should only use this when you need to operate on global procfs files -// (such as sysctls in /proc/sys). Unlike [Handle.OpenThreadSelf], -// [Handle.OpenSelf], and [Handle.OpenPid], the procfs handle used internally -// for this operation will never use "subset=pid", which makes it a more juicy -// target for [CVE-2024-21626]-style attacks (and doing something like opening -// a directory with OpenRoot effectively leaks [OpenUnsafeProcRoot] as long as -// the file descriptor is open). -// -// [CVE-2024-21626]: https://github.com/opencontainers/runc/security/advisories/GHSA-xr7r-f8xq-vfvv -func (proc *Handle) OpenRoot(subpath string) (*os.File, error) { - return proc.inner.OpenRoot(subpath) -} - -// OpenPid returns a handle to /proc/$pid/ (pid can be a pid or tid). -// This is mainly intended for usage when operating on other processes. -// -// You should not use this for the current thread, as special handling is -// needed for /proc/thread-self (or /proc/self/task/) when dealing with -// goroutine scheduling -- use [Handle.OpenThreadSelf] instead. -// -// To refer to the current thread-group, you should use prefer -// [Handle.OpenSelf] to passing os.Getpid as the pid argument. -func (proc *Handle) OpenPid(pid int, subpath string) (*os.File, error) { - return proc.inner.OpenPid(pid, subpath) -} - -// ProcSelfFdReadlink gets the real path of the given file by looking at -// /proc/self/fd/ with [readlink]. It is effectively just shorthand for -// something along the lines of: -// -// proc, err := procfs.OpenProcRoot() -// if err != nil { -// return err -// } -// link, err := proc.OpenThreadSelf(fmt.Sprintf("fd/%d", f.Fd())) -// if err != nil { -// return err -// } -// defer link.Close() -// var buf [4096]byte -// n, err := unix.Readlinkat(int(link.Fd()), "", buf[:]) -// if err != nil { -// return err -// } -// pathname := buf[:n] -// -// [readlink]: https://pkg.go.dev/golang.org/x/sys/unix#Readlinkat -func ProcSelfFdReadlink(f *os.File) (string, error) { - return procfs.ProcSelfFdReadlink(f) -} diff --git a/vendor/github.com/go-git/go-billy/v5/README.md b/vendor/github.com/go-git/go-billy/v5/README.md index da5c07478..f260f7944 100644 --- a/vendor/github.com/go-git/go-billy/v5/README.md +++ b/vendor/github.com/go-git/go-billy/v5/README.md @@ -5,6 +5,10 @@ Billy implements an interface based on the `os` standard library, allowing to de Billy was born as part of [go-git/go-git](https://github.com/go-git/go-git) project. +## Version support + +go-billy v5 is in maintenance mode. Users should upgrade to [go-billy v6](https://pkg.go.dev/github.com/go-git/go-billy/v6) where possible. + ## Installation ```go diff --git a/vendor/github.com/go-git/go-billy/v5/helper/chroot/chroot.go b/vendor/github.com/go-git/go-billy/v5/helper/chroot/chroot.go index dbdf11186..299d16537 100644 --- a/vendor/github.com/go-git/go-billy/v5/helper/chroot/chroot.go +++ b/vendor/github.com/go-git/go-billy/v5/helper/chroot/chroot.go @@ -3,19 +3,25 @@ package chroot import ( "errors" "os" + "path" "path/filepath" "strings" + "syscall" "github.com/go-git/go-billy/v5" "github.com/go-git/go-billy/v5/helper/polyfill" ) // ChrootHelper is a helper to implement billy.Chroot. +// It is not a security boundary, callers that need containment should use a +// filesystem implementation that enforces paths at the OS boundary instead. type ChrootHelper struct { underlying billy.Filesystem base string } +const maxFollowedSymlinks = 8 // Aligns with POSIX_SYMLOOP_MAX + // New creates a new filesystem wrapping up the given 'fs'. // The created filesystem has its base in the given ChrootHelperectory of the // underlying filesystem. @@ -34,15 +40,184 @@ func (fs *ChrootHelper) underlyingPath(filename string) (string, error) { return fs.Join(fs.Root(), filename), nil } -func isCrossBoundaries(path string) bool { - path = filepath.ToSlash(path) - path = filepath.Clean(path) +func (fs *ChrootHelper) followedPath(filename string, followFinal bool, op string) (string, error) { + fullpath, err := fs.underlyingPath(filename) + if err != nil { + return "", err + } - return strings.HasPrefix(path, ".."+string(filepath.Separator)) + sl, ok := fs.underlying.(billy.Symlink) + if !ok { + return fullpath, nil + } + + rel, err := fs.relativeToRoot(fullpath) + if err != nil { + return "", err + } + + fullpath, err = fs.resolveFollowedPath(rel, followFinal, op, sl) + if errors.Is(err, billy.ErrNotSupported) { + return fs.underlyingPath(filename) + } + + return fullpath, err +} + +func (fs *ChrootHelper) resolveFollowedPath(rel string, followFinal bool, op string, sl billy.Symlink) (string, error) { + if rel == "" { + return fs.resolveFollowedRoot(followFinal, op, sl) + } + + parts := splitRelativePath(rel) + resolved := "" + followed := 0 + + for len(parts) > 0 { + part := parts[0] + parts = parts[1:] + + currentRel := joinRelativePath(resolved, part) + currentPath := fs.Join(fs.Root(), currentRel) + if len(parts) == 0 && !followFinal { + return currentPath, nil + } + + fi, err := sl.Lstat(currentPath) + if err != nil { + if os.IsNotExist(err) { + return fs.Join(fs.Root(), joinRelativePath(append([]string{currentRel}, parts...)...)), nil + } + return "", err + } + + if fi.Mode()&os.ModeSymlink == 0 { + resolved = currentRel + continue + } + + followed++ + if followed > maxFollowedSymlinks { + return "", symlinkLoopError(op, currentPath) + } + + target, err := sl.Readlink(currentPath) + if err != nil { + return "", err + } + + targetRel, err := fs.linkTargetRel(currentPath, target) + if err != nil { + return "", err + } + if targetRel == currentRel { + return "", symlinkLoopError(op, currentPath) + } + + parts = append(splitRelativePath(targetRel), parts...) + resolved = "" + } + + return fs.Join(fs.Root(), resolved), nil +} + +func symlinkLoopError(op, path string) error { + return &os.PathError{Op: op, Path: path, Err: syscall.ELOOP} +} + +func (fs *ChrootHelper) resolveFollowedRoot(followFinal bool, op string, sl billy.Symlink) (string, error) { + root := fs.Join(fs.Root(), "") + if !followFinal { + return root, nil + } + + fi, err := sl.Lstat(root) + if err != nil { + if os.IsNotExist(err) { + return root, nil + } + return "", err + } + + if fi.Mode()&os.ModeSymlink == 0 { + return root, nil + } + + target, err := sl.Readlink(root) + if err != nil { + return "", err + } + + targetRel, err := fs.linkTargetRel(root, target) + if err != nil { + return root, err + } + if targetRel == "" { + return "", symlinkLoopError(op, root) + } + + return fs.resolveFollowedPath(targetRel, followFinal, op, sl) +} + +func (fs *ChrootHelper) relativeToRoot(filename string) (string, error) { + rel, err := filepath.Rel(filepath.Clean(fs.Root()), filepath.Clean(filename)) + if err != nil || isCrossBoundaries(rel) { + return "", billy.ErrCrossedBoundary + } + + if rel == "." { + return "", nil + } + return rel, nil +} + +func (fs *ChrootHelper) linkTargetRel(linkPath, target string) (string, error) { + target = filepath.FromSlash(target) + if filepath.IsAbs(target) || strings.HasPrefix(target, string(filepath.Separator)) { + return fs.relativeToRoot(target) + } + + return fs.relativeToRoot(fs.Join(filepath.Dir(linkPath), target)) +} + +func splitRelativePath(filename string) []string { + filename = filepath.Clean(filename) + if filename == "" || filename == "." { + return nil + } + + return strings.Split(filepath.ToSlash(filename), "/") +} + +func joinRelativePath(elem ...string) string { + parts := make([]string, 0, len(elem)) + for _, part := range elem { + if part == "" || part == "." { + continue + } + parts = append(parts, part) + } + + if len(parts) == 0 { + return "" + } + return filepath.Join(parts...) +} + +func isCreateExclusive(flag int) bool { + return flag&os.O_CREATE != 0 && flag&os.O_EXCL != 0 +} + +func isCrossBoundaries(name string) bool { + name = filepath.ToSlash(name) + name = strings.TrimLeft(name, "/") + name = path.Clean(name) + + return name == ".." || strings.HasPrefix(name, "../") } func (fs *ChrootHelper) Create(filename string) (billy.File, error) { - fullpath, err := fs.underlyingPath(filename) + fullpath, err := fs.followedPath(filename, true, "create") if err != nil { return nil, err } @@ -56,7 +231,7 @@ func (fs *ChrootHelper) Create(filename string) (billy.File, error) { } func (fs *ChrootHelper) Open(filename string) (billy.File, error) { - fullpath, err := fs.underlyingPath(filename) + fullpath, err := fs.followedPath(filename, true, "open") if err != nil { return nil, err } @@ -70,7 +245,7 @@ func (fs *ChrootHelper) Open(filename string) (billy.File, error) { } func (fs *ChrootHelper) OpenFile(filename string, flag int, mode os.FileMode) (billy.File, error) { - fullpath, err := fs.underlyingPath(filename) + fullpath, err := fs.followedPath(filename, !isCreateExclusive(flag), "open") if err != nil { return nil, err } @@ -84,12 +259,16 @@ func (fs *ChrootHelper) OpenFile(filename string, flag int, mode os.FileMode) (b } func (fs *ChrootHelper) Stat(filename string) (os.FileInfo, error) { - fullpath, err := fs.underlyingPath(filename) + fullpath, err := fs.followedPath(filename, true, "stat") if err != nil { return nil, err } - return fs.underlying.Stat(fullpath) + fi, err := fs.underlying.Stat(fullpath) + if err != nil { + return nil, err + } + return fileInfo{FileInfo: fi, name: filepath.Base(filename)}, nil } func (fs *ChrootHelper) Rename(from, to string) error { @@ -135,7 +314,7 @@ func (fs *ChrootHelper) TempFile(dir, prefix string) (billy.File, error) { } func (fs *ChrootHelper) ReadDir(path string) ([]os.FileInfo, error) { - fullpath, err := fs.underlyingPath(path) + fullpath, err := fs.followedPath(path, true, "readdir") if err != nil { return nil, err } @@ -241,6 +420,11 @@ type file struct { name string } +type fileInfo struct { + os.FileInfo + name string +} + func newFile(fs billy.Filesystem, f billy.File, filename string) billy.File { filename = fs.Join(fs.Root(), filename) filename, _ = filepath.Rel(fs.Root(), filename) @@ -254,3 +438,7 @@ func newFile(fs billy.Filesystem, f billy.File, filename string) billy.File { func (f *file) Name() string { return f.name } + +func (fi fileInfo) Name() string { + return fi.name +} diff --git a/vendor/github.com/go-git/go-billy/v5/osfs/os.go b/vendor/github.com/go-git/go-billy/v5/osfs/os.go index a7fe79f2f..0c240ef31 100644 --- a/vendor/github.com/go-git/go-billy/v5/osfs/os.go +++ b/vendor/github.com/go-git/go-billy/v5/osfs/os.go @@ -24,6 +24,9 @@ var Default = &ChrootOS{} // New returns a new OS filesystem. // By default paths are deduplicated, but still enforced // under baseDir. For more info refer to WithDeduplicatePath. +// +// New returns ChrootOS by default for v5 compatibility. Users should prefer +// New with WithBoundOS. func New(baseDir string, opts ...Option) billy.Filesystem { o := &options{ deduplicatePath: true, @@ -47,6 +50,8 @@ func WithBoundOS() Option { } // WithChrootOS returns the option of using a Chroot filesystem OS. +// +// Deprecated: use WithBoundOS instead. func WithChrootOS() Option { return func(o *options) { o.Type = ChrootOSFS diff --git a/vendor/github.com/go-git/go-billy/v5/osfs/os_bound.go b/vendor/github.com/go-git/go-billy/v5/osfs/os_bound.go index 92ebc3dc7..70e6a7232 100644 --- a/vendor/github.com/go-git/go-billy/v5/osfs/os_bound.go +++ b/vendor/github.com/go-git/go-billy/v5/osfs/os_bound.go @@ -20,6 +20,7 @@ package osfs import ( + "errors" "fmt" "os" "path/filepath" @@ -29,6 +30,31 @@ import ( "github.com/go-git/go-billy/v5" ) +var ( + // ErrBaseDirCannotBeRemoved is returned when removing the BoundOS base dir. + ErrBaseDirCannotBeRemoved = errors.New("base dir cannot be removed") + + // ErrBaseDirCannotBeRenamed is returned when renaming the BoundOS base dir. + ErrBaseDirCannotBeRenamed = errors.New("base dir cannot be renamed") + + dotPrefixes = dotPathPrefixes() + dotSeparators = dotPathSeparators() +) + +func dotPathPrefixes() []string { + if filepath.Separator == '\\' { + return []string{"./", ".\\"} + } + return []string{"./"} +} + +func dotPathSeparators() string { + if filepath.Separator == '\\' { + return `/\` + } + return `/` +} + // BoundOS is a fs implementation based on the OS filesystem which is bound to // a base dir. // Prefer this fs implementation over ChrootOS. @@ -54,6 +80,7 @@ func (fs *BoundOS) Create(filename string) (billy.File, error) { } func (fs *BoundOS) OpenFile(filename string, flag int, perm os.FileMode) (billy.File, error) { + filename = fs.expandDot(filename) fn, err := fs.abs(filename) if err != nil { return nil, err @@ -62,6 +89,7 @@ func (fs *BoundOS) OpenFile(filename string, flag int, perm os.FileMode) (billy. } func (fs *BoundOS) ReadDir(path string) ([]os.FileInfo, error) { + path = fs.expandDot(path) dir, err := fs.abs(path) if err != nil { return nil, err @@ -71,6 +99,12 @@ func (fs *BoundOS) ReadDir(path string) ([]os.FileInfo, error) { } func (fs *BoundOS) Rename(from, to string) error { + if fs.isBaseDir(from) { + return ErrBaseDirCannotBeRenamed + } + from = fs.expandDot(from) + to = fs.expandDot(to) + f, err := fs.abs(from) if err != nil { return err @@ -89,6 +123,7 @@ func (fs *BoundOS) Rename(from, to string) error { } func (fs *BoundOS) MkdirAll(path string, perm os.FileMode) error { + path = fs.expandDot(path) dir, err := fs.abs(path) if err != nil { return err @@ -101,6 +136,7 @@ func (fs *BoundOS) Open(filename string) (billy.File, error) { } func (fs *BoundOS) Stat(filename string) (os.FileInfo, error) { + filename = fs.expandDot(filename) filename, err := fs.abs(filename) if err != nil { return nil, err @@ -109,6 +145,11 @@ func (fs *BoundOS) Stat(filename string) (os.FileInfo, error) { } func (fs *BoundOS) Remove(filename string) error { + if fs.isBaseDir(filename) { + return ErrBaseDirCannotBeRemoved + } + filename = fs.expandDot(filename) + fn, err := fs.abs(filename) if err != nil { return err @@ -122,6 +163,7 @@ func (fs *BoundOS) Remove(filename string) error { func (fs *BoundOS) TempFile(dir, prefix string) (billy.File, error) { if dir != "" { var err error + dir = fs.expandDot(dir) dir, err = fs.abs(dir) if err != nil { return nil, err @@ -144,6 +186,11 @@ func (fs *BoundOS) Join(elem ...string) string { } func (fs *BoundOS) RemoveAll(path string) error { + if fs.isBaseDir(path) { + return ErrBaseDirCannotBeRemoved + } + path = fs.expandDot(path) + dir, err := fs.abs(path) if err != nil { return err @@ -152,6 +199,7 @@ func (fs *BoundOS) RemoveAll(path string) error { } func (fs *BoundOS) Symlink(target, link string) error { + link = fs.expandDot(link) ln, err := fs.abs(link) if err != nil { return err @@ -164,6 +212,7 @@ func (fs *BoundOS) Symlink(target, link string) error { } func (fs *BoundOS) Lstat(filename string) (os.FileInfo, error) { + filename = fs.expandDot(filename) filename = filepath.Clean(filename) if !filepath.IsAbs(filename) { filename = filepath.Join(fs.baseDir, filename) @@ -175,6 +224,7 @@ func (fs *BoundOS) Lstat(filename string) (os.FileInfo, error) { } func (fs *BoundOS) Readlink(link string) (string, error) { + link = fs.expandDot(link) if !filepath.IsAbs(link) { link = filepath.Clean(filepath.Join(fs.baseDir, link)) } @@ -185,6 +235,7 @@ func (fs *BoundOS) Readlink(link string) (string, error) { } func (fs *BoundOS) Chmod(path string, mode os.FileMode) error { + path = fs.expandDot(path) abspath, err := fs.abs(path) if err != nil { return err @@ -199,7 +250,7 @@ func (fs *BoundOS) Chroot(path string) (billy.Filesystem, error) { if err != nil { return nil, err } - return New(joined), nil + return New(joined, WithBoundOS()), nil } // Root returns the current base dir of the billy.Filesystem. @@ -220,6 +271,37 @@ func (fs *BoundOS) createDir(fullpath string) error { return nil } +func (fs *BoundOS) expandDot(path string) string { + if path == "." { + return fs.baseDir + } + for _, prefix := range dotPrefixes { + if strings.HasPrefix(path, prefix) { + path = strings.TrimLeft(strings.TrimPrefix(path, prefix), dotSeparators) + if path == "" { + return fs.baseDir + } + return path + } + } + return path +} + +func (fs *BoundOS) isBaseDir(path string) bool { + if path == "" || filepath.Clean(path) == "." { + return true + } + path = fs.expandDot(path) + if filepath.Clean(path) == filepath.Clean(fs.baseDir) { + return true + } + abspath, err := fs.abs(path) + if err != nil { + return false + } + return filepath.Clean(abspath) == filepath.Clean(fs.baseDir) +} + // abs transforms filename to an absolute path, taking into account the base dir. // Relative paths won't be allowed to ascend the base dir, so `../file` will become // `/working-dir/file`. @@ -233,7 +315,7 @@ func (fs *BoundOS) abs(filename string) (string, error) { path, err := securejoin.SecureJoin(fs.baseDir, filename) if err != nil { - return "", nil + return "", err } if fs.deduplicatePath { @@ -246,24 +328,12 @@ func (fs *BoundOS) abs(filename string) (string, error) { return path, nil } -// insideBaseDir checks whether filename is located within -// the fs.baseDir. -func (fs *BoundOS) insideBaseDir(filename string) (bool, error) { - if filename == fs.baseDir { - return true, nil - } - if !strings.HasPrefix(filename, fs.baseDir+string(filepath.Separator)) { - return false, fmt.Errorf("path outside base dir") - } - return true, nil -} - // insideBaseDirEval checks whether filename is contained within // a dir that is within the fs.baseDir, by first evaluating any symlinks // that either filename or fs.baseDir may contain. func (fs *BoundOS) insideBaseDirEval(filename string) (bool, error) { // "/" contains all others. - if fs.baseDir == "/" { + if fs.baseDir == "/" || fs.baseDir == filename { return true, nil } dir, err := filepath.EvalSymlinks(filepath.Dir(filename)) diff --git a/vendor/github.com/go-git/go-billy/v5/osfs/os_chroot.go b/vendor/github.com/go-git/go-billy/v5/osfs/os_chroot.go index 413b3b898..2fa9d8b53 100644 --- a/vendor/github.com/go-git/go-billy/v5/osfs/os_chroot.go +++ b/vendor/github.com/go-git/go-billy/v5/osfs/os_chroot.go @@ -14,6 +14,8 @@ import ( // ChrootOS is a legacy filesystem based on a "soft chroot" of the os filesystem. // Although this is still the default os filesystem, consider using BoundOS instead. // +// Deprecated: use New with WithBoundOS instead. +// // Behaviours of note: // 1. A "soft chroot" translates the base dir to "/" for the purposes of the // fs abstraction. @@ -24,6 +26,14 @@ import ( type ChrootOS struct{} func newChrootOS(baseDir string) billy.Filesystem { + if baseDir != "" { + resolved, err := filepath.EvalSymlinks(baseDir) + if err != nil { + return chroot.New(&ChrootOS{}, baseDir) + } + baseDir = resolved + } + return chroot.New(&ChrootOS{}, baseDir) } diff --git a/vendor/github.com/go-git/go-billy/v5/util/util.go b/vendor/github.com/go-git/go-billy/v5/util/util.go index 2cdd832c7..cd869d6e4 100644 --- a/vendor/github.com/go-git/go-billy/v5/util/util.go +++ b/vendor/github.com/go-git/go-billy/v5/util/util.go @@ -16,8 +16,6 @@ import ( // can but returns the first error it encounters. If the path does not exist, // RemoveAll returns nil (no error). func RemoveAll(fs billy.Basic, path string) error { - fs, path = getUnderlyingAndPath(fs, path) - if r, ok := fs.(removerAll); ok { return r.RemoveAll(path) } @@ -39,7 +37,7 @@ func removeAll(fs billy.Basic, path string) error { } // Otherwise, is this a directory we need to recurse into? - dir, serr := fs.Stat(path) + dir, serr := lstat(fs, path) if serr != nil { if errors.Is(serr, os.ErrNotExist) { return nil @@ -48,8 +46,8 @@ func removeAll(fs billy.Basic, path string) error { return serr } - if !dir.IsDir() { - // Not a directory; return the error from Remove. + if dir.Mode()&os.ModeSymlink != 0 || !dir.IsDir() { + // Not a directory we should recurse into; return the error from Remove. return err } @@ -62,7 +60,7 @@ func removeAll(fs billy.Basic, path string) error { fis, err := dirfs.ReadDir(path) if err != nil { if errors.Is(err, os.ErrNotExist) { - // Race. It was deleted between the Lstat and Open. + // Race. It was deleted between the Lstat and ReadDir. // Return nil per RemoveAll's docs. return nil } @@ -91,7 +89,18 @@ func removeAll(fs billy.Basic, path string) error { } return err +} +func lstat(filesystem billy.Basic, path string) (os.FileInfo, error) { + if sl, ok := filesystem.(billy.Symlink); ok { + // Avoid following a symlink substituted after the initial Remove fails. + fi, err := sl.Lstat(path) + if err == nil || !errors.Is(err, billy.ErrNotSupported) { + return fi, err + } + } + + return filesystem.Stat(path) } // WriteFile writes data to a file named by filename in the given filesystem. @@ -123,8 +132,10 @@ func WriteFile(fs billy.Basic, filename string, data []byte, perm os.FileMode) ( // We generate random temporary file names so that there's a good // chance the file doesn't exist yet - keeps the number of tries in // TempFile to a minimum. -var rand uint32 -var randmu sync.Mutex +var ( + rand uint32 + randmu sync.Mutex +) func reseed() uint32 { return uint32(time.Now().UnixNano() + int64(os.Getpid())) @@ -220,22 +231,6 @@ func getTempDir(fs billy.Basic) string { return ".tmp" } -type underlying interface { - Underlying() billy.Basic -} - -func getUnderlyingAndPath(fs billy.Basic, path string) (billy.Basic, string) { - u, ok := fs.(underlying) - if !ok { - return fs, path - } - if ch, ok := fs.(billy.Chroot); ok { - path = fs.Join(ch.Root(), path) - } - - return u.Underlying(), path -} - // ReadFile reads the named file and returns the contents from the given filesystem. // A successful call returns err == nil, not err == EOF. // Because ReadFile reads the whole file, it does not treat an EOF from Read diff --git a/vendor/github.com/go-git/go-git/v5/plumbing/object/commit.go b/vendor/github.com/go-git/go-git/v5/plumbing/object/commit.go index 78627b065..07034c10c 100644 --- a/vendor/github.com/go-git/go-git/v5/plumbing/object/commit.go +++ b/vendor/github.com/go-git/go-git/v5/plumbing/object/commit.go @@ -5,7 +5,7 @@ import ( "context" "errors" "fmt" - "io" + "slices" "strings" "github.com/ProtonMail/go-crypto/openpgp" @@ -20,6 +20,7 @@ const ( beginpgp string = "-----BEGIN PGP SIGNATURE-----" endpgp string = "-----END PGP SIGNATURE-----" headerpgp string = "gpgsig" + headerpgp256 string = "gpgsig-sha256" headerencoding string = "encoding" // https://github.com/git/git/blob/bcb6cae2966cc407ca1afc77413b3ef11103c175/Documentation/gitformat-signature.txt#L153 @@ -41,6 +42,11 @@ type MessageEncoding string // in time, such as a timestamp, the author of the changes since the last // commit, a pointer to the previous commit(s), etc. // http://shafiulazam.com/gitbook/1_the_git_object_model.html +// +// When a Commit is populated by Decode it retains a reference to the source +// plumbing.EncodedObject so that EncodeWithoutSignature can reproduce the +// exact bytes the signature was computed over. Refer to EncodeWithoutSignature +// for more information. type Commit struct { // Hash of the commit object. Hash plumbing.Hash @@ -66,6 +72,9 @@ type Commit struct { ExtraHeaders []ExtraHeader s storer.EncodedObjectStorer + // src holds the encoded object this Commit was decoded from, used by + // EncodeWithoutSignature to recover the canonical signed bytes. + src plumbing.EncodedObject } // ExtraHeader holds any non-standard header @@ -98,8 +107,8 @@ func (h ExtraHeader) Format(f fmt.State, verb rune) { func parseExtraHeader(line []byte) (ExtraHeader, bool) { split := bytes.SplitN(line, []byte{' '}, 2) - out := ExtraHeader { - Key: string(bytes.TrimRight(split[0], "\n")), + out := ExtraHeader{ + Key: string(bytes.TrimRight(split[0], "\n")), Value: "", } @@ -181,6 +190,11 @@ func (c *Commit) NumParents() int { var ErrParentNotFound = errors.New("commit parent not found") +// ErrMalformedCommit is returned when a commit object cannot be decoded +// because its standard headers (tree, parent, author, committer) are missing, +// duplicated, or out of order. +var ErrMalformedCommit = errors.New("malformed commit") + // Parent returns the ith parent of a commit. func (c *Commit) Parent(i int) (*Commit, error) { if len(c.ParentHashes) == 0 || i > len(c.ParentHashes)-1 { @@ -227,14 +241,23 @@ func (c *Commit) Type() plumbing.ObjectType { return plumbing.CommitObject } +func (c *Commit) reset() { + storer := c.s + *c = Commit{ + Encoding: defaultUtf8CommitMessageEncoding, + s: storer, + } +} + // Decode transforms a plumbing.EncodedObject into a Commit struct. func (c *Commit) Decode(o plumbing.EncodedObject) (err error) { if o.Type() != plumbing.CommitObject { return ErrUnsupportedObject } + c.reset() c.Hash = o.Hash() - c.Encoding = defaultUtf8CommitMessageEncoding + c.src = o reader, err := o.Reader() if err != nil { @@ -245,97 +268,17 @@ func (c *Commit) Decode(o plumbing.EncodedObject) (err error) { r := sync.GetBufioReader(reader) defer sync.PutBufioReader(r) - var message bool - var mergetag bool - var pgpsig bool - var msgbuf bytes.Buffer - var extraheader *ExtraHeader = nil - for { - line, err := r.ReadBytes('\n') - if err != nil && err != io.EOF { + s := &commitScanner{r: r, c: c} + for state := scanTree; state != nil; { + state, err = state(s) + if err != nil { return err } - - if mergetag { - if len(line) > 0 && line[0] == ' ' { - line = bytes.TrimLeft(line, " ") - c.MergeTag += string(line) - continue - } else { - mergetag = false - } - } - - if pgpsig { - if len(line) > 0 && line[0] == ' ' { - line = bytes.TrimLeft(line, " ") - c.PGPSignature += string(line) - continue - } else { - pgpsig = false - } - } - - if extraheader != nil { - if len(line) > 0 && line[0] == ' ' { - extraheader.Value += string(line[1:]) - continue - } else { - extraheader.Value = strings.TrimRight(extraheader.Value, "\n") - c.ExtraHeaders = append(c.ExtraHeaders, *extraheader) - extraheader = nil - } - } - - if !message { - original_line := line - line = bytes.TrimSpace(line) - if len(line) == 0 { - message = true - continue - } - - split := bytes.SplitN(line, []byte{' '}, 2) - - var data []byte - if len(split) == 2 { - data = split[1] - } - - switch string(split[0]) { - case "tree": - c.TreeHash = plumbing.NewHash(string(data)) - case "parent": - c.ParentHashes = append(c.ParentHashes, plumbing.NewHash(string(data))) - case "author": - c.Author.Decode(data) - case "committer": - c.Committer.Decode(data) - case headermergetag: - c.MergeTag += string(data) + "\n" - mergetag = true - case headerencoding: - c.Encoding = MessageEncoding(data) - case headerpgp: - c.PGPSignature += string(data) + "\n" - pgpsig = true - default: - h, maybecontinued := parseExtraHeader(original_line) - if maybecontinued { - extraheader = &h - } else { - c.ExtraHeaders = append(c.ExtraHeaders, h) - } - } - } else { - msgbuf.Write(line) - } - - if err == io.EOF { - break - } } - c.Message = msgbuf.String() + if !s.sawTree { + return fmt.Errorf("%w: missing tree header", ErrMalformedCommit) + } + c.Message = s.msgbuf.String() return nil } @@ -344,11 +287,73 @@ func (c *Commit) Encode(o plumbing.EncodedObject) error { return c.encode(o, true) } -// EncodeWithoutSignature export a Commit into a plumbing.EncodedObject without the signature (correspond to the payload of the PGP signature). +// EncodeWithoutSignature exports a Commit into a plumbing.EncodedObject +// without any signature headers, producing the payload that PGP/GPG +// signatures are computed over. +// +// Behaviour depends on how the Commit was created: +// +// - For Commits populated by Decode whose exported fields still match the +// source object, the payload is streamed from the raw source bytes with +// gpgsig and gpgsig-sha256 headers (and their continuation lines) +// stripped verbatim. This preserves the exact bytes the signature was +// computed over, regardless of any normalization performed by Decode. +// +// - For Commits constructed in memory, or for decoded Commits whose +// exported fields have been mutated, the payload is derived from the +// current struct fields. Mutation is detected by re-decoding the source +// object and comparing exported fields; if any differ, the in-memory +// representation prevails. func (c *Commit) EncodeWithoutSignature(o plumbing.EncodedObject) error { + if c.matchesSource() { + return stripObjectSignatures(o, c.src, plumbing.CommitObject) + } return c.encode(o, false) } +// matchesSource reports whether c.src is set and re-decoding it produces a +// Commit whose payload-affecting exported fields are identical to those of +// c. It is the auto-detection used by EncodeWithoutSignature to decide +// between the raw bytes and the struct-encoded payload. +// +// PGPSignature is intentionally excluded from the comparison: neither path +// emits it, so mutating it must not trigger a switch to struct-encode (which +// would change the byte layout the caller is trying to verify against). +func (c *Commit) matchesSource() bool { + if c.src == nil { + return false + } + fresh := &Commit{} + if err := fresh.Decode(c.src); err != nil { + return false + } + return c.Hash == fresh.Hash && + signatureEqual(c.Author, fresh.Author) && + signatureEqual(c.Committer, fresh.Committer) && + c.MergeTag == fresh.MergeTag && + c.Message == fresh.Message && + c.TreeHash == fresh.TreeHash && + c.Encoding == fresh.Encoding && + slices.Equal(c.ParentHashes, fresh.ParentHashes) && + slices.Equal(c.ExtraHeaders, fresh.ExtraHeaders) +} + +func signatureEqual(a, b Signature) bool { + return a.Name == b.Name && + a.Email == b.Email && + a.When.Unix() == b.When.Unix() && + a.When.Format("-0700") == b.When.Format("-0700") +} + +func isStandardHeader(key string) bool { + switch key { + case "tree", "parent", "author", "committer", + headerencoding, headermergetag, headerpgp, headerpgp256: + return true + } + return false +} + func (c *Commit) encode(o plumbing.EncodedObject, includeSig bool) (err error) { o.SetType(plumbing.CommitObject) w, err := o.Writer() @@ -407,7 +412,9 @@ func (c *Commit) encode(o plumbing.EncodedObject, includeSig bool) (err error) { } for _, header := range c.ExtraHeaders { - + if isStandardHeader(header.Key) { + continue + } if _, err = fmt.Fprintf(w, "\n%s", header); err != nil { return err } @@ -478,9 +485,21 @@ func (c *Commit) String() string { ) } +// ErrMultipleSignatures is returned by Verify when the commit carries more +// than one armored signature block. Mirrors upstream's parse_gpg_output +// rejection of GOODSIG/BADSIG status lines after the first +// (gpg-interface.c:257-269): multi-signature commits are intentionally +// unsupported because their provenance cannot be reduced to a single +// authoritative signer. +var ErrMultipleSignatures = errors.New("commit has multiple signatures") + // Verify performs PGP verification of the commit with a provided armored // keyring and returns openpgp.Entity associated with verifying key on success. func (c *Commit) Verify(armoredKeyRing string) (*openpgp.Entity, error) { + if countSignatureBlocks([]byte(c.PGPSignature)) > 1 { + return nil, ErrMultipleSignatures + } + keyRingReader := strings.NewReader(armoredKeyRing) keyring, err := openpgp.ReadArmoredKeyRing(keyRingReader) if err != nil { diff --git a/vendor/github.com/go-git/go-git/v5/plumbing/object/commit_scanner.go b/vendor/github.com/go-git/go-git/v5/plumbing/object/commit_scanner.go new file mode 100644 index 000000000..7e4cf5441 --- /dev/null +++ b/vendor/github.com/go-git/go-git/v5/plumbing/object/commit_scanner.go @@ -0,0 +1,377 @@ +package object + +import ( + "bufio" + "bytes" + "fmt" + "io" + "strings" + + "github.com/go-git/go-git/v5/plumbing" +) + +// commitScanner holds the working state of the commit decoder driven by the +// stateFn loop in (*Commit).Decode. Each commitState reads one or more lines +// from r, updates the in-progress *Commit and the scanner's bookkeeping, and +// returns the state that should run next (or nil to stop). +type commitScanner struct { + r *bufio.Reader + c *Commit + msgbuf bytes.Buffer + + // pending holds a line that was read but the current state decided to + // hand back to the next state, paired with the io.EOF flag that was + // returned when the line was originally read. + pending []byte + pendingErr error + + // First-occurrence tracking: once the corresponding field has been + // decoded, subsequent occurrences are silently dropped (matches + // upstream's find_commit_header / first-wins semantics). + // + // gpgsig is not tracked here: upstream's parse_buffer_signed_by_header + // (commit.c:1186) accumulates every occurrence into one signature buffer, + // so we do the same on the scanner side to keep verification payloads + // byte-aligned. gpgsig-sha256 is recognized and skipped without exposing a + // new field in v5. + sawTree, sawAuthor, sawCommitter bool + sawEncoding, sawMergetag bool + + // extra is the multi-line ExtraHeader currently being assembled. + extra *ExtraHeader +} + +// commitState is one step of the decoder state machine. Each function reads +// the lines it needs, mutates *Commit via s.c, and returns the next state to +// run (or nil to terminate the loop). +type commitState func(*commitScanner) (commitState, error) + +// readLine returns the next line from the buffer, transparently consuming any +// line that was previously pushed back by a state that decided not to handle +// it. +func (s *commitScanner) readLine() ([]byte, error) { + if s.pending != nil { + line, err := s.pending, s.pendingErr + s.pending, s.pendingErr = nil, nil + return line, err + } + line, err := s.r.ReadBytes('\n') + if err != nil && err != io.EOF { + return line, err + } + return line, err +} + +// pushBack stashes an unconsumed line so the next state's readLine call sees +// it. Only one line can be pushed back at a time. +func (s *commitScanner) pushBack(line []byte, err error) { + s.pending = line + s.pendingErr = err +} + +// scanTree expects the first non-empty header to be `tree HASH`. Anything +// else (or an empty buffer) is rejected with ErrMalformedCommit, matching +// upstream's `bogus commit object` check. +func scanTree(s *commitScanner) (commitState, error) { + line, err := s.readLine() + if err != nil && err != io.EOF { + return nil, err + } + if len(line) == 0 || isBlankLine(line) { + return nil, fmt.Errorf("%w: missing tree header", ErrMalformedCommit) + } + + key, data := splitHeader(line) + if key != "tree" { + return nil, fmt.Errorf("%w: tree header must be first", ErrMalformedCommit) + } + h, herr := parseObjectIDHex(data, ErrMalformedCommit, "tree") + if herr != nil { + return nil, herr + } + s.c.TreeHash = h + s.sawTree = true + if err == io.EOF { + return nil, nil + } + return scanParents, nil +} + +// scanParents consumes contiguous `parent HASH` lines. The first non-parent +// line ends the parent block and is handed off to scanAuthor; any later +// `parent` line is silently dropped (matches upstream's parse_commit_buffer +// exiting its parent loop at the first non-parent line and +// read_commit_extra_header_lines filtering `parent` out of extras). +func scanParents(s *commitScanner) (commitState, error) { + line, err := s.readLine() + if err != nil && err != io.EOF { + return nil, err + } + if len(line) == 0 { + return nil, nil + } + if isBlankLine(line) { + return scanMessage, nil + } + + key, data := splitHeader(line) + if key == "parent" { + h, herr := parseObjectIDHex(data, ErrMalformedCommit, "parent") + if herr != nil { + return nil, herr + } + s.c.ParentHashes = append(s.c.ParentHashes, h) + if err == io.EOF { + return nil, nil + } + return scanParents, nil + } + s.pushBack(line, err) + return scanAuthor, nil +} + +// scanAuthor accepts an `author` line at its canonical position immediately +// after the parent block. Any other header here is pushed back for +// scanCommitter; an out-of-place author is therefore silently dropped. +// Mirrors upstream's parse_commit_date func. +func scanAuthor(s *commitScanner) (commitState, error) { + line, err := s.readLine() + if err != nil && err != io.EOF { + return nil, err + } + if len(line) == 0 { + return nil, nil + } + if isBlankLine(line) { + return scanMessage, nil + } + + key, data := splitHeader(line) + if key == "author" { + s.c.Author.Decode(data) + s.sawAuthor = true + if err == io.EOF { + return nil, nil + } + return scanCommitter, nil + } + s.pushBack(line, err) + return scanCommitter, nil +} + +// scanCommitter accepts a `committer` line at its canonical position +// immediately after the author. Any other header is pushed back for +// scanHeaders. Same upstream rationale as scanAuthor. +func scanCommitter(s *commitScanner) (commitState, error) { + line, err := s.readLine() + if err != nil && err != io.EOF { + return nil, err + } + if len(line) == 0 { + return nil, nil + } + if isBlankLine(line) { + return scanMessage, nil + } + + key, data := splitHeader(line) + if key == "committer" { + s.c.Committer.Decode(data) + s.sawCommitter = true + if err == io.EOF { + return nil, nil + } + return scanHeaders, nil + } + s.pushBack(line, err) + return scanHeaders, nil +} + +// scanHeaders dispatches one header line. Continuation-bearing headers +// (mergetag, gpgsig, gpgsig-sha256, and unknown extras whose value is +// continued on subsequent lines) hand off to a dedicated continuation state +// that handles the `...` lines and then returns here. +func scanHeaders(s *commitScanner) (commitState, error) { + line, err := s.readLine() + if err != nil && err != io.EOF { + return nil, err + } + if len(line) == 0 { + return nil, nil + } + if isBlankLine(line) { + return scanMessage, nil + } + + originalLine := line + key, data := splitHeader(line) + + var next commitState = scanHeaders + switch key { + case "tree", "parent", "author", "committer": + // Anything reaching scanHeaders with one of these keys is out of + // canonical position: duplicate tree, parent past the contiguous + // block, or author/committer not at their expected slot. Drop them + // the same way upstream's standard_header_field filter excludes + // them from the extras list (read_commit_extra_header_lines, + // commit.c:1520-1522). + case headerencoding: + if !s.sawEncoding { + s.c.Encoding = MessageEncoding(data) + s.sawEncoding = true + } + case headermergetag: + if s.sawMergetag { + next = scanSkipCont + } else { + s.c.MergeTag += string(data) + "\n" + s.sawMergetag = true + next = scanMergetagCont + } + case headerpgp: + s.c.PGPSignature += string(data) + "\n" + next = scanPgpCont + case headerpgp256: + next = scanSkipCont + default: + h, multiline := parseExtraHeader(originalLine) + if multiline { + s.extra = &h + next = scanExtraCont + } else { + s.c.ExtraHeaders = append(s.c.ExtraHeaders, h) + } + } + + if err == io.EOF { + return nil, nil + } + return next, nil +} + +// scanMergetagCont accumulates continuation lines for the first mergetag +// header. Continuations strip exactly one leading space, mirroring upstream's +// `line + 1` (commit.c:1509). The first non-continuation line is pushed back +// so scanHeaders can dispatch it. +func scanMergetagCont(s *commitScanner) (commitState, error) { + return continuationCont(s, &s.c.MergeTag, scanMergetagCont) +} + +// scanPgpCont accumulates continuation lines for a signature header. +// Continuations strip exactly one leading space, mirroring upstream's +// `line + 1` (commit.c:1509). The first non-continuation line is pushed back +// so scanHeaders can dispatch it. Repeat occurrences of the same signature +// header land back here and concatenate, matching upstream's +// parse_buffer_signed_by_header (commit.c:1186). +func scanPgpCont(s *commitScanner) (commitState, error) { + return continuationCont(s, &s.c.PGPSignature, scanPgpCont) +} + +func continuationCont(s *commitScanner, dst *string, self commitState) (commitState, error) { + line, err := s.readLine() + if err != nil && err != io.EOF { + return nil, err + } + if len(line) > 0 && line[0] == ' ' { + *dst += string(line[1:]) + if err == io.EOF { + return nil, nil + } + return self, nil + } + if len(line) > 0 { + s.pushBack(line, err) + } + return scanHeaders, nil +} + +// scanSkipCont discards continuation lines that belong to a header scanHeaders +// chose to drop. +func scanSkipCont(s *commitScanner) (commitState, error) { + line, err := s.readLine() + if err != nil && err != io.EOF { + return nil, err + } + if len(line) > 0 && line[0] == ' ' { + if err == io.EOF { + return nil, nil + } + return scanSkipCont, nil + } + if len(line) > 0 { + s.pushBack(line, err) + } + return scanHeaders, nil +} + +// scanExtraCont accumulates continuation lines for an unknown ExtraHeader +// whose value spans multiple lines, then finalises the entry once the +// continuation block ends. +func scanExtraCont(s *commitScanner) (commitState, error) { + line, err := s.readLine() + if err != nil && err != io.EOF { + return nil, err + } + if len(line) > 0 && line[0] == ' ' { + s.extra.Value += string(line[1:]) + if err == io.EOF { + s.finaliseExtra() + return nil, nil + } + return scanExtraCont, nil + } + s.finaliseExtra() + if len(line) > 0 { + s.pushBack(line, err) + } + return scanHeaders, nil +} + +func (s *commitScanner) finaliseExtra() { + s.extra.Value = strings.TrimRight(s.extra.Value, "\n") + s.c.ExtraHeaders = append(s.c.ExtraHeaders, *s.extra) + s.extra = nil +} + +// scanMessage drains the remaining bytes into the message buffer. +func scanMessage(s *commitScanner) (commitState, error) { + for { + line, err := s.readLine() + if err != nil && err != io.EOF { + return nil, err + } + if len(line) > 0 { + s.msgbuf.Write(line) + } + if err == io.EOF { + return nil, nil + } + } +} + +// isBlankLine reports whether line is the canonical header/body separator: +// a single newline. Mirrors upstream's `*line == '\n'` test in +// read_commit_extra_header_lines (commit.c:1502). +func isBlankLine(line []byte) bool { + return len(line) == 1 && line[0] == '\n' +} + +// splitHeader returns the header keyword (everything before the first space) +// and the value (everything after, with the trailing newline stripped). If +// the header has no value the returned data is nil. +func splitHeader(line []byte) (string, []byte) { + trimmed := bytes.TrimRight(line, "\n") + key, value, ok := bytes.Cut(trimmed, []byte{' '}) + if !ok { + return string(trimmed), nil + } + return string(key), value +} + +func parseObjectIDHex(data []byte, malformedErr error, header string) (plumbing.Hash, error) { + id := string(data) + if !plumbing.IsHash(id) { + return plumbing.ZeroHash, fmt.Errorf("%w: bad %s hash", malformedErr, header) + } + return plumbing.NewHash(id), nil +} diff --git a/vendor/github.com/go-git/go-git/v5/plumbing/object/signature.go b/vendor/github.com/go-git/go-git/v5/plumbing/object/signature.go index f9c3d306b..3346e4fd1 100644 --- a/vendor/github.com/go-git/go-git/v5/plumbing/object/signature.go +++ b/vendor/github.com/go-git/go-git/v5/plumbing/object/signature.go @@ -1,6 +1,13 @@ package object -import "bytes" +import ( + "bytes" + "io" + + "github.com/go-git/go-git/v5/plumbing" + "github.com/go-git/go-git/v5/utils/ioutil" + "github.com/go-git/go-git/v5/utils/sync" +) const ( signatureTypeUnknown signatureType = iota @@ -100,3 +107,116 @@ func parseSignedBytes(b []byte) (int, signatureType) { } return match, t } + +// countSignatureBlocks reports how many distinct armored signature blocks +// start at a line boundary in b. Used by verification paths to reject +// multi-signature payloads, matching upstream's check in gpg-interface.c +// where parse_gpg_output bails out the first time it sees a second +// exclusive status line (a second GOODSIG/BADSIG/etc.). +func countSignatureBlocks(b []byte) int { + n, count := 0, 0 + for n < len(b) { + i := b[n:] + if typeForSignature(i) != signatureTypeUnknown { + count++ + } + if eol := bytes.IndexByte(i, '\n'); eol >= 0 { + n += eol + 1 + continue + } + break + } + return count +} + +// isSignatureHeader reports whether line is a canonical "gpgsig "/ +// "gpgsig-sha256 " header line. Other "gpgsig"-prefixed extra headers +// are intentionally not matched. +func isSignatureHeader(line []byte) bool { + return bytes.HasPrefix(line, []byte(headerpgp+" ")) || + bytes.HasPrefix(line, []byte(headerpgp256+" ")) +} + +// stripObjectSignatures streams src into dst, producing the byte sequence +// over which a PGP/GPG signature is computed: +// +// - Canonical "gpgsig" and "gpgsig-sha256" headers (and their +// continuation lines) are dropped, mirroring upstream's +// remove_signature in commit.c. +// - For tag objects, the inline trailing PGP signature is additionally +// truncated, mirroring upstream's parse_signature in gpg-interface.c +// used by gpg_verify_tag. +// +// The returned object's type is set to objType. Used by both +// Commit.EncodeWithoutSignature and Tag.EncodeWithoutSignature to +// reproduce the exact bytes the signature was computed over. +func stripObjectSignatures(dst, src plumbing.EncodedObject, objType plumbing.ObjectType) (err error) { + dst.SetType(objType) + + r, err := src.Reader() + if err != nil { + return err + } + defer ioutil.CheckClose(r, &err) + + var input io.Reader = r + if objType == plumbing.TagObject { + raw, err := io.ReadAll(r) + if err != nil { + return err + } + if sm, _ := parseSignedBytes(raw); sm >= 0 { + raw = raw[:sm] + } + input = bytes.NewReader(raw) + } + + w, err := dst.Writer() + if err != nil { + return err + } + defer ioutil.CheckClose(w, &err) + + return stripHeaderSignatures(w, input) +} + +// stripHeaderSignatures copies r to w, dropping canonical signature header +// lines (gpgsig and gpgsig-sha256) and their continuation lines. Lines +// past the blank line that closes the header block are copied verbatim. +func stripHeaderSignatures(w io.Writer, r io.Reader) error { + br := sync.GetBufioReader(r) + defer sync.PutBufioReader(br) + + var inBody, skipping bool + for { + line, rerr := br.ReadBytes('\n') + if rerr != nil && rerr != io.EOF { + return rerr + } + + write := true + if !inBody { + switch { + case skipping && len(line) > 0 && line[0] == ' ': + write = false + case isSignatureHeader(line): + skipping = true + write = false + case len(line) == 1 && line[0] == '\n': + skipping = false + inBody = true + default: + skipping = false + } + } + + if write && len(line) > 0 { + if _, werr := w.Write(line); werr != nil { + return werr + } + } + if rerr == io.EOF { + return nil + } + } +} diff --git a/vendor/github.com/go-git/go-git/v5/plumbing/object/tag.go b/vendor/github.com/go-git/go-git/v5/plumbing/object/tag.go index cf46c08e1..93e56a4a5 100644 --- a/vendor/github.com/go-git/go-git/v5/plumbing/object/tag.go +++ b/vendor/github.com/go-git/go-git/v5/plumbing/object/tag.go @@ -1,9 +1,8 @@ package object import ( - "bytes" + "errors" "fmt" - "io" "strings" "github.com/ProtonMail/go-crypto/openpgp" @@ -13,6 +12,10 @@ import ( "github.com/go-git/go-git/v5/utils/sync" ) +// ErrMalformedTag is returned when a tag object cannot be decoded because +// its required headers (object, type, tag) are missing or out of order. +var ErrMalformedTag = errors.New("malformed tag") + // Tag represents an annotated tag object. It points to a single git object of // any type, but tags typically are applied to commit or blob objects. It // provides a reference that associates the target with a tag name. It also @@ -39,6 +42,9 @@ type Tag struct { Target plumbing.Hash s storer.EncodedObjectStorer + // src holds the encoded object this Tag was decoded from, used by + // EncodeWithoutSignature to recover the canonical signed bytes. + src plumbing.EncodedObject } // GetTag gets a tag from an object storer and decodes it. @@ -77,13 +83,20 @@ func (t *Tag) Type() plumbing.ObjectType { return plumbing.TagObject } +func (t *Tag) reset() { + storer := t.s + *t = Tag{s: storer} +} + // Decode transforms a plumbing.EncodedObject into a Tag struct. func (t *Tag) Decode(o plumbing.EncodedObject) (err error) { if o.Type() != plumbing.TagObject { return ErrUnsupportedObject } + t.reset() t.Hash = o.Hash() + t.src = o reader, err := o.Reader() if err != nil { @@ -94,42 +107,15 @@ func (t *Tag) Decode(o plumbing.EncodedObject) (err error) { r := sync.GetBufioReader(reader) defer sync.PutBufioReader(r) - for { - var line []byte - line, err = r.ReadBytes('\n') - if err != nil && err != io.EOF { + scanner := &tagScanner{r: r, t: t} + for state := scanTagObject; state != nil; { + state, err = state(scanner) + if err != nil { return err } - - line = bytes.TrimSpace(line) - if len(line) == 0 { - break // Start of message - } - - split := bytes.SplitN(line, []byte{' '}, 2) - switch string(split[0]) { - case "object": - t.Target = plumbing.NewHash(string(split[1])) - case "type": - t.TargetType, err = plumbing.ParseObjectType(string(split[1])) - if err != nil { - return err - } - case "tag": - t.Name = string(split[1]) - case "tagger": - t.Tagger.Decode(split[1]) - } - - if err == io.EOF { - return nil - } } - data, err := io.ReadAll(r) - if err != nil { - return err - } + data := scanner.msgbuf.Bytes() if sm, _ := parseSignedBytes(data); sm >= 0 { t.PGPSignature = string(data[sm:]) data = data[:sm] @@ -144,11 +130,54 @@ func (t *Tag) Encode(o plumbing.EncodedObject) error { return t.encode(o, true) } -// EncodeWithoutSignature export a Tag into a plumbing.EncodedObject without the signature (correspond to the payload of the PGP signature). +// EncodeWithoutSignature exports a Tag into a plumbing.EncodedObject without +// any signature data, producing the payload that PGP/GPG signatures are +// computed over. +// +// Behaviour mirrors Commit.EncodeWithoutSignature: +// +// - For Tags populated by Decode whose exported fields still match the +// source object, the payload is streamed from the raw source bytes with +// the inline trailing signature truncated and gpgsig/gpgsig-sha256 +// headers (and their continuation lines) stripped verbatim. This +// preserves the exact bytes the signature was computed over, regardless +// of any normalization performed by Decode. +// +// - For Tags constructed in memory, or for decoded Tags whose exported +// fields have been mutated, the payload is derived from the current +// struct fields. Mutation is detected by re-decoding the source object +// and comparing exported fields; if any differ, the in-memory +// representation prevails. func (t *Tag) EncodeWithoutSignature(o plumbing.EncodedObject) error { + if t.matchesSource() { + return stripObjectSignatures(o, t.src, plumbing.TagObject) + } return t.encode(o, false) } +// matchesSource reports whether t.src is set and re-decoding it produces a +// Tag whose payload-affecting exported fields are identical to those of t. +// +// PGPSignature is intentionally excluded from the comparison: neither path +// emits it as part of the verification payload, so mutating it must not +// trigger a switch to struct-encode (which would change the byte layout the +// caller is trying to verify against). +func (t *Tag) matchesSource() bool { + if t.src == nil { + return false + } + fresh := &Tag{} + if err := fresh.Decode(t.src); err != nil { + return false + } + return t.Hash == fresh.Hash && + t.Name == fresh.Name && + signatureEqual(t.Tagger, fresh.Tagger) && + t.Message == fresh.Message && + t.TargetType == fresh.TargetType && + t.Target == fresh.Target +} + func (t *Tag) encode(o plumbing.EncodedObject, includeSig bool) (err error) { o.SetType(plumbing.TagObject) w, err := o.Writer() @@ -158,16 +187,26 @@ func (t *Tag) encode(o plumbing.EncodedObject, includeSig bool) (err error) { defer ioutil.CheckClose(w, &err) if _, err = fmt.Fprintf(w, - "object %s\ntype %s\ntag %s\ntagger ", + "object %s\ntype %s\ntag %s\n", t.Target.String(), t.TargetType.Bytes(), t.Name); err != nil { return err } - if err = t.Tagger.Encode(w); err != nil { - return err + if !isZeroSignature(t.Tagger) { + if _, err = fmt.Fprint(w, "tagger "); err != nil { + return err + } + + if err = t.Tagger.Encode(w); err != nil { + return err + } + + if _, err = fmt.Fprint(w, "\n"); err != nil { + return err + } } - if _, err = fmt.Fprint(w, "\n\n"); err != nil { + if _, err = fmt.Fprint(w, "\n"); err != nil { return err } @@ -175,11 +214,12 @@ func (t *Tag) encode(o plumbing.EncodedObject, includeSig bool) (err error) { return err } - // Note that this is highly sensitive to what it sent along in the message. - // Message *always* needs to end with a newline, or else the message and the - // signature will be concatenated into a corrupt object. Since this is a - // lower-level method, we assume you know what you are doing and have already - // done the needful on the message in the caller. + // Note that this is highly sensitive to what is sent along in the + // message. Message *always* needs to end with a newline, or else the + // message and the trailing signature will be concatenated into a + // corrupt object. Since this is a lower-level method, we assume you + // know what you are doing and have already done the needful on the + // message in the caller. if includeSig { if _, err = fmt.Fprint(w, t.PGPSignature); err != nil { return err @@ -189,6 +229,10 @@ func (t *Tag) encode(o plumbing.EncodedObject, includeSig bool) (err error) { return err } +func isZeroSignature(s Signature) bool { + return s.Name == "" && s.Email == "" && s.When.IsZero() +} + // Commit returns the commit pointed to by the tag. If the tag points to a // different type of object ErrUnsupportedObject will be returned. func (t *Tag) Commit() (*Commit, error) { @@ -256,7 +300,8 @@ func (t *Tag) String() string { } // Verify performs PGP verification of the tag with a provided armored -// keyring and returns openpgp.Entity associated with verifying key on success. +// keyring and returns openpgp.Entity associated with verifying key on +// success. func (t *Tag) Verify(armoredKeyRing string) (*openpgp.Entity, error) { keyRingReader := strings.NewReader(armoredKeyRing) keyring, err := openpgp.ReadArmoredKeyRing(keyRingReader) diff --git a/vendor/github.com/go-git/go-git/v5/plumbing/object/tag_scanner.go b/vendor/github.com/go-git/go-git/v5/plumbing/object/tag_scanner.go new file mode 100644 index 000000000..2bfb3a1d7 --- /dev/null +++ b/vendor/github.com/go-git/go-git/v5/plumbing/object/tag_scanner.go @@ -0,0 +1,237 @@ +package object + +import ( + "bufio" + "bytes" + "fmt" + "io" + + "github.com/go-git/go-git/v5/plumbing" +) + +// tagScanner holds the working state of the tag decoder driven by the +// stateFn loop in (*Tag).Decode. Each tagState reads one or more lines +// from r, updates the in-progress *Tag and the scanner's bookkeeping, +// and returns the state that should run next (or nil to stop). +type tagScanner struct { + r *bufio.Reader + t *Tag + msgbuf bytes.Buffer + + // pending holds a line that was read but the current state decided to + // hand back to the next state, paired with the io.EOF flag returned + // when the line was originally read. + pending []byte + pendingErr error + + // First-occurrence tracking: once the corresponding canonical + // header has been decoded at its expected position, subsequent + // occurrences (or out-of-position lines) are silently dropped, + // matching the strict layout enforced by upstream's + // parse_tag_buffer (tag.c:130). + // + // gpgsig-sha256 is recognized and skipped without exposing a new field + // in v5. + sawObject, sawType, sawName, sawTagger bool +} + +// tagState is one step of the decoder state machine. Each function reads +// the lines it needs, mutates *Tag via s.t, and returns the next state +// to run (or nil to terminate the loop). +type tagState func(*tagScanner) (tagState, error) + +// readLine returns the next line from the buffer, transparently +// consuming any line that was previously pushed back by a state that +// decided not to handle it. +func (s *tagScanner) readLine() ([]byte, error) { + if s.pending != nil { + line, err := s.pending, s.pendingErr + s.pending, s.pendingErr = nil, nil + return line, err + } + return s.r.ReadBytes('\n') +} + +// pushBack stashes an unconsumed line so the next state's readLine call +// sees it. Only one line can be pushed back at a time. +func (s *tagScanner) pushBack(line []byte, err error) { + s.pending = line + s.pendingErr = err +} + +// scanTagObject requires the first line to be `object HASH`, mirroring +// upstream's strict parse_tag_buffer (tag.c:151-156). Anything else +// returns ErrMalformedTag. +func scanTagObject(s *tagScanner) (tagState, error) { + line, err := s.readLine() + if err != nil && err != io.EOF { + return nil, err + } + if len(line) == 0 || isBlankLine(line) { + return nil, fmt.Errorf("%w: missing object header", ErrMalformedTag) + } + + key, data := splitHeader(line) + if key != "object" { + return nil, fmt.Errorf("%w: object header must be first", ErrMalformedTag) + } + h, herr := parseObjectIDHex(data, ErrMalformedTag, "object") + if herr != nil { + return nil, herr + } + s.t.Target = h + s.sawObject = true + if err == io.EOF { + return nil, nil + } + return scanTagType, nil +} + +// scanTagType requires a `type` line immediately after the object header, +// mirroring upstream's parse_tag_buffer (tag.c:158-166). +func scanTagType(s *tagScanner) (tagState, error) { + line, err := s.readLine() + if err != nil && err != io.EOF { + return nil, err + } + if len(line) == 0 || isBlankLine(line) { + return nil, fmt.Errorf("%w: missing type header", ErrMalformedTag) + } + + key, data := splitHeader(line) + if key != "type" { + return nil, fmt.Errorf("%w: type header must follow object", ErrMalformedTag) + } + ot, perr := plumbing.ParseObjectType(string(data)) + if perr != nil { + return nil, perr + } + s.t.TargetType = ot + s.sawType = true + if err == io.EOF { + return nil, nil + } + return scanTagName, nil +} + +// scanTagName requires a `tag` line immediately after the type header, +// mirroring upstream's parse_tag_buffer (tag.c:186-194). +func scanTagName(s *tagScanner) (tagState, error) { + line, err := s.readLine() + if err != nil && err != io.EOF { + return nil, err + } + if len(line) == 0 || isBlankLine(line) { + return nil, fmt.Errorf("%w: missing tag header", ErrMalformedTag) + } + + key, data := splitHeader(line) + if key != "tag" { + return nil, fmt.Errorf("%w: tag header must follow type", ErrMalformedTag) + } + s.t.Name = string(data) + s.sawName = true + if err == io.EOF { + return nil, nil + } + return scanTagTagger, nil +} + +// scanTagTagger accepts a `tagger` line at its canonical position. Any +// other header is pushed back for scanTagHeaders. +func scanTagTagger(s *tagScanner) (tagState, error) { + line, err := s.readLine() + if err != nil && err != io.EOF { + return nil, err + } + if len(line) == 0 { + return nil, nil + } + if isBlankLine(line) { + return scanTagMessage, nil + } + + key, data := splitHeader(line) + if key == "tagger" { + s.t.Tagger.Decode(data) + s.sawTagger = true + if err == io.EOF { + return nil, nil + } + return scanTagHeaders, nil + } + s.pushBack(line, err) + return scanTagHeaders, nil +} + +// scanTagHeaders dispatches one header line. gpgsig-sha256 hands off to +// scanTagSkipCont so the continuation block can be consumed; out-of-position +// canonical fields and unknown headers are silently dropped. +func scanTagHeaders(s *tagScanner) (tagState, error) { + line, err := s.readLine() + if err != nil && err != io.EOF { + return nil, err + } + if len(line) == 0 { + return nil, nil + } + if isBlankLine(line) { + return scanTagMessage, nil + } + + key, _ := splitHeader(line) + next := scanTagHeaders + switch key { + case "object", "type", "tag", "tagger": + // Out-of-canonical-position duplicates are dropped, mirroring the + // strict ordering of upstream's parse_tag_buffer. + case headerpgp256: + next = scanTagSkipCont + default: + // Unknown header: silently dropped (the Tag struct does not + // expose ExtraHeaders). + } + + if err == io.EOF { + return nil, nil + } + return next, nil +} + +// scanTagSkipCont discards continuation lines for a header scanTagHeaders chose +// to drop. The first non-continuation line is pushed back so scanTagHeaders can +// dispatch it. +func scanTagSkipCont(s *tagScanner) (tagState, error) { + line, err := s.readLine() + if err != nil && err != io.EOF { + return nil, err + } + if len(line) > 0 && line[0] == ' ' { + if err == io.EOF { + return nil, nil + } + return scanTagSkipCont, nil + } + if len(line) > 0 { + s.pushBack(line, err) + } + return scanTagHeaders, nil +} + +// scanTagMessage drains the remaining bytes into the message buffer. +// (*Tag).Decode then runs parseSignedBytes over those bytes to peel off +// the optional inline trailing PGP signature. +func scanTagMessage(s *tagScanner) (tagState, error) { + for { + line, err := s.readLine() + if err != nil && err != io.EOF { + return nil, err + } + if len(line) > 0 { + s.msgbuf.Write(line) + } + if err == io.EOF { + return nil, nil + } + } +} diff --git a/vendor/github.com/go-git/go-git/v5/plumbing/object/tree.go b/vendor/github.com/go-git/go-git/v5/plumbing/object/tree.go index 2e1b78915..d0d0036de 100644 --- a/vendor/github.com/go-git/go-git/v5/plumbing/object/tree.go +++ b/vendor/github.com/go-git/go-git/v5/plumbing/object/tree.go @@ -29,6 +29,7 @@ var ( ErrDirectoryNotFound = errors.New("directory not found") ErrEntryNotFound = errors.New("entry not found") ErrEntriesNotSorted = errors.New("entries in tree are not sorted") + ErrMalformedTree = errors.New("malformed tree") ) // Tree is basically like a directory - it references a bunch of other trees @@ -37,9 +38,9 @@ type Tree struct { Entries []TreeEntry Hash plumbing.Hash - s storer.EncodedObjectStorer - m map[string]*TreeEntry - t map[string]*Tree // tree path cache + s storer.EncodedObjectStorer + t map[string]*Tree // tree path cache + entriesSorted bool } // GetTree gets a tree from an object storer and decodes it. @@ -182,16 +183,43 @@ func (t *Tree) dir(baseName string) (*Tree, error) { } func (t *Tree) entry(baseName string) (*TreeEntry, error) { - if t.m == nil { - t.buildMap() - } - - entry, ok := t.m[baseName] - if !ok { + if t.entriesSorted { + if entry := t.searchEntry(baseName); entry != nil { + return entry, nil + } return nil, ErrEntryNotFound } - return entry, nil + pastName := baseName + "/" + for i := range t.Entries { + entry := &t.Entries[i] + if entry.Name == baseName { + return entry, nil + } + if treeEntrySortName(entry) > pastName { + break + } + } + + return nil, ErrEntryNotFound +} + +func (t *Tree) searchEntry(baseName string) *TreeEntry { + if i := t.searchEntryIndex(baseName); i < len(t.Entries) && t.Entries[i].Name == baseName { + return &t.Entries[i] + } + + if i := t.searchEntryIndex(baseName + "/"); i < len(t.Entries) && t.Entries[i].Name == baseName { + return &t.Entries[i] + } + + return nil +} + +func (t *Tree) searchEntryIndex(name string) int { + return sort.Search(len(t.Entries), func(i int) bool { + return treeEntrySortName(&t.Entries[i]) >= name + }) } // Files returns a FileIter allowing to iterate over the Tree @@ -212,20 +240,25 @@ func (t *Tree) Type() plumbing.ObjectType { return plumbing.TreeObject } +func (t *Tree) reset() { + storer := t.s + *t = Tree{s: storer} +} + // Decode transform an plumbing.EncodedObject into a Tree struct func (t *Tree) Decode(o plumbing.EncodedObject) (err error) { if o.Type() != plumbing.TreeObject { return ErrUnsupportedObject } + t.reset() t.Hash = o.Hash() + // assume tree is sorted as a valid tree should always be sorted. + t.entriesSorted = true if o.Size() == 0 { return nil } - t.Entries = nil - t.m = nil - reader, err := o.Reader() if err != nil { return err @@ -235,10 +268,14 @@ func (t *Tree) Decode(o plumbing.EncodedObject) (err error) { r := sync.GetBufioReader(reader) defer sync.PutBufioReader(r) + var prevSortName string for { str, err := r.ReadString(' ') if err != nil { if err == io.EOF { + if len(str) != 0 { + return fmt.Errorf("%w: missing mode terminator", ErrMalformedTree) + } break } @@ -248,25 +285,41 @@ func (t *Tree) Decode(o plumbing.EncodedObject) (err error) { mode, err := filemode.New(str) if err != nil { - return err + return fmt.Errorf("%w: malformed mode", ErrMalformedTree) } + mode = canonicalTreeMode(mode) name, err := r.ReadString(0) - if err != nil && err != io.EOF { + if err != nil { + if err == io.EOF { + return fmt.Errorf("%w: missing filename terminator", ErrMalformedTree) + } return err } + if len(name) == 1 { + return fmt.Errorf("%w: empty filename", ErrMalformedTree) + } var hash plumbing.Hash if _, err = io.ReadFull(r, hash[:]); err != nil { + if errors.Is(err, io.EOF) || errors.Is(err, io.ErrUnexpectedEOF) { + return fmt.Errorf("%w: truncated object id", ErrMalformedTree) + } return err } baseName := name[:len(name)-1] - t.Entries = append(t.Entries, TreeEntry{ + entry := TreeEntry{ Hash: hash, Mode: mode, Name: baseName, - }) + } + sortName := treeEntrySortName(&entry) + if len(t.Entries) != 0 && prevSortName > sortName { + t.entriesSorted = false + } + prevSortName = sortName + t.Entries = append(t.Entries, entry) } return nil @@ -279,21 +332,37 @@ func (s TreeEntrySorter) Len() int { } func (s TreeEntrySorter) Less(i, j int) bool { - name1 := s[i].Name - name2 := s[j].Name - if s[i].Mode == filemode.Dir { - name1 += "/" - } - if s[j].Mode == filemode.Dir { - name2 += "/" - } - return name1 < name2 + return treeEntrySortName(&s[i]) < treeEntrySortName(&s[j]) } func (s TreeEntrySorter) Swap(i, j int) { s[i], s[j] = s[j], s[i] } +// Git compares tree entries as if directory names had a trailing slash. +func treeEntrySortName(e *TreeEntry) string { + if e.Mode == filemode.Dir { + return e.Name + "/" + } + return e.Name +} + +func canonicalTreeMode(mode filemode.FileMode) filemode.FileMode { + switch mode & 0o170000 { + case 0o040000: + return filemode.Dir + case 0o100000: + if mode&0o111 != 0 { + return filemode.Executable + } + return filemode.Regular + case 0o120000: + return filemode.Symlink + default: + return filemode.Submodule + } +} + // Encode transforms a Tree into a plumbing.EncodedObject. // The tree entries must be sorted by name. func (t *Tree) Encode(o plumbing.EncodedObject) (err error) { @@ -329,13 +398,6 @@ func (t *Tree) Encode(o plumbing.EncodedObject) (err error) { return err } -func (t *Tree) buildMap() { - t.m = make(map[string]*TreeEntry) - for i := 0; i < len(t.Entries); i++ { - t.m[t.Entries[i].Name] = &t.Entries[i] - } -} - // Diff returns a list of changes between this tree and the provided one func (t *Tree) Diff(to *Tree) (Changes, error) { return t.DiffContext(context.Background(), to) diff --git a/vendor/github.com/klauspost/cpuid/v2/README.md b/vendor/github.com/klauspost/cpuid/v2/README.md index 7b1d59921..88d68d528 100644 --- a/vendor/github.com/klauspost/cpuid/v2/README.md +++ b/vendor/github.com/klauspost/cpuid/v2/README.md @@ -281,7 +281,7 @@ Exit Code 1 | AMXBF16 | Tile computational operations on BFLOAT16 numbers | | AMXINT8 | Tile computational operations on 8-bit integers | | AMXFP16 | Tile computational operations on FP16 numbers | -| AMXFP8 | Tile computational operations on FP8 numbers | +| AMXFP8 | Tile computational operations on FP8 numbers | | AMXCOMPLEX | Tile computational operations on complex numbers | | AMXTILE | Tile architecture | | AMXTF32 | Matrix Multiplication of TF32 Tiles into Packed Single Precision Tile | @@ -418,6 +418,7 @@ Exit Code 1 | SEV_SNP | AMD SEV Secure Nested Paging supported | | SGX | Software Guard Extensions | | SGXLC | Software Guard Extensions Launch Control | +| SGXPQC | Software Guard Extensions 256-bit Encryption | | SHA | Intel SHA Extensions | | SME | AMD Secure Memory Encryption supported | | SME_COHERENT | AMD Hardware cache coherency across encryption domains enforced | @@ -450,6 +451,9 @@ Exit Code 1 | TLB_FLUSH_NESTED | AMD: Flushing includes all the nested translations for guest translations | | TME | Intel Total Memory Encryption. The following MSRs are supported: IA32_TME_CAPABILITY, IA32_TME_ACTIVATE, IA32_TME_EXCLUDE_MASK, and IA32_TME_EXCLUDE_BASE. | | TOPEXT | TopologyExtensions: topology extensions support. Indicates support for CPUID Fn8000_001D_EAX_x[N:0]-CPUID Fn8000_001E_EDX. | +| TSA_L1_NO | AMD only: Not vulnerable to TSA-L1 | +| TSA_SQ_NO | AMD only: Not vulnerable to TSA-SQ | +| TSA_VERW_CLEAR | AMD: If set, the memory form of the VERW instruction may be used to help mitigate TSA | | TSCRATEMSR | MSR based TSC rate control. Indicates support for MSR TSC ratio MSRC000_0104 | | TSXLDTRK | Intel TSX Suspend Load Address Tracking | | VAES | Vector AES. AVX(512) versions requires additional checks. | diff --git a/vendor/github.com/klauspost/cpuid/v2/cpuid.go b/vendor/github.com/klauspost/cpuid/v2/cpuid.go index 248439a9a..9cf7738a9 100644 --- a/vendor/github.com/klauspost/cpuid/v2/cpuid.go +++ b/vendor/github.com/klauspost/cpuid/v2/cpuid.go @@ -220,6 +220,7 @@ const ( SEV_SNP // AMD SEV Secure Nested Paging supported SGX // Software Guard Extensions SGXLC // Software Guard Extensions Launch Control + SGXPQC // Software Guard Extensions 256-bit Encryption SHA // Intel SHA Extensions SME // AMD Secure Memory Encryption supported SME_COHERENT // AMD Hardware cache coherency across encryption domains enforced @@ -255,6 +256,9 @@ const ( TLB_FLUSH_NESTED // AMD: Flushing includes all the nested translations for guest translations TME // Intel Total Memory Encryption. The following MSRs are supported: IA32_TME_CAPABILITY, IA32_TME_ACTIVATE, IA32_TME_EXCLUDE_MASK, and IA32_TME_EXCLUDE_BASE. TOPEXT // TopologyExtensions: topology extensions support. Indicates support for CPUID Fn8000_001D_EAX_x[N:0]-CPUID Fn8000_001E_EDX. + TSA_L1_NO // AMD only: Not vulnerable to TSA-L1 + TSA_SQ_NO // AM onlyD: Not vulnerable to TSA-SQ + TSA_VERW_CLEAR // If set, the memory form of the VERW instruction may be used to help mitigate TSA TSCRATEMSR // MSR based TSC rate control. Indicates support for MSR TSC ratio MSRC000_0104 TSXLDTRK // Intel TSX Suspend Load Address Tracking VAES // Vector AES. AVX(512) versions requires additional checks. @@ -304,6 +308,13 @@ const ( SM3 // SM3 instructions SM4 // SM4 instructions SVE // Scalable Vector Extension + + // PMU + PMU_FIXEDCOUNTER_CYCLES + PMU_FIXEDCOUNTER_REFCYCLES + PMU_FIXEDCOUNTER_INSTRUCTIONS + PMU_FIXEDCOUNTER_TOPDOWN_SLOTS + // Keep it last. It automatically defines the size of []flagSet lastID @@ -336,11 +347,36 @@ type CPUInfo struct { SGX SGXSupport AMDMemEncryption AMDMemEncryptionSupport AVX10Level uint8 + PMU PerformanceMonitoringInfo // holds information about the PMU maxFunc uint32 maxExFunc uint32 } +// PerformanceMonitoringInfo holds information about CPU performance monitoring capabilities. +// This is primarily populated from CPUID leaf 0xAh on x86 +type PerformanceMonitoringInfo struct { + // VersionID (x86 only): Version ID of architectural performance monitoring. + // A value of 0 means architectural performance monitoring is not supported or information is unavailable. + VersionID uint8 + // NumGPPMC: Number of General-Purpose Performance Monitoring Counters per logical processor. + // On ARM, this is derived from PMCR_EL0.N (number of event counters). + NumGPCounters uint8 + // GPPMCWidth: Bit width of General-Purpose Performance Monitoring Counters. + // On ARM, typically 64 for PMU event counters. + GPPMCWidth uint8 + // NumFixedPMC: Number of Fixed-Function Performance Counters. + // Valid on x86 if VersionID > 1. On ARM, this typically includes at least the cycle counter (PMCCNTR_EL0). + NumFixedPMC uint8 + // FixedPMCWidth: Bit width of Fixed-Function Performance Counters. + // Valid on x86 if VersionID > 1. On ARM, the cycle counter (PMCCNTR_EL0) is 64-bit. + FixedPMCWidth uint8 + // Raw register output from CPUID leaf 0xAh. + RawEBX uint32 + RawEAX uint32 + RawEDX uint32 +} + var cpuid func(op uint32) (eax, ebx, ecx, edx uint32) var cpuidex func(op, op2 uint32) (eax, ebx, ecx, edx uint32) var xgetbv func(index uint32) (eax, edx uint32) @@ -1358,6 +1394,11 @@ func support() flagSet { fs.setIf(edx&(1<<4) != 0, BHI_CTRL) fs.setIf(edx&(1<<5) != 0, MCDT_NO) + if fs.inSet(SGX) { + eax, _, _, _ := cpuidex(0x12, 0) + fs.setIf(eax&(1<<12) != 0, SGXPQC) + } + // Add keylocker features. if fs.inSet(KEYLOCKER) && mfi >= 0x19 { _, ebx, _, _ := cpuidex(0x19, 0) @@ -1371,6 +1412,7 @@ func support() flagSet { fs.setIf(ebx&(1<<17) != 0, AVX10_256) fs.setIf(ebx&(1<<18) != 0, AVX10_512) } + } // Processor Extended State Enumeration Sub-leaf (EAX = 0DH, ECX = 1) @@ -1514,12 +1556,28 @@ func support() flagSet { } if maxExtendedFunction() >= 0x80000021 && vend == AMD { - a, _, _, _ := cpuid(0x80000021) + a, _, c, _ := cpuid(0x80000021) fs.setIf((a>>31)&1 == 1, SRSO_MSR_FIX) fs.setIf((a>>30)&1 == 1, SRSO_USER_KERNEL_NO) fs.setIf((a>>29)&1 == 1, SRSO_NO) fs.setIf((a>>28)&1 == 1, IBPB_BRTYPE) fs.setIf((a>>27)&1 == 1, SBPB) + fs.setIf((c>>1)&1 == 1, TSA_L1_NO) + fs.setIf((c>>2)&1 == 1, TSA_SQ_NO) + fs.setIf((a>>5)&1 == 1, TSA_VERW_CLEAR) + } + if vend == AMD { + if family < 0x19 { + // AMD CPUs that are older than Family 19h are not vulnerable to TSA but do not set TSA_L1_NO or TSA_SQ_NO. + // Source: https://www.amd.com/content/dam/amd/en/documents/resources/bulletin/technical-guidance-for-mitigating-transient-scheduler-attacks.pdf + fs.set(TSA_L1_NO) + fs.set(TSA_SQ_NO) + } else if family == 0x1a { + // AMD Family 1Ah models 00h-4Fh and 60h-7Fh are also not vulnerable to TSA but do not set TSA_L1_NO or TSA_SQ_NO. + // Future AMD CPUs will set these CPUID bits if appropriate. CPUs will be designed to set these CPUID bits if appropriate. + notVuln := model <= 0x4f || (model >= 0x60 && model <= 0x7f) + fs.setIf(notVuln, TSA_L1_NO, TSA_SQ_NO) + } } if mfi >= 0x20 { @@ -1575,3 +1633,47 @@ func valAsString(values ...uint32) []byte { } return r } + +func parseLeaf0AH(c *CPUInfo, eax, ebx, edx uint32) (info PerformanceMonitoringInfo) { + info.VersionID = uint8(eax & 0xFF) + info.NumGPCounters = uint8((eax >> 8) & 0xFF) + info.GPPMCWidth = uint8((eax >> 16) & 0xFF) + + info.RawEBX = ebx + info.RawEAX = eax + info.RawEDX = edx + + if info.VersionID > 1 { // This information is only valid if VersionID > 1 + info.NumFixedPMC = uint8(edx & 0x1F) // Bits 4:0 + info.FixedPMCWidth = uint8((edx >> 5) & 0xFF) // Bits 12:5 + } + if info.VersionID > 0 { + // first 4 fixed events are always instructions retired, cycles, ref cycles and topdown slots + if ebx == 0x0 && info.NumFixedPMC == 3 { + c.featureSet.set(PMU_FIXEDCOUNTER_INSTRUCTIONS) + c.featureSet.set(PMU_FIXEDCOUNTER_CYCLES) + c.featureSet.set(PMU_FIXEDCOUNTER_REFCYCLES) + } + if ebx == 0x0 && info.NumFixedPMC == 4 { + c.featureSet.set(PMU_FIXEDCOUNTER_INSTRUCTIONS) + c.featureSet.set(PMU_FIXEDCOUNTER_CYCLES) + c.featureSet.set(PMU_FIXEDCOUNTER_REFCYCLES) + c.featureSet.set(PMU_FIXEDCOUNTER_TOPDOWN_SLOTS) + } + if ebx != 0x0 { + if ((ebx >> 0) & 1) == 0 { + c.featureSet.set(PMU_FIXEDCOUNTER_INSTRUCTIONS) + } + if ((ebx >> 1) & 1) == 0 { + c.featureSet.set(PMU_FIXEDCOUNTER_CYCLES) + } + if ((ebx >> 2) & 1) == 0 { + c.featureSet.set(PMU_FIXEDCOUNTER_REFCYCLES) + } + if ((ebx >> 3) & 1) == 0 { + c.featureSet.set(PMU_FIXEDCOUNTER_TOPDOWN_SLOTS) + } + } + } + return info +} diff --git a/vendor/github.com/klauspost/cpuid/v2/detect_x86.go b/vendor/github.com/klauspost/cpuid/v2/detect_x86.go index f924c9d83..14a56b930 100644 --- a/vendor/github.com/klauspost/cpuid/v2/detect_x86.go +++ b/vendor/github.com/klauspost/cpuid/v2/detect_x86.go @@ -36,6 +36,10 @@ func addInfo(c *CPUInfo, safe bool) { c.AVX10Level = c.supportAVX10() c.cacheSize() c.frequencies() + if c.maxFunc >= 0x0A { + eax, ebx, _, edx := cpuid(0x0A) + c.PMU = parseLeaf0AH(c, eax, ebx, edx) + } } func getVectorLength() (vl, pl uint64) { return 0, 0 } diff --git a/vendor/github.com/klauspost/cpuid/v2/featureid_string.go b/vendor/github.com/klauspost/cpuid/v2/featureid_string.go index 07704351f..2888bae8f 100644 --- a/vendor/github.com/klauspost/cpuid/v2/featureid_string.go +++ b/vendor/github.com/klauspost/cpuid/v2/featureid_string.go @@ -154,95 +154,103 @@ func _() { _ = x[SEV_SNP-144] _ = x[SGX-145] _ = x[SGXLC-146] - _ = x[SHA-147] - _ = x[SME-148] - _ = x[SME_COHERENT-149] - _ = x[SM3_X86-150] - _ = x[SM4_X86-151] - _ = x[SPEC_CTRL_SSBD-152] - _ = x[SRBDS_CTRL-153] - _ = x[SRSO_MSR_FIX-154] - _ = x[SRSO_NO-155] - _ = x[SRSO_USER_KERNEL_NO-156] - _ = x[SSE-157] - _ = x[SSE2-158] - _ = x[SSE3-159] - _ = x[SSE4-160] - _ = x[SSE42-161] - _ = x[SSE4A-162] - _ = x[SSSE3-163] - _ = x[STIBP-164] - _ = x[STIBP_ALWAYSON-165] - _ = x[STOSB_SHORT-166] - _ = x[SUCCOR-167] - _ = x[SVM-168] - _ = x[SVMDA-169] - _ = x[SVMFBASID-170] - _ = x[SVML-171] - _ = x[SVMNP-172] - _ = x[SVMPF-173] - _ = x[SVMPFT-174] - _ = x[SYSCALL-175] - _ = x[SYSEE-176] - _ = x[TBM-177] - _ = x[TDX_GUEST-178] - _ = x[TLB_FLUSH_NESTED-179] - _ = x[TME-180] - _ = x[TOPEXT-181] - _ = x[TSCRATEMSR-182] - _ = x[TSXLDTRK-183] - _ = x[VAES-184] - _ = x[VMCBCLEAN-185] - _ = x[VMPL-186] - _ = x[VMSA_REGPROT-187] - _ = x[VMX-188] - _ = x[VPCLMULQDQ-189] - _ = x[VTE-190] - _ = x[WAITPKG-191] - _ = x[WBNOINVD-192] - _ = x[WRMSRNS-193] - _ = x[X87-194] - _ = x[XGETBV1-195] - _ = x[XOP-196] - _ = x[XSAVE-197] - _ = x[XSAVEC-198] - _ = x[XSAVEOPT-199] - _ = x[XSAVES-200] - _ = x[AESARM-201] - _ = x[ARMCPUID-202] - _ = x[ASIMD-203] - _ = x[ASIMDDP-204] - _ = x[ASIMDHP-205] - _ = x[ASIMDRDM-206] - _ = x[ATOMICS-207] - _ = x[CRC32-208] - _ = x[DCPOP-209] - _ = x[EVTSTRM-210] - _ = x[FCMA-211] - _ = x[FHM-212] - _ = x[FP-213] - _ = x[FPHP-214] - _ = x[GPA-215] - _ = x[JSCVT-216] - _ = x[LRCPC-217] - _ = x[PMULL-218] - _ = x[RNDR-219] - _ = x[TLB-220] - _ = x[TS-221] - _ = x[SHA1-222] - _ = x[SHA2-223] - _ = x[SHA3-224] - _ = x[SHA512-225] - _ = x[SM3-226] - _ = x[SM4-227] - _ = x[SVE-228] - _ = x[lastID-229] + _ = x[SGXPQC-147] + _ = x[SHA-148] + _ = x[SME-149] + _ = x[SME_COHERENT-150] + _ = x[SM3_X86-151] + _ = x[SM4_X86-152] + _ = x[SPEC_CTRL_SSBD-153] + _ = x[SRBDS_CTRL-154] + _ = x[SRSO_MSR_FIX-155] + _ = x[SRSO_NO-156] + _ = x[SRSO_USER_KERNEL_NO-157] + _ = x[SSE-158] + _ = x[SSE2-159] + _ = x[SSE3-160] + _ = x[SSE4-161] + _ = x[SSE42-162] + _ = x[SSE4A-163] + _ = x[SSSE3-164] + _ = x[STIBP-165] + _ = x[STIBP_ALWAYSON-166] + _ = x[STOSB_SHORT-167] + _ = x[SUCCOR-168] + _ = x[SVM-169] + _ = x[SVMDA-170] + _ = x[SVMFBASID-171] + _ = x[SVML-172] + _ = x[SVMNP-173] + _ = x[SVMPF-174] + _ = x[SVMPFT-175] + _ = x[SYSCALL-176] + _ = x[SYSEE-177] + _ = x[TBM-178] + _ = x[TDX_GUEST-179] + _ = x[TLB_FLUSH_NESTED-180] + _ = x[TME-181] + _ = x[TOPEXT-182] + _ = x[TSA_L1_NO-183] + _ = x[TSA_SQ_NO-184] + _ = x[TSA_VERW_CLEAR-185] + _ = x[TSCRATEMSR-186] + _ = x[TSXLDTRK-187] + _ = x[VAES-188] + _ = x[VMCBCLEAN-189] + _ = x[VMPL-190] + _ = x[VMSA_REGPROT-191] + _ = x[VMX-192] + _ = x[VPCLMULQDQ-193] + _ = x[VTE-194] + _ = x[WAITPKG-195] + _ = x[WBNOINVD-196] + _ = x[WRMSRNS-197] + _ = x[X87-198] + _ = x[XGETBV1-199] + _ = x[XOP-200] + _ = x[XSAVE-201] + _ = x[XSAVEC-202] + _ = x[XSAVEOPT-203] + _ = x[XSAVES-204] + _ = x[AESARM-205] + _ = x[ARMCPUID-206] + _ = x[ASIMD-207] + _ = x[ASIMDDP-208] + _ = x[ASIMDHP-209] + _ = x[ASIMDRDM-210] + _ = x[ATOMICS-211] + _ = x[CRC32-212] + _ = x[DCPOP-213] + _ = x[EVTSTRM-214] + _ = x[FCMA-215] + _ = x[FHM-216] + _ = x[FP-217] + _ = x[FPHP-218] + _ = x[GPA-219] + _ = x[JSCVT-220] + _ = x[LRCPC-221] + _ = x[PMULL-222] + _ = x[RNDR-223] + _ = x[TLB-224] + _ = x[TS-225] + _ = x[SHA1-226] + _ = x[SHA2-227] + _ = x[SHA3-228] + _ = x[SHA512-229] + _ = x[SM3-230] + _ = x[SM4-231] + _ = x[SVE-232] + _ = x[PMU_FIXEDCOUNTER_CYCLES-233] + _ = x[PMU_FIXEDCOUNTER_REFCYCLES-234] + _ = x[PMU_FIXEDCOUNTER_INSTRUCTIONS-235] + _ = x[PMU_FIXEDCOUNTER_TOPDOWN_SLOTS-236] + _ = x[lastID-237] _ = x[firstID-0] } -const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXFP8AMXTILEAMXTF32AMXCOMPLEXAMXTRANSPOSEAPX_FAVXAVX10AVX10_128AVX10_256AVX10_512AVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8AVXVNNIINT16BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBPB_BRTYPEIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBKEYLOCKERKEYLOCKERWLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSBPBSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSM3_X86SM4_X86SPEC_CTRL_SSBDSRBDS_CTRLSRSO_MSR_FIXSRSO_NOSRSO_USER_KERNEL_NOSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFHMFPFPHPGPAJSCVTLRCPCPMULLRNDRTLBTSSHA1SHA2SHA3SHA512SM3SM4SVElastID" +const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXFP8AMXTILEAMXTF32AMXCOMPLEXAMXTRANSPOSEAPX_FAVXAVX10AVX10_128AVX10_256AVX10_512AVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8AVXVNNIINT16BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBPB_BRTYPEIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBKEYLOCKERKEYLOCKERWLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSBPBSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSGXPQCSHASMESME_COHERENTSM3_X86SM4_X86SPEC_CTRL_SSBDSRBDS_CTRLSRSO_MSR_FIXSRSO_NOSRSO_USER_KERNEL_NOSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSA_L1_NOTSA_SQ_NOTSA_VERW_CLEARTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFHMFPFPHPGPAJSCVTLRCPCPMULLRNDRTLBTSSHA1SHA2SHA3SHA512SM3SM4SVEPMU_FIXEDCOUNTER_CYCLESPMU_FIXEDCOUNTER_REFCYCLESPMU_FIXEDCOUNTER_INSTRUCTIONSPMU_FIXEDCOUNTER_TOPDOWN_SLOTSlastID" -var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 61, 68, 75, 85, 97, 102, 105, 110, 119, 128, 137, 141, 151, 163, 171, 179, 187, 195, 202, 212, 222, 230, 240, 251, 259, 269, 287, 302, 309, 321, 328, 335, 346, 358, 366, 370, 374, 380, 385, 393, 398, 404, 408, 417, 435, 443, 450, 454, 458, 472, 478, 482, 486, 495, 499, 503, 508, 513, 517, 521, 528, 532, 535, 541, 544, 547, 557, 567, 580, 593, 597, 608, 612, 626, 643, 646, 656, 667, 673, 681, 692, 700, 712, 728, 742, 753, 763, 778, 786, 797, 807, 814, 823, 833, 837, 840, 847, 852, 863, 870, 877, 885, 888, 894, 899, 908, 915, 923, 927, 930, 936, 943, 956, 961, 963, 970, 977, 983, 987, 996, 1000, 1005, 1011, 1017, 1023, 1033, 1036, 1052, 1056, 1065, 1068, 1077, 1092, 1105, 1111, 1125, 1132, 1135, 1140, 1143, 1146, 1158, 1165, 1172, 1186, 1196, 1208, 1215, 1234, 1237, 1241, 1245, 1249, 1254, 1259, 1264, 1269, 1283, 1294, 1300, 1303, 1308, 1317, 1321, 1326, 1331, 1337, 1344, 1349, 1352, 1361, 1377, 1380, 1386, 1396, 1404, 1408, 1417, 1421, 1433, 1436, 1446, 1449, 1456, 1464, 1471, 1474, 1481, 1484, 1489, 1495, 1503, 1509, 1515, 1523, 1528, 1535, 1542, 1550, 1557, 1562, 1567, 1574, 1578, 1581, 1583, 1587, 1590, 1595, 1600, 1605, 1609, 1612, 1614, 1618, 1622, 1626, 1632, 1635, 1638, 1641, 1647} +var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 61, 68, 75, 85, 97, 102, 105, 110, 119, 128, 137, 141, 151, 163, 171, 179, 187, 195, 202, 212, 222, 230, 240, 251, 259, 269, 287, 302, 309, 321, 328, 335, 346, 358, 366, 370, 374, 380, 385, 393, 398, 404, 408, 417, 435, 443, 450, 454, 458, 472, 478, 482, 486, 495, 499, 503, 508, 513, 517, 521, 528, 532, 535, 541, 544, 547, 557, 567, 580, 593, 597, 608, 612, 626, 643, 646, 656, 667, 673, 681, 692, 700, 712, 728, 742, 753, 763, 778, 786, 797, 807, 814, 823, 833, 837, 840, 847, 852, 863, 870, 877, 885, 888, 894, 899, 908, 915, 923, 927, 930, 936, 943, 956, 961, 963, 970, 977, 983, 987, 996, 1000, 1005, 1011, 1017, 1023, 1033, 1036, 1052, 1056, 1065, 1068, 1077, 1092, 1105, 1111, 1125, 1132, 1135, 1140, 1146, 1149, 1152, 1164, 1171, 1178, 1192, 1202, 1214, 1221, 1240, 1243, 1247, 1251, 1255, 1260, 1265, 1270, 1275, 1289, 1300, 1306, 1309, 1314, 1323, 1327, 1332, 1337, 1343, 1350, 1355, 1358, 1367, 1383, 1386, 1392, 1401, 1410, 1424, 1434, 1442, 1446, 1455, 1459, 1471, 1474, 1484, 1487, 1494, 1502, 1509, 1512, 1519, 1522, 1527, 1533, 1541, 1547, 1553, 1561, 1566, 1573, 1580, 1588, 1595, 1600, 1605, 1612, 1616, 1619, 1621, 1625, 1628, 1633, 1638, 1643, 1647, 1650, 1652, 1656, 1660, 1664, 1670, 1673, 1676, 1679, 1702, 1728, 1757, 1787, 1793} func (i FeatureID) String() string { if i < 0 || i >= FeatureID(len(_FeatureID_index)-1) { diff --git a/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/tree/assimilation.go b/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/tree/assimilation.go index 529277535..c1ad1c07a 100644 --- a/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/tree/assimilation.go +++ b/vendor/github.com/opencloud-eu/reva/v2/pkg/storage/fs/posix/tree/assimilation.go @@ -870,6 +870,9 @@ func (t *Tree) WarmupIDCache(root string, assimilate, onlyDirty bool) error { isTrash(path) || t.isUpload(path) || t.isIndex(path) { + if info.IsDir() { + return filepath.SkipDir + } return nil } if t.isRootPath(path) { diff --git a/vendor/github.com/pjbgf/sha1cd/Dockerfile.arm b/vendor/github.com/pjbgf/sha1cd/Dockerfile.arm index 4230fba01..1fe43ec4a 100644 --- a/vendor/github.com/pjbgf/sha1cd/Dockerfile.arm +++ b/vendor/github.com/pjbgf/sha1cd/Dockerfile.arm @@ -1,4 +1,4 @@ -FROM golang:1.23@sha256:51a6466e8dbf3e00e422eb0f7a97ac450b2d57b33617bbe8d2ee0bddcd9d0d37 +FROM golang:1.25@sha256:31c1e53dfc1cc2d269deec9c83f58729fa3c53dc9a576f6426109d1e319e9e9a ENV GOOS=linux ENV GOARCH=arm diff --git a/vendor/github.com/pjbgf/sha1cd/Dockerfile.arm64 b/vendor/github.com/pjbgf/sha1cd/Dockerfile.arm64 index 59928252a..af7f2e21b 100644 --- a/vendor/github.com/pjbgf/sha1cd/Dockerfile.arm64 +++ b/vendor/github.com/pjbgf/sha1cd/Dockerfile.arm64 @@ -1,4 +1,4 @@ -FROM golang:1.23@sha256:51a6466e8dbf3e00e422eb0f7a97ac450b2d57b33617bbe8d2ee0bddcd9d0d37 +FROM golang:1.25@sha256:31c1e53dfc1cc2d269deec9c83f58729fa3c53dc9a576f6426109d1e319e9e9a ENV GOOS=linux ENV GOARCH=arm64 diff --git a/vendor/github.com/pjbgf/sha1cd/Makefile b/vendor/github.com/pjbgf/sha1cd/Makefile index 278a109d8..e746d62a1 100644 --- a/vendor/github.com/pjbgf/sha1cd/Makefile +++ b/vendor/github.com/pjbgf/sha1cd/Makefile @@ -4,7 +4,7 @@ export CGO_ENABLED := 1 .PHONY: test test: - go test ./... + go test -race -timeout 15s ./... .PHONY: bench bench: @@ -31,9 +31,6 @@ build-nocgo: # Run cross-compilation to assure supported architectures. cross-build: build-arm build-arm64 build-nocgo -generate: - go generate -x ./... - -verify: generate +verify: git diff --exit-code go vet ./... diff --git a/vendor/github.com/pjbgf/sha1cd/README.md b/vendor/github.com/pjbgf/sha1cd/README.md index 378cf78cf..f3ae73290 100644 --- a/vendor/github.com/pjbgf/sha1cd/README.md +++ b/vendor/github.com/pjbgf/sha1cd/README.md @@ -6,8 +6,7 @@ collision attacks. The `cgo/lib` code is a carbon copy of the [original code], based on the award winning [white paper] by Marc Stevens. -The Go implementation is largely based off Go's generic sha1. -At present no SIMD optimisations have been implemented. +The Go and native implementations are largely based off upstream Go. ## Usage diff --git a/vendor/github.com/pjbgf/sha1cd/sha1cd.go b/vendor/github.com/pjbgf/sha1cd/sha1cd.go index 509569f66..865a995ca 100644 --- a/vendor/github.com/pjbgf/sha1cd/sha1cd.go +++ b/vendor/github.com/pjbgf/sha1cd/sha1cd.go @@ -12,7 +12,6 @@ package sha1cd // Original: https://github.com/golang/go/blob/master/src/crypto/sha1/sha1.go import ( - "crypto" "encoding/binary" "errors" "hash" @@ -20,12 +19,6 @@ import ( shared "github.com/pjbgf/sha1cd/internal" ) -//go:generate go run -C asm . -out ../sha1cdblock_amd64.s -pkg $GOPACKAGE - -func init() { - crypto.RegisterHash(crypto.SHA1, New) -} - // The size of a SHA-1 checksum in bytes. const Size = shared.Size @@ -40,8 +33,7 @@ type digest struct { len uint64 // col defines whether a collision has been found. - col bool - blockFunc func(dig *digest, p []byte) + col bool } func (d *digest) MarshalBinary() ([]byte, error) { @@ -101,7 +93,7 @@ func (d *digest) UnmarshalBinary(b []byte) error { func consumeUint64(b []byte) ([]byte, uint64) { _ = b[7] - x := uint64(b[7]) | uint64(b[6])<<8 | uint64(b[shared.WordBuffers])<<16 | uint64(b[4])<<24 | + x := uint64(b[7]) | uint64(b[6])<<8 | uint64(b[5])<<16 | uint64(b[4])<<24 | uint64(b[3])<<32 | uint64(b[2])<<40 | uint64(b[1])<<48 | uint64(b[0])<<56 return b[8:], x } @@ -128,21 +120,9 @@ func (d *digest) Reset() { // implements encoding.BinaryMarshaler and encoding.BinaryUnmarshaler to // marshal and unmarshal the internal state of the hash. func New() hash.Hash { - d := new(digest) - - d.blockFunc = block + var d digest d.Reset() - return d -} - -// NewGeneric is equivalent to New but uses the Go generic implementation, -// avoiding any processor-specific optimizations. -func NewGeneric() hash.Hash { - d := new(digest) - - d.blockFunc = blockGeneric - d.Reset() - return d + return &d } func (d *digest) Size() int { return Size } @@ -160,14 +140,14 @@ func (d *digest) Write(p []byte) (nn int, err error) { n := copy(d.x[d.nx:], p) d.nx += n if d.nx == shared.Chunk { - d.blockFunc(d, d.x[:]) + block(d, d.x[:]) d.nx = 0 } p = p[n:] } if len(p) >= shared.Chunk { n := len(p) &^ (shared.Chunk - 1) - d.blockFunc(d, p[:n]) + block(d, p[:n]) p = p[n:] } if len(p) > 0 { @@ -186,18 +166,20 @@ func (d *digest) Sum(in []byte) []byte { func (d *digest) checkSum() [Size]byte { len := d.len // Padding. Add a 1 bit and 0 bits until 56 bytes mod 64. - var tmp [64]byte + var tmp [64 + 8]byte tmp[0] = 0x80 + var t uint64 if len%64 < 56 { - d.Write(tmp[0 : 56-len%64]) + t = 56 - len%64 } else { - d.Write(tmp[0 : 64+56-len%64]) + t = 64 + 56 - len%64 } // Length in bits. len <<= 3 - binary.BigEndian.PutUint64(tmp[:], len) - d.Write(tmp[0:8]) + padlen := tmp[:t+8] + binary.BigEndian.PutUint64(tmp[t:], len) + d.Write(padlen) if d.nx != 0 { panic("d.nx != 0") @@ -216,7 +198,8 @@ func (d *digest) checkSum() [Size]byte { // Sum returns the SHA-1 checksum of the data. func Sum(data []byte) ([Size]byte, bool) { - d := New().(*digest) + var d digest + d.Reset() d.Write(data) return d.checkSum(), d.col } diff --git a/vendor/github.com/pjbgf/sha1cd/sha1cdblock_amd64.go b/vendor/github.com/pjbgf/sha1cd/sha1cdblock_amd64.go index 95e083084..6b716abd6 100644 --- a/vendor/github.com/pjbgf/sha1cd/sha1cdblock_amd64.go +++ b/vendor/github.com/pjbgf/sha1cd/sha1cdblock_amd64.go @@ -1,48 +1,50 @@ -//go:build !noasm && gc && amd64 -// +build !noasm,gc,amd64 +//go:build !noasm && gc && amd64 && !arm64 +// +build !noasm,gc,amd64,!arm64 package sha1cd import ( - "math" - "unsafe" + "runtime" + "github.com/klauspost/cpuid/v2" shared "github.com/pjbgf/sha1cd/internal" ) -type sliceHeader struct { - base uintptr - len int - cap int -} +var hasSHANI = (runtime.GOARCH == "amd64" && + cpuid.CPU.Supports(cpuid.AVX) && + cpuid.CPU.Supports(cpuid.SHA) && + cpuid.CPU.Supports(cpuid.SSE3) && + cpuid.CPU.Supports(cpuid.SSE4)) -// blockAMD64 hashes the message p into the current state in dig. +// blockAMD64 hashes the message p into the current state in h. // Both m1 and cs are used to store intermediate results which are used by the collision detection logic. // //go:noescape -func blockAMD64(dig *digest, p sliceHeader, m1 []uint32, cs [][5]uint32) +func blockAMD64(h []uint32, p []byte, m1 []uint32, cs [][5]uint32) func block(dig *digest, p []byte) { + if forceGeneric || !hasSHANI { + blockGeneric(dig, p) + return + } + m1 := [shared.Rounds]uint32{} cs := [shared.PreStepState][shared.WordBuffers]uint32{} for len(p) >= shared.Chunk { - // Only send a block to be processed, as the collission detection - // works on a block by block basis. - ips := sliceHeader{ - base: uintptr(unsafe.Pointer(&p[0])), - len: int(math.Min(float64(len(p)), float64(shared.Chunk))), - cap: shared.Chunk, - } + // The assembly code only supports processing a block at a time, + // so adjust the chunk accordingly. + chunk := p[:shared.Chunk] - blockAMD64(dig, ips, m1[:], cs[:]) + blockAMD64(dig.h[:], chunk, m1[:], cs[:]) + rectifyCompressionState(&m1, &cs) - col := checkCollision(m1, cs, dig.h) + col := checkCollision(&m1, &cs, &dig.h) if col { dig.col = true - blockAMD64(dig, ips, m1[:], cs[:]) - blockAMD64(dig, ips, m1[:], cs[:]) + blockAMD64(dig.h[:], chunk, m1[:], cs[:]) + blockAMD64(dig.h[:], chunk, m1[:], cs[:]) } p = p[shared.Chunk:] diff --git a/vendor/github.com/pjbgf/sha1cd/sha1cdblock_amd64.s b/vendor/github.com/pjbgf/sha1cd/sha1cdblock_amd64.s index e5e213a52..061906a95 100644 --- a/vendor/github.com/pjbgf/sha1cd/sha1cdblock_amd64.s +++ b/vendor/github.com/pjbgf/sha1cd/sha1cdblock_amd64.s @@ -1,2273 +1,274 @@ -// Code generated by command: go run asm.go -out ../sha1cdblock_amd64.s -pkg sha1cd. DO NOT EDIT. - -//go:build !noasm && gc && amd64 +//go:build !noasm && gc && amd64 && !arm64 #include "textflag.h" -// func blockAMD64(dig *digest, p []byte, m1 []uint32, cs [][5]uint32) -TEXT ·blockAMD64(SB), NOSPLIT, $64-80 - MOVQ dig+0(FP), R8 - MOVQ p_base+8(FP), DI - MOVQ p_len+16(FP), DX - SHRQ $+6, DX - SHLQ $+6, DX - LEAQ (DI)(DX*1), SI +// License information for the original SHA1 arm64 implemention: +// Copyright 2024 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found at: +// - https://github.com/golang/go/blob/master/LICENSE +// +// Reference implementations: +// - https://github.com/golang/go/blob/master/src/crypto/sha1/sha1block_amd64.s - // Load h0, h1, h2, h3, h4. - MOVL (R8), AX - MOVL 4(R8), BX - MOVL 8(R8), CX - MOVL 12(R8), DX - MOVL 16(R8), BP +// Reverse the dword order in abcd via PSHUFD then store the 16 bytes in one +// move, instead of issuing four VPEXTRD's that each go through the store port. +#define LOADCS(abcd, e, index, target) \ + VPSHUFD $0x1B, abcd, X8; \ + VMOVDQU X8, ((index*20)+0)(target); \ + MOVL e, ((index*20)+16)(target); - // len(p) >= chunk - CMPQ DI, SI - JEQ end +#define LOADM1(m1, index, target) \ + VPSHUFD $0x1B, m1, X8; \ + VMOVDQU X8, ((index*16)+0)(target); + +// func blockAMD64(h []uint32, p []byte, m1 []uint32, cs [][5]uint32) +// Requires: AVX, SHA, SSE2, SSE4.1, SSSE3 +TEXT ·blockAMD64(SB), NOSPLIT, $80-96 + MOVQ h_base+0(FP), DI + MOVQ p_base+24(FP), SI + MOVQ p_len+32(FP), DX + MOVQ m1_base+48(FP), R13 + MOVQ cs_base+72(FP), R15 + CMPQ DX, $0x00 + JEQ done + ADDQ SI, DX + + // Allocate space on the stack for saving ABCD and E0, and align it to 16 bytes + LEAQ 15(SP), AX + MOVQ $0x000000000000000f, CX + NOTQ CX + ANDQ CX, AX + + // Load initial hash state + PINSRD $0x03, 16(DI), X5 + VMOVDQU (DI), X0 + PAND upper_mask<>+0(SB), X5 + PSHUFD $0x1b, X0, X0 + VMOVDQA shuffle_mask<>+0(SB), X7 loop: - // Initialize registers a, b, c, d, e. - MOVL AX, R10 - MOVL BX, R11 - MOVL CX, R12 - MOVL DX, R13 - MOVL BP, R14 - - // ROUND1 (steps 0-15) - // Load cs - MOVQ cs_base+56(FP), R8 - MOVL R10, (R8) - MOVL R11, 4(R8) - MOVL R12, 8(R8) - MOVL R13, 12(R8) - MOVL R14, 16(R8) - - // ROUND1(0) - // LOAD - MOVL (DI), R9 - BSWAPL R9 - MOVL R9, (SP) - - // FUNC1 - MOVL R13, R15 - XORL R12, R15 - ANDL R11, R15 - XORL R13, R15 - - // MIX - ROLL $+30, R11 - ADDL R15, R14 - MOVL R10, R8 - ROLL $+5, R8 - LEAL 1518500249(R14)(R9*1), R14 - ADDL R8, R14 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL (SP), R9 - MOVL R9, (R8) - - // ROUND1(1) - // LOAD - MOVL 4(DI), R9 - BSWAPL R9 - MOVL R9, 4(SP) - - // FUNC1 - MOVL R12, R15 - XORL R11, R15 - ANDL R10, R15 - XORL R12, R15 - - // MIX - ROLL $+30, R10 - ADDL R15, R13 - MOVL R14, R8 - ROLL $+5, R8 - LEAL 1518500249(R13)(R9*1), R13 - ADDL R8, R13 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 4(SP), R9 - MOVL R9, 4(R8) - - // ROUND1(2) - // LOAD - MOVL 8(DI), R9 - BSWAPL R9 - MOVL R9, 8(SP) - - // FUNC1 - MOVL R11, R15 - XORL R10, R15 - ANDL R14, R15 - XORL R11, R15 - - // MIX - ROLL $+30, R14 - ADDL R15, R12 - MOVL R13, R8 - ROLL $+5, R8 - LEAL 1518500249(R12)(R9*1), R12 - ADDL R8, R12 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 8(SP), R9 - MOVL R9, 8(R8) - - // ROUND1(3) - // LOAD - MOVL 12(DI), R9 - BSWAPL R9 - MOVL R9, 12(SP) - - // FUNC1 - MOVL R10, R15 - XORL R14, R15 - ANDL R13, R15 - XORL R10, R15 - - // MIX - ROLL $+30, R13 - ADDL R15, R11 - MOVL R12, R8 - ROLL $+5, R8 - LEAL 1518500249(R11)(R9*1), R11 - ADDL R8, R11 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 12(SP), R9 - MOVL R9, 12(R8) - - // ROUND1(4) - // LOAD - MOVL 16(DI), R9 - BSWAPL R9 - MOVL R9, 16(SP) - - // FUNC1 - MOVL R14, R15 - XORL R13, R15 - ANDL R12, R15 - XORL R14, R15 - - // MIX - ROLL $+30, R12 - ADDL R15, R10 - MOVL R11, R8 - ROLL $+5, R8 - LEAL 1518500249(R10)(R9*1), R10 - ADDL R8, R10 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 16(SP), R9 - MOVL R9, 16(R8) - - // ROUND1(5) - // LOAD - MOVL 20(DI), R9 - BSWAPL R9 - MOVL R9, 20(SP) - - // FUNC1 - MOVL R13, R15 - XORL R12, R15 - ANDL R11, R15 - XORL R13, R15 - - // MIX - ROLL $+30, R11 - ADDL R15, R14 - MOVL R10, R8 - ROLL $+5, R8 - LEAL 1518500249(R14)(R9*1), R14 - ADDL R8, R14 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 20(SP), R9 - MOVL R9, 20(R8) - - // ROUND1(6) - // LOAD - MOVL 24(DI), R9 - BSWAPL R9 - MOVL R9, 24(SP) - - // FUNC1 - MOVL R12, R15 - XORL R11, R15 - ANDL R10, R15 - XORL R12, R15 - - // MIX - ROLL $+30, R10 - ADDL R15, R13 - MOVL R14, R8 - ROLL $+5, R8 - LEAL 1518500249(R13)(R9*1), R13 - ADDL R8, R13 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 24(SP), R9 - MOVL R9, 24(R8) - - // ROUND1(7) - // LOAD - MOVL 28(DI), R9 - BSWAPL R9 - MOVL R9, 28(SP) - - // FUNC1 - MOVL R11, R15 - XORL R10, R15 - ANDL R14, R15 - XORL R11, R15 - - // MIX - ROLL $+30, R14 - ADDL R15, R12 - MOVL R13, R8 - ROLL $+5, R8 - LEAL 1518500249(R12)(R9*1), R12 - ADDL R8, R12 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 28(SP), R9 - MOVL R9, 28(R8) - - // ROUND1(8) - // LOAD - MOVL 32(DI), R9 - BSWAPL R9 - MOVL R9, 32(SP) - - // FUNC1 - MOVL R10, R15 - XORL R14, R15 - ANDL R13, R15 - XORL R10, R15 - - // MIX - ROLL $+30, R13 - ADDL R15, R11 - MOVL R12, R8 - ROLL $+5, R8 - LEAL 1518500249(R11)(R9*1), R11 - ADDL R8, R11 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 32(SP), R9 - MOVL R9, 32(R8) - - // ROUND1(9) - // LOAD - MOVL 36(DI), R9 - BSWAPL R9 - MOVL R9, 36(SP) - - // FUNC1 - MOVL R14, R15 - XORL R13, R15 - ANDL R12, R15 - XORL R14, R15 - - // MIX - ROLL $+30, R12 - ADDL R15, R10 - MOVL R11, R8 - ROLL $+5, R8 - LEAL 1518500249(R10)(R9*1), R10 - ADDL R8, R10 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 36(SP), R9 - MOVL R9, 36(R8) - - // ROUND1(10) - // LOAD - MOVL 40(DI), R9 - BSWAPL R9 - MOVL R9, 40(SP) - - // FUNC1 - MOVL R13, R15 - XORL R12, R15 - ANDL R11, R15 - XORL R13, R15 - - // MIX - ROLL $+30, R11 - ADDL R15, R14 - MOVL R10, R8 - ROLL $+5, R8 - LEAL 1518500249(R14)(R9*1), R14 - ADDL R8, R14 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 40(SP), R9 - MOVL R9, 40(R8) - - // ROUND1(11) - // LOAD - MOVL 44(DI), R9 - BSWAPL R9 - MOVL R9, 44(SP) - - // FUNC1 - MOVL R12, R15 - XORL R11, R15 - ANDL R10, R15 - XORL R12, R15 - - // MIX - ROLL $+30, R10 - ADDL R15, R13 - MOVL R14, R8 - ROLL $+5, R8 - LEAL 1518500249(R13)(R9*1), R13 - ADDL R8, R13 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 44(SP), R9 - MOVL R9, 44(R8) - - // ROUND1(12) - // LOAD - MOVL 48(DI), R9 - BSWAPL R9 - MOVL R9, 48(SP) - - // FUNC1 - MOVL R11, R15 - XORL R10, R15 - ANDL R14, R15 - XORL R11, R15 - - // MIX - ROLL $+30, R14 - ADDL R15, R12 - MOVL R13, R8 - ROLL $+5, R8 - LEAL 1518500249(R12)(R9*1), R12 - ADDL R8, R12 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 48(SP), R9 - MOVL R9, 48(R8) - - // ROUND1(13) - // LOAD - MOVL 52(DI), R9 - BSWAPL R9 - MOVL R9, 52(SP) - - // FUNC1 - MOVL R10, R15 - XORL R14, R15 - ANDL R13, R15 - XORL R10, R15 - - // MIX - ROLL $+30, R13 - ADDL R15, R11 - MOVL R12, R8 - ROLL $+5, R8 - LEAL 1518500249(R11)(R9*1), R11 - ADDL R8, R11 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 52(SP), R9 - MOVL R9, 52(R8) - - // ROUND1(14) - // LOAD - MOVL 56(DI), R9 - BSWAPL R9 - MOVL R9, 56(SP) - - // FUNC1 - MOVL R14, R15 - XORL R13, R15 - ANDL R12, R15 - XORL R14, R15 - - // MIX - ROLL $+30, R12 - ADDL R15, R10 - MOVL R11, R8 - ROLL $+5, R8 - LEAL 1518500249(R10)(R9*1), R10 - ADDL R8, R10 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 56(SP), R9 - MOVL R9, 56(R8) - - // ROUND1(15) - // LOAD - MOVL 60(DI), R9 - BSWAPL R9 - MOVL R9, 60(SP) - - // FUNC1 - MOVL R13, R15 - XORL R12, R15 - ANDL R11, R15 - XORL R13, R15 - - // MIX - ROLL $+30, R11 - ADDL R15, R14 - MOVL R10, R8 - ROLL $+5, R8 - LEAL 1518500249(R14)(R9*1), R14 - ADDL R8, R14 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 60(SP), R9 - MOVL R9, 60(R8) - - // ROUND1x (steps 16-19) - same as ROUND1 but with no data load. - // ROUND1x(16) - // SHUFFLE - MOVL (SP), R9 - XORL 52(SP), R9 - XORL 32(SP), R9 - XORL 8(SP), R9 - ROLL $+1, R9 - MOVL R9, (SP) - - // FUNC1 - MOVL R12, R15 - XORL R11, R15 - ANDL R10, R15 - XORL R12, R15 - - // MIX - ROLL $+30, R10 - ADDL R15, R13 - MOVL R14, R8 - ROLL $+5, R8 - LEAL 1518500249(R13)(R9*1), R13 - ADDL R8, R13 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL (SP), R9 - MOVL R9, 64(R8) - - // ROUND1x(17) - // SHUFFLE - MOVL 4(SP), R9 - XORL 56(SP), R9 - XORL 36(SP), R9 - XORL 12(SP), R9 - ROLL $+1, R9 - MOVL R9, 4(SP) - - // FUNC1 - MOVL R11, R15 - XORL R10, R15 - ANDL R14, R15 - XORL R11, R15 - - // MIX - ROLL $+30, R14 - ADDL R15, R12 - MOVL R13, R8 - ROLL $+5, R8 - LEAL 1518500249(R12)(R9*1), R12 - ADDL R8, R12 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 4(SP), R9 - MOVL R9, 68(R8) - - // ROUND1x(18) - // SHUFFLE - MOVL 8(SP), R9 - XORL 60(SP), R9 - XORL 40(SP), R9 - XORL 16(SP), R9 - ROLL $+1, R9 - MOVL R9, 8(SP) - - // FUNC1 - MOVL R10, R15 - XORL R14, R15 - ANDL R13, R15 - XORL R10, R15 - - // MIX - ROLL $+30, R13 - ADDL R15, R11 - MOVL R12, R8 - ROLL $+5, R8 - LEAL 1518500249(R11)(R9*1), R11 - ADDL R8, R11 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 8(SP), R9 - MOVL R9, 72(R8) - - // ROUND1x(19) - // SHUFFLE - MOVL 12(SP), R9 - XORL (SP), R9 - XORL 44(SP), R9 - XORL 20(SP), R9 - ROLL $+1, R9 - MOVL R9, 12(SP) - - // FUNC1 - MOVL R14, R15 - XORL R13, R15 - ANDL R12, R15 - XORL R14, R15 - - // MIX - ROLL $+30, R12 - ADDL R15, R10 - MOVL R11, R8 - ROLL $+5, R8 - LEAL 1518500249(R10)(R9*1), R10 - ADDL R8, R10 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 12(SP), R9 - MOVL R9, 76(R8) - - // ROUND2 (steps 20-39) - // ROUND2(20) - // SHUFFLE - MOVL 16(SP), R9 - XORL 4(SP), R9 - XORL 48(SP), R9 - XORL 24(SP), R9 - ROLL $+1, R9 - MOVL R9, 16(SP) - - // FUNC2 - MOVL R11, R15 - XORL R12, R15 - XORL R13, R15 - - // MIX - ROLL $+30, R11 - ADDL R15, R14 - MOVL R10, R8 - ROLL $+5, R8 - LEAL 1859775393(R14)(R9*1), R14 - ADDL R8, R14 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 16(SP), R9 - MOVL R9, 80(R8) - - // ROUND2(21) - // SHUFFLE - MOVL 20(SP), R9 - XORL 8(SP), R9 - XORL 52(SP), R9 - XORL 28(SP), R9 - ROLL $+1, R9 - MOVL R9, 20(SP) - - // FUNC2 - MOVL R10, R15 - XORL R11, R15 - XORL R12, R15 - - // MIX - ROLL $+30, R10 - ADDL R15, R13 - MOVL R14, R8 - ROLL $+5, R8 - LEAL 1859775393(R13)(R9*1), R13 - ADDL R8, R13 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 20(SP), R9 - MOVL R9, 84(R8) - - // ROUND2(22) - // SHUFFLE - MOVL 24(SP), R9 - XORL 12(SP), R9 - XORL 56(SP), R9 - XORL 32(SP), R9 - ROLL $+1, R9 - MOVL R9, 24(SP) - - // FUNC2 - MOVL R14, R15 - XORL R10, R15 - XORL R11, R15 - - // MIX - ROLL $+30, R14 - ADDL R15, R12 - MOVL R13, R8 - ROLL $+5, R8 - LEAL 1859775393(R12)(R9*1), R12 - ADDL R8, R12 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 24(SP), R9 - MOVL R9, 88(R8) - - // ROUND2(23) - // SHUFFLE - MOVL 28(SP), R9 - XORL 16(SP), R9 - XORL 60(SP), R9 - XORL 36(SP), R9 - ROLL $+1, R9 - MOVL R9, 28(SP) - - // FUNC2 - MOVL R13, R15 - XORL R14, R15 - XORL R10, R15 - - // MIX - ROLL $+30, R13 - ADDL R15, R11 - MOVL R12, R8 - ROLL $+5, R8 - LEAL 1859775393(R11)(R9*1), R11 - ADDL R8, R11 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 28(SP), R9 - MOVL R9, 92(R8) - - // ROUND2(24) - // SHUFFLE - MOVL 32(SP), R9 - XORL 20(SP), R9 - XORL (SP), R9 - XORL 40(SP), R9 - ROLL $+1, R9 - MOVL R9, 32(SP) - - // FUNC2 - MOVL R12, R15 - XORL R13, R15 - XORL R14, R15 - - // MIX - ROLL $+30, R12 - ADDL R15, R10 - MOVL R11, R8 - ROLL $+5, R8 - LEAL 1859775393(R10)(R9*1), R10 - ADDL R8, R10 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 32(SP), R9 - MOVL R9, 96(R8) - - // ROUND2(25) - // SHUFFLE - MOVL 36(SP), R9 - XORL 24(SP), R9 - XORL 4(SP), R9 - XORL 44(SP), R9 - ROLL $+1, R9 - MOVL R9, 36(SP) - - // FUNC2 - MOVL R11, R15 - XORL R12, R15 - XORL R13, R15 - - // MIX - ROLL $+30, R11 - ADDL R15, R14 - MOVL R10, R8 - ROLL $+5, R8 - LEAL 1859775393(R14)(R9*1), R14 - ADDL R8, R14 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 36(SP), R9 - MOVL R9, 100(R8) - - // ROUND2(26) - // SHUFFLE - MOVL 40(SP), R9 - XORL 28(SP), R9 - XORL 8(SP), R9 - XORL 48(SP), R9 - ROLL $+1, R9 - MOVL R9, 40(SP) - - // FUNC2 - MOVL R10, R15 - XORL R11, R15 - XORL R12, R15 - - // MIX - ROLL $+30, R10 - ADDL R15, R13 - MOVL R14, R8 - ROLL $+5, R8 - LEAL 1859775393(R13)(R9*1), R13 - ADDL R8, R13 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 40(SP), R9 - MOVL R9, 104(R8) - - // ROUND2(27) - // SHUFFLE - MOVL 44(SP), R9 - XORL 32(SP), R9 - XORL 12(SP), R9 - XORL 52(SP), R9 - ROLL $+1, R9 - MOVL R9, 44(SP) - - // FUNC2 - MOVL R14, R15 - XORL R10, R15 - XORL R11, R15 - - // MIX - ROLL $+30, R14 - ADDL R15, R12 - MOVL R13, R8 - ROLL $+5, R8 - LEAL 1859775393(R12)(R9*1), R12 - ADDL R8, R12 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 44(SP), R9 - MOVL R9, 108(R8) - - // ROUND2(28) - // SHUFFLE - MOVL 48(SP), R9 - XORL 36(SP), R9 - XORL 16(SP), R9 - XORL 56(SP), R9 - ROLL $+1, R9 - MOVL R9, 48(SP) - - // FUNC2 - MOVL R13, R15 - XORL R14, R15 - XORL R10, R15 - - // MIX - ROLL $+30, R13 - ADDL R15, R11 - MOVL R12, R8 - ROLL $+5, R8 - LEAL 1859775393(R11)(R9*1), R11 - ADDL R8, R11 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 48(SP), R9 - MOVL R9, 112(R8) - - // ROUND2(29) - // SHUFFLE - MOVL 52(SP), R9 - XORL 40(SP), R9 - XORL 20(SP), R9 - XORL 60(SP), R9 - ROLL $+1, R9 - MOVL R9, 52(SP) - - // FUNC2 - MOVL R12, R15 - XORL R13, R15 - XORL R14, R15 - - // MIX - ROLL $+30, R12 - ADDL R15, R10 - MOVL R11, R8 - ROLL $+5, R8 - LEAL 1859775393(R10)(R9*1), R10 - ADDL R8, R10 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 52(SP), R9 - MOVL R9, 116(R8) - - // ROUND2(30) - // SHUFFLE - MOVL 56(SP), R9 - XORL 44(SP), R9 - XORL 24(SP), R9 - XORL (SP), R9 - ROLL $+1, R9 - MOVL R9, 56(SP) - - // FUNC2 - MOVL R11, R15 - XORL R12, R15 - XORL R13, R15 - - // MIX - ROLL $+30, R11 - ADDL R15, R14 - MOVL R10, R8 - ROLL $+5, R8 - LEAL 1859775393(R14)(R9*1), R14 - ADDL R8, R14 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 56(SP), R9 - MOVL R9, 120(R8) - - // ROUND2(31) - // SHUFFLE - MOVL 60(SP), R9 - XORL 48(SP), R9 - XORL 28(SP), R9 - XORL 4(SP), R9 - ROLL $+1, R9 - MOVL R9, 60(SP) - - // FUNC2 - MOVL R10, R15 - XORL R11, R15 - XORL R12, R15 - - // MIX - ROLL $+30, R10 - ADDL R15, R13 - MOVL R14, R8 - ROLL $+5, R8 - LEAL 1859775393(R13)(R9*1), R13 - ADDL R8, R13 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 60(SP), R9 - MOVL R9, 124(R8) - - // ROUND2(32) - // SHUFFLE - MOVL (SP), R9 - XORL 52(SP), R9 - XORL 32(SP), R9 - XORL 8(SP), R9 - ROLL $+1, R9 - MOVL R9, (SP) - - // FUNC2 - MOVL R14, R15 - XORL R10, R15 - XORL R11, R15 - - // MIX - ROLL $+30, R14 - ADDL R15, R12 - MOVL R13, R8 - ROLL $+5, R8 - LEAL 1859775393(R12)(R9*1), R12 - ADDL R8, R12 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL (SP), R9 - MOVL R9, 128(R8) - - // ROUND2(33) - // SHUFFLE - MOVL 4(SP), R9 - XORL 56(SP), R9 - XORL 36(SP), R9 - XORL 12(SP), R9 - ROLL $+1, R9 - MOVL R9, 4(SP) - - // FUNC2 - MOVL R13, R15 - XORL R14, R15 - XORL R10, R15 - - // MIX - ROLL $+30, R13 - ADDL R15, R11 - MOVL R12, R8 - ROLL $+5, R8 - LEAL 1859775393(R11)(R9*1), R11 - ADDL R8, R11 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 4(SP), R9 - MOVL R9, 132(R8) - - // ROUND2(34) - // SHUFFLE - MOVL 8(SP), R9 - XORL 60(SP), R9 - XORL 40(SP), R9 - XORL 16(SP), R9 - ROLL $+1, R9 - MOVL R9, 8(SP) - - // FUNC2 - MOVL R12, R15 - XORL R13, R15 - XORL R14, R15 - - // MIX - ROLL $+30, R12 - ADDL R15, R10 - MOVL R11, R8 - ROLL $+5, R8 - LEAL 1859775393(R10)(R9*1), R10 - ADDL R8, R10 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 8(SP), R9 - MOVL R9, 136(R8) - - // ROUND2(35) - // SHUFFLE - MOVL 12(SP), R9 - XORL (SP), R9 - XORL 44(SP), R9 - XORL 20(SP), R9 - ROLL $+1, R9 - MOVL R9, 12(SP) - - // FUNC2 - MOVL R11, R15 - XORL R12, R15 - XORL R13, R15 - - // MIX - ROLL $+30, R11 - ADDL R15, R14 - MOVL R10, R8 - ROLL $+5, R8 - LEAL 1859775393(R14)(R9*1), R14 - ADDL R8, R14 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 12(SP), R9 - MOVL R9, 140(R8) - - // ROUND2(36) - // SHUFFLE - MOVL 16(SP), R9 - XORL 4(SP), R9 - XORL 48(SP), R9 - XORL 24(SP), R9 - ROLL $+1, R9 - MOVL R9, 16(SP) - - // FUNC2 - MOVL R10, R15 - XORL R11, R15 - XORL R12, R15 - - // MIX - ROLL $+30, R10 - ADDL R15, R13 - MOVL R14, R8 - ROLL $+5, R8 - LEAL 1859775393(R13)(R9*1), R13 - ADDL R8, R13 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 16(SP), R9 - MOVL R9, 144(R8) - - // ROUND2(37) - // SHUFFLE - MOVL 20(SP), R9 - XORL 8(SP), R9 - XORL 52(SP), R9 - XORL 28(SP), R9 - ROLL $+1, R9 - MOVL R9, 20(SP) - - // FUNC2 - MOVL R14, R15 - XORL R10, R15 - XORL R11, R15 - - // MIX - ROLL $+30, R14 - ADDL R15, R12 - MOVL R13, R8 - ROLL $+5, R8 - LEAL 1859775393(R12)(R9*1), R12 - ADDL R8, R12 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 20(SP), R9 - MOVL R9, 148(R8) - - // ROUND2(38) - // SHUFFLE - MOVL 24(SP), R9 - XORL 12(SP), R9 - XORL 56(SP), R9 - XORL 32(SP), R9 - ROLL $+1, R9 - MOVL R9, 24(SP) - - // FUNC2 - MOVL R13, R15 - XORL R14, R15 - XORL R10, R15 - - // MIX - ROLL $+30, R13 - ADDL R15, R11 - MOVL R12, R8 - ROLL $+5, R8 - LEAL 1859775393(R11)(R9*1), R11 - ADDL R8, R11 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 24(SP), R9 - MOVL R9, 152(R8) - - // ROUND2(39) - // SHUFFLE - MOVL 28(SP), R9 - XORL 16(SP), R9 - XORL 60(SP), R9 - XORL 36(SP), R9 - ROLL $+1, R9 - MOVL R9, 28(SP) - - // FUNC2 - MOVL R12, R15 - XORL R13, R15 - XORL R14, R15 - - // MIX - ROLL $+30, R12 - ADDL R15, R10 - MOVL R11, R8 - ROLL $+5, R8 - LEAL 1859775393(R10)(R9*1), R10 - ADDL R8, R10 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 28(SP), R9 - MOVL R9, 156(R8) - - // ROUND3 (steps 40-59) - // ROUND3(40) - // SHUFFLE - MOVL 32(SP), R9 - XORL 20(SP), R9 - XORL (SP), R9 - XORL 40(SP), R9 - ROLL $+1, R9 - MOVL R9, 32(SP) - - // FUNC3 - MOVL R11, R8 - ORL R12, R8 - ANDL R13, R8 - MOVL R11, R15 - ANDL R12, R15 - ORL R8, R15 - - // MIX - ROLL $+30, R11 - ADDL R15, R14 - MOVL R10, R8 - ROLL $+5, R8 - LEAL 2400959708(R14)(R9*1), R14 - ADDL R8, R14 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 32(SP), R9 - MOVL R9, 160(R8) - - // ROUND3(41) - // SHUFFLE - MOVL 36(SP), R9 - XORL 24(SP), R9 - XORL 4(SP), R9 - XORL 44(SP), R9 - ROLL $+1, R9 - MOVL R9, 36(SP) - - // FUNC3 - MOVL R10, R8 - ORL R11, R8 - ANDL R12, R8 - MOVL R10, R15 - ANDL R11, R15 - ORL R8, R15 - - // MIX - ROLL $+30, R10 - ADDL R15, R13 - MOVL R14, R8 - ROLL $+5, R8 - LEAL 2400959708(R13)(R9*1), R13 - ADDL R8, R13 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 36(SP), R9 - MOVL R9, 164(R8) - - // ROUND3(42) - // SHUFFLE - MOVL 40(SP), R9 - XORL 28(SP), R9 - XORL 8(SP), R9 - XORL 48(SP), R9 - ROLL $+1, R9 - MOVL R9, 40(SP) - - // FUNC3 - MOVL R14, R8 - ORL R10, R8 - ANDL R11, R8 - MOVL R14, R15 - ANDL R10, R15 - ORL R8, R15 - - // MIX - ROLL $+30, R14 - ADDL R15, R12 - MOVL R13, R8 - ROLL $+5, R8 - LEAL 2400959708(R12)(R9*1), R12 - ADDL R8, R12 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 40(SP), R9 - MOVL R9, 168(R8) - - // ROUND3(43) - // SHUFFLE - MOVL 44(SP), R9 - XORL 32(SP), R9 - XORL 12(SP), R9 - XORL 52(SP), R9 - ROLL $+1, R9 - MOVL R9, 44(SP) - - // FUNC3 - MOVL R13, R8 - ORL R14, R8 - ANDL R10, R8 - MOVL R13, R15 - ANDL R14, R15 - ORL R8, R15 - - // MIX - ROLL $+30, R13 - ADDL R15, R11 - MOVL R12, R8 - ROLL $+5, R8 - LEAL 2400959708(R11)(R9*1), R11 - ADDL R8, R11 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 44(SP), R9 - MOVL R9, 172(R8) - - // ROUND3(44) - // SHUFFLE - MOVL 48(SP), R9 - XORL 36(SP), R9 - XORL 16(SP), R9 - XORL 56(SP), R9 - ROLL $+1, R9 - MOVL R9, 48(SP) - - // FUNC3 - MOVL R12, R8 - ORL R13, R8 - ANDL R14, R8 - MOVL R12, R15 - ANDL R13, R15 - ORL R8, R15 - - // MIX - ROLL $+30, R12 - ADDL R15, R10 - MOVL R11, R8 - ROLL $+5, R8 - LEAL 2400959708(R10)(R9*1), R10 - ADDL R8, R10 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 48(SP), R9 - MOVL R9, 176(R8) - - // ROUND3(45) - // SHUFFLE - MOVL 52(SP), R9 - XORL 40(SP), R9 - XORL 20(SP), R9 - XORL 60(SP), R9 - ROLL $+1, R9 - MOVL R9, 52(SP) - - // FUNC3 - MOVL R11, R8 - ORL R12, R8 - ANDL R13, R8 - MOVL R11, R15 - ANDL R12, R15 - ORL R8, R15 - - // MIX - ROLL $+30, R11 - ADDL R15, R14 - MOVL R10, R8 - ROLL $+5, R8 - LEAL 2400959708(R14)(R9*1), R14 - ADDL R8, R14 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 52(SP), R9 - MOVL R9, 180(R8) - - // ROUND3(46) - // SHUFFLE - MOVL 56(SP), R9 - XORL 44(SP), R9 - XORL 24(SP), R9 - XORL (SP), R9 - ROLL $+1, R9 - MOVL R9, 56(SP) - - // FUNC3 - MOVL R10, R8 - ORL R11, R8 - ANDL R12, R8 - MOVL R10, R15 - ANDL R11, R15 - ORL R8, R15 - - // MIX - ROLL $+30, R10 - ADDL R15, R13 - MOVL R14, R8 - ROLL $+5, R8 - LEAL 2400959708(R13)(R9*1), R13 - ADDL R8, R13 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 56(SP), R9 - MOVL R9, 184(R8) - - // ROUND3(47) - // SHUFFLE - MOVL 60(SP), R9 - XORL 48(SP), R9 - XORL 28(SP), R9 - XORL 4(SP), R9 - ROLL $+1, R9 - MOVL R9, 60(SP) - - // FUNC3 - MOVL R14, R8 - ORL R10, R8 - ANDL R11, R8 - MOVL R14, R15 - ANDL R10, R15 - ORL R8, R15 - - // MIX - ROLL $+30, R14 - ADDL R15, R12 - MOVL R13, R8 - ROLL $+5, R8 - LEAL 2400959708(R12)(R9*1), R12 - ADDL R8, R12 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 60(SP), R9 - MOVL R9, 188(R8) - - // ROUND3(48) - // SHUFFLE - MOVL (SP), R9 - XORL 52(SP), R9 - XORL 32(SP), R9 - XORL 8(SP), R9 - ROLL $+1, R9 - MOVL R9, (SP) - - // FUNC3 - MOVL R13, R8 - ORL R14, R8 - ANDL R10, R8 - MOVL R13, R15 - ANDL R14, R15 - ORL R8, R15 - - // MIX - ROLL $+30, R13 - ADDL R15, R11 - MOVL R12, R8 - ROLL $+5, R8 - LEAL 2400959708(R11)(R9*1), R11 - ADDL R8, R11 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL (SP), R9 - MOVL R9, 192(R8) - - // ROUND3(49) - // SHUFFLE - MOVL 4(SP), R9 - XORL 56(SP), R9 - XORL 36(SP), R9 - XORL 12(SP), R9 - ROLL $+1, R9 - MOVL R9, 4(SP) - - // FUNC3 - MOVL R12, R8 - ORL R13, R8 - ANDL R14, R8 - MOVL R12, R15 - ANDL R13, R15 - ORL R8, R15 - - // MIX - ROLL $+30, R12 - ADDL R15, R10 - MOVL R11, R8 - ROLL $+5, R8 - LEAL 2400959708(R10)(R9*1), R10 - ADDL R8, R10 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 4(SP), R9 - MOVL R9, 196(R8) - - // ROUND3(50) - // SHUFFLE - MOVL 8(SP), R9 - XORL 60(SP), R9 - XORL 40(SP), R9 - XORL 16(SP), R9 - ROLL $+1, R9 - MOVL R9, 8(SP) - - // FUNC3 - MOVL R11, R8 - ORL R12, R8 - ANDL R13, R8 - MOVL R11, R15 - ANDL R12, R15 - ORL R8, R15 - - // MIX - ROLL $+30, R11 - ADDL R15, R14 - MOVL R10, R8 - ROLL $+5, R8 - LEAL 2400959708(R14)(R9*1), R14 - ADDL R8, R14 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 8(SP), R9 - MOVL R9, 200(R8) - - // ROUND3(51) - // SHUFFLE - MOVL 12(SP), R9 - XORL (SP), R9 - XORL 44(SP), R9 - XORL 20(SP), R9 - ROLL $+1, R9 - MOVL R9, 12(SP) - - // FUNC3 - MOVL R10, R8 - ORL R11, R8 - ANDL R12, R8 - MOVL R10, R15 - ANDL R11, R15 - ORL R8, R15 - - // MIX - ROLL $+30, R10 - ADDL R15, R13 - MOVL R14, R8 - ROLL $+5, R8 - LEAL 2400959708(R13)(R9*1), R13 - ADDL R8, R13 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 12(SP), R9 - MOVL R9, 204(R8) - - // ROUND3(52) - // SHUFFLE - MOVL 16(SP), R9 - XORL 4(SP), R9 - XORL 48(SP), R9 - XORL 24(SP), R9 - ROLL $+1, R9 - MOVL R9, 16(SP) - - // FUNC3 - MOVL R14, R8 - ORL R10, R8 - ANDL R11, R8 - MOVL R14, R15 - ANDL R10, R15 - ORL R8, R15 - - // MIX - ROLL $+30, R14 - ADDL R15, R12 - MOVL R13, R8 - ROLL $+5, R8 - LEAL 2400959708(R12)(R9*1), R12 - ADDL R8, R12 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 16(SP), R9 - MOVL R9, 208(R8) - - // ROUND3(53) - // SHUFFLE - MOVL 20(SP), R9 - XORL 8(SP), R9 - XORL 52(SP), R9 - XORL 28(SP), R9 - ROLL $+1, R9 - MOVL R9, 20(SP) - - // FUNC3 - MOVL R13, R8 - ORL R14, R8 - ANDL R10, R8 - MOVL R13, R15 - ANDL R14, R15 - ORL R8, R15 - - // MIX - ROLL $+30, R13 - ADDL R15, R11 - MOVL R12, R8 - ROLL $+5, R8 - LEAL 2400959708(R11)(R9*1), R11 - ADDL R8, R11 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 20(SP), R9 - MOVL R9, 212(R8) - - // ROUND3(54) - // SHUFFLE - MOVL 24(SP), R9 - XORL 12(SP), R9 - XORL 56(SP), R9 - XORL 32(SP), R9 - ROLL $+1, R9 - MOVL R9, 24(SP) - - // FUNC3 - MOVL R12, R8 - ORL R13, R8 - ANDL R14, R8 - MOVL R12, R15 - ANDL R13, R15 - ORL R8, R15 - - // MIX - ROLL $+30, R12 - ADDL R15, R10 - MOVL R11, R8 - ROLL $+5, R8 - LEAL 2400959708(R10)(R9*1), R10 - ADDL R8, R10 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 24(SP), R9 - MOVL R9, 216(R8) - - // ROUND3(55) - // SHUFFLE - MOVL 28(SP), R9 - XORL 16(SP), R9 - XORL 60(SP), R9 - XORL 36(SP), R9 - ROLL $+1, R9 - MOVL R9, 28(SP) - - // FUNC3 - MOVL R11, R8 - ORL R12, R8 - ANDL R13, R8 - MOVL R11, R15 - ANDL R12, R15 - ORL R8, R15 - - // MIX - ROLL $+30, R11 - ADDL R15, R14 - MOVL R10, R8 - ROLL $+5, R8 - LEAL 2400959708(R14)(R9*1), R14 - ADDL R8, R14 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 28(SP), R9 - MOVL R9, 220(R8) - - // ROUND3(56) - // SHUFFLE - MOVL 32(SP), R9 - XORL 20(SP), R9 - XORL (SP), R9 - XORL 40(SP), R9 - ROLL $+1, R9 - MOVL R9, 32(SP) - - // FUNC3 - MOVL R10, R8 - ORL R11, R8 - ANDL R12, R8 - MOVL R10, R15 - ANDL R11, R15 - ORL R8, R15 - - // MIX - ROLL $+30, R10 - ADDL R15, R13 - MOVL R14, R8 - ROLL $+5, R8 - LEAL 2400959708(R13)(R9*1), R13 - ADDL R8, R13 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 32(SP), R9 - MOVL R9, 224(R8) - - // ROUND3(57) - // SHUFFLE - MOVL 36(SP), R9 - XORL 24(SP), R9 - XORL 4(SP), R9 - XORL 44(SP), R9 - ROLL $+1, R9 - MOVL R9, 36(SP) - - // FUNC3 - MOVL R14, R8 - ORL R10, R8 - ANDL R11, R8 - MOVL R14, R15 - ANDL R10, R15 - ORL R8, R15 - - // MIX - ROLL $+30, R14 - ADDL R15, R12 - MOVL R13, R8 - ROLL $+5, R8 - LEAL 2400959708(R12)(R9*1), R12 - ADDL R8, R12 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 36(SP), R9 - MOVL R9, 228(R8) - - // Load cs - MOVQ cs_base+56(FP), R8 - MOVL R12, 20(R8) - MOVL R13, 24(R8) - MOVL R14, 28(R8) - MOVL R10, 32(R8) - MOVL R11, 36(R8) - - // ROUND3(58) - // SHUFFLE - MOVL 40(SP), R9 - XORL 28(SP), R9 - XORL 8(SP), R9 - XORL 48(SP), R9 - ROLL $+1, R9 - MOVL R9, 40(SP) - - // FUNC3 - MOVL R13, R8 - ORL R14, R8 - ANDL R10, R8 - MOVL R13, R15 - ANDL R14, R15 - ORL R8, R15 - - // MIX - ROLL $+30, R13 - ADDL R15, R11 - MOVL R12, R8 - ROLL $+5, R8 - LEAL 2400959708(R11)(R9*1), R11 - ADDL R8, R11 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 40(SP), R9 - MOVL R9, 232(R8) - - // ROUND3(59) - // SHUFFLE - MOVL 44(SP), R9 - XORL 32(SP), R9 - XORL 12(SP), R9 - XORL 52(SP), R9 - ROLL $+1, R9 - MOVL R9, 44(SP) - - // FUNC3 - MOVL R12, R8 - ORL R13, R8 - ANDL R14, R8 - MOVL R12, R15 - ANDL R13, R15 - ORL R8, R15 - - // MIX - ROLL $+30, R12 - ADDL R15, R10 - MOVL R11, R8 - ROLL $+5, R8 - LEAL 2400959708(R10)(R9*1), R10 - ADDL R8, R10 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 44(SP), R9 - MOVL R9, 236(R8) - - // ROUND4 (steps 60-79) - // ROUND4(60) - // SHUFFLE - MOVL 48(SP), R9 - XORL 36(SP), R9 - XORL 16(SP), R9 - XORL 56(SP), R9 - ROLL $+1, R9 - MOVL R9, 48(SP) - - // FUNC2 - MOVL R11, R15 - XORL R12, R15 - XORL R13, R15 - - // MIX - ROLL $+30, R11 - ADDL R15, R14 - MOVL R10, R8 - ROLL $+5, R8 - LEAL 3395469782(R14)(R9*1), R14 - ADDL R8, R14 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 48(SP), R9 - MOVL R9, 240(R8) - - // ROUND4(61) - // SHUFFLE - MOVL 52(SP), R9 - XORL 40(SP), R9 - XORL 20(SP), R9 - XORL 60(SP), R9 - ROLL $+1, R9 - MOVL R9, 52(SP) - - // FUNC2 - MOVL R10, R15 - XORL R11, R15 - XORL R12, R15 - - // MIX - ROLL $+30, R10 - ADDL R15, R13 - MOVL R14, R8 - ROLL $+5, R8 - LEAL 3395469782(R13)(R9*1), R13 - ADDL R8, R13 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 52(SP), R9 - MOVL R9, 244(R8) - - // ROUND4(62) - // SHUFFLE - MOVL 56(SP), R9 - XORL 44(SP), R9 - XORL 24(SP), R9 - XORL (SP), R9 - ROLL $+1, R9 - MOVL R9, 56(SP) - - // FUNC2 - MOVL R14, R15 - XORL R10, R15 - XORL R11, R15 - - // MIX - ROLL $+30, R14 - ADDL R15, R12 - MOVL R13, R8 - ROLL $+5, R8 - LEAL 3395469782(R12)(R9*1), R12 - ADDL R8, R12 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 56(SP), R9 - MOVL R9, 248(R8) - - // ROUND4(63) - // SHUFFLE - MOVL 60(SP), R9 - XORL 48(SP), R9 - XORL 28(SP), R9 - XORL 4(SP), R9 - ROLL $+1, R9 - MOVL R9, 60(SP) - - // FUNC2 - MOVL R13, R15 - XORL R14, R15 - XORL R10, R15 - - // MIX - ROLL $+30, R13 - ADDL R15, R11 - MOVL R12, R8 - ROLL $+5, R8 - LEAL 3395469782(R11)(R9*1), R11 - ADDL R8, R11 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 60(SP), R9 - MOVL R9, 252(R8) - - // ROUND4(64) - // SHUFFLE - MOVL (SP), R9 - XORL 52(SP), R9 - XORL 32(SP), R9 - XORL 8(SP), R9 - ROLL $+1, R9 - MOVL R9, (SP) - - // FUNC2 - MOVL R12, R15 - XORL R13, R15 - XORL R14, R15 - - // MIX - ROLL $+30, R12 - ADDL R15, R10 - MOVL R11, R8 - ROLL $+5, R8 - LEAL 3395469782(R10)(R9*1), R10 - ADDL R8, R10 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL (SP), R9 - MOVL R9, 256(R8) - - // Load cs - MOVQ cs_base+56(FP), R8 - MOVL R10, 40(R8) - MOVL R11, 44(R8) - MOVL R12, 48(R8) - MOVL R13, 52(R8) - MOVL R14, 56(R8) - - // ROUND4(65) - // SHUFFLE - MOVL 4(SP), R9 - XORL 56(SP), R9 - XORL 36(SP), R9 - XORL 12(SP), R9 - ROLL $+1, R9 - MOVL R9, 4(SP) - - // FUNC2 - MOVL R11, R15 - XORL R12, R15 - XORL R13, R15 - - // MIX - ROLL $+30, R11 - ADDL R15, R14 - MOVL R10, R8 - ROLL $+5, R8 - LEAL 3395469782(R14)(R9*1), R14 - ADDL R8, R14 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 4(SP), R9 - MOVL R9, 260(R8) - - // ROUND4(66) - // SHUFFLE - MOVL 8(SP), R9 - XORL 60(SP), R9 - XORL 40(SP), R9 - XORL 16(SP), R9 - ROLL $+1, R9 - MOVL R9, 8(SP) - - // FUNC2 - MOVL R10, R15 - XORL R11, R15 - XORL R12, R15 - - // MIX - ROLL $+30, R10 - ADDL R15, R13 - MOVL R14, R8 - ROLL $+5, R8 - LEAL 3395469782(R13)(R9*1), R13 - ADDL R8, R13 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 8(SP), R9 - MOVL R9, 264(R8) - - // ROUND4(67) - // SHUFFLE - MOVL 12(SP), R9 - XORL (SP), R9 - XORL 44(SP), R9 - XORL 20(SP), R9 - ROLL $+1, R9 - MOVL R9, 12(SP) - - // FUNC2 - MOVL R14, R15 - XORL R10, R15 - XORL R11, R15 - - // MIX - ROLL $+30, R14 - ADDL R15, R12 - MOVL R13, R8 - ROLL $+5, R8 - LEAL 3395469782(R12)(R9*1), R12 - ADDL R8, R12 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 12(SP), R9 - MOVL R9, 268(R8) - - // ROUND4(68) - // SHUFFLE - MOVL 16(SP), R9 - XORL 4(SP), R9 - XORL 48(SP), R9 - XORL 24(SP), R9 - ROLL $+1, R9 - MOVL R9, 16(SP) - - // FUNC2 - MOVL R13, R15 - XORL R14, R15 - XORL R10, R15 - - // MIX - ROLL $+30, R13 - ADDL R15, R11 - MOVL R12, R8 - ROLL $+5, R8 - LEAL 3395469782(R11)(R9*1), R11 - ADDL R8, R11 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 16(SP), R9 - MOVL R9, 272(R8) - - // ROUND4(69) - // SHUFFLE - MOVL 20(SP), R9 - XORL 8(SP), R9 - XORL 52(SP), R9 - XORL 28(SP), R9 - ROLL $+1, R9 - MOVL R9, 20(SP) - - // FUNC2 - MOVL R12, R15 - XORL R13, R15 - XORL R14, R15 - - // MIX - ROLL $+30, R12 - ADDL R15, R10 - MOVL R11, R8 - ROLL $+5, R8 - LEAL 3395469782(R10)(R9*1), R10 - ADDL R8, R10 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 20(SP), R9 - MOVL R9, 276(R8) - - // ROUND4(70) - // SHUFFLE - MOVL 24(SP), R9 - XORL 12(SP), R9 - XORL 56(SP), R9 - XORL 32(SP), R9 - ROLL $+1, R9 - MOVL R9, 24(SP) - - // FUNC2 - MOVL R11, R15 - XORL R12, R15 - XORL R13, R15 - - // MIX - ROLL $+30, R11 - ADDL R15, R14 - MOVL R10, R8 - ROLL $+5, R8 - LEAL 3395469782(R14)(R9*1), R14 - ADDL R8, R14 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 24(SP), R9 - MOVL R9, 280(R8) - - // ROUND4(71) - // SHUFFLE - MOVL 28(SP), R9 - XORL 16(SP), R9 - XORL 60(SP), R9 - XORL 36(SP), R9 - ROLL $+1, R9 - MOVL R9, 28(SP) - - // FUNC2 - MOVL R10, R15 - XORL R11, R15 - XORL R12, R15 - - // MIX - ROLL $+30, R10 - ADDL R15, R13 - MOVL R14, R8 - ROLL $+5, R8 - LEAL 3395469782(R13)(R9*1), R13 - ADDL R8, R13 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 28(SP), R9 - MOVL R9, 284(R8) - - // ROUND4(72) - // SHUFFLE - MOVL 32(SP), R9 - XORL 20(SP), R9 - XORL (SP), R9 - XORL 40(SP), R9 - ROLL $+1, R9 - MOVL R9, 32(SP) - - // FUNC2 - MOVL R14, R15 - XORL R10, R15 - XORL R11, R15 - - // MIX - ROLL $+30, R14 - ADDL R15, R12 - MOVL R13, R8 - ROLL $+5, R8 - LEAL 3395469782(R12)(R9*1), R12 - ADDL R8, R12 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 32(SP), R9 - MOVL R9, 288(R8) - - // ROUND4(73) - // SHUFFLE - MOVL 36(SP), R9 - XORL 24(SP), R9 - XORL 4(SP), R9 - XORL 44(SP), R9 - ROLL $+1, R9 - MOVL R9, 36(SP) - - // FUNC2 - MOVL R13, R15 - XORL R14, R15 - XORL R10, R15 - - // MIX - ROLL $+30, R13 - ADDL R15, R11 - MOVL R12, R8 - ROLL $+5, R8 - LEAL 3395469782(R11)(R9*1), R11 - ADDL R8, R11 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 36(SP), R9 - MOVL R9, 292(R8) - - // ROUND4(74) - // SHUFFLE - MOVL 40(SP), R9 - XORL 28(SP), R9 - XORL 8(SP), R9 - XORL 48(SP), R9 - ROLL $+1, R9 - MOVL R9, 40(SP) - - // FUNC2 - MOVL R12, R15 - XORL R13, R15 - XORL R14, R15 - - // MIX - ROLL $+30, R12 - ADDL R15, R10 - MOVL R11, R8 - ROLL $+5, R8 - LEAL 3395469782(R10)(R9*1), R10 - ADDL R8, R10 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 40(SP), R9 - MOVL R9, 296(R8) - - // ROUND4(75) - // SHUFFLE - MOVL 44(SP), R9 - XORL 32(SP), R9 - XORL 12(SP), R9 - XORL 52(SP), R9 - ROLL $+1, R9 - MOVL R9, 44(SP) - - // FUNC2 - MOVL R11, R15 - XORL R12, R15 - XORL R13, R15 - - // MIX - ROLL $+30, R11 - ADDL R15, R14 - MOVL R10, R8 - ROLL $+5, R8 - LEAL 3395469782(R14)(R9*1), R14 - ADDL R8, R14 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 44(SP), R9 - MOVL R9, 300(R8) - - // ROUND4(76) - // SHUFFLE - MOVL 48(SP), R9 - XORL 36(SP), R9 - XORL 16(SP), R9 - XORL 56(SP), R9 - ROLL $+1, R9 - MOVL R9, 48(SP) - - // FUNC2 - MOVL R10, R15 - XORL R11, R15 - XORL R12, R15 - - // MIX - ROLL $+30, R10 - ADDL R15, R13 - MOVL R14, R8 - ROLL $+5, R8 - LEAL 3395469782(R13)(R9*1), R13 - ADDL R8, R13 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 48(SP), R9 - MOVL R9, 304(R8) - - // ROUND4(77) - // SHUFFLE - MOVL 52(SP), R9 - XORL 40(SP), R9 - XORL 20(SP), R9 - XORL 60(SP), R9 - ROLL $+1, R9 - MOVL R9, 52(SP) - - // FUNC2 - MOVL R14, R15 - XORL R10, R15 - XORL R11, R15 - - // MIX - ROLL $+30, R14 - ADDL R15, R12 - MOVL R13, R8 - ROLL $+5, R8 - LEAL 3395469782(R12)(R9*1), R12 - ADDL R8, R12 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 52(SP), R9 - MOVL R9, 308(R8) - - // ROUND4(78) - // SHUFFLE - MOVL 56(SP), R9 - XORL 44(SP), R9 - XORL 24(SP), R9 - XORL (SP), R9 - ROLL $+1, R9 - MOVL R9, 56(SP) - - // FUNC2 - MOVL R13, R15 - XORL R14, R15 - XORL R10, R15 - - // MIX - ROLL $+30, R13 - ADDL R15, R11 - MOVL R12, R8 - ROLL $+5, R8 - LEAL 3395469782(R11)(R9*1), R11 - ADDL R8, R11 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 56(SP), R9 - MOVL R9, 312(R8) - - // ROUND4(79) - // SHUFFLE - MOVL 60(SP), R9 - XORL 48(SP), R9 - XORL 28(SP), R9 - XORL 4(SP), R9 - ROLL $+1, R9 - MOVL R9, 60(SP) - - // FUNC2 - MOVL R12, R15 - XORL R13, R15 - XORL R14, R15 - - // MIX - ROLL $+30, R12 - ADDL R15, R10 - MOVL R11, R8 - ROLL $+5, R8 - LEAL 3395469782(R10)(R9*1), R10 - ADDL R8, R10 - - // Load m1 - MOVQ m1_base+32(FP), R8 - MOVL 60(SP), R9 - MOVL R9, 316(R8) - - // Add registers to temp hash. - ADDL R10, AX - ADDL R11, BX - ADDL R12, CX - ADDL R13, DX - ADDL R14, BP - ADDQ $+64, DI - CMPQ DI, SI - JB loop - -end: - MOVQ dig+0(FP), SI - MOVL AX, (SI) - MOVL BX, 4(SI) - MOVL CX, 8(SI) - MOVL DX, 12(SI) - MOVL BP, 16(SI) + // Save ABCD and E working values + VMOVDQA X5, (AX) + VMOVDQA X0, 16(AX) + + // LOAD CS 0 + VPEXTRD $3, X5, R12 + LOADCS(X0, R12, 0, R15) + + // Rounds 0-3 + VMOVDQU (SI), X1 + PSHUFB X7, X1 + PADDD X1, X5 + VMOVDQA X0, X6 + SHA1RNDS4 $0x00, X5, X0 + LOADM1(X1, 0, R13) + + // Rounds 4-7 + VMOVDQU 16(SI), X2 + PSHUFB X7, X2 + SHA1NEXTE X2, X6 + VMOVDQA X0, X5 + SHA1RNDS4 $0x00, X6, X0 + SHA1MSG1 X2, X1 + LOADM1(X2, 1, R13) + + // Rounds 8-11 + VMOVDQU 32(SI), X3 + PSHUFB X7, X3 + SHA1NEXTE X3, X5 + VMOVDQA X0, X6 + SHA1RNDS4 $0x00, X5, X0 + SHA1MSG1 X3, X2 + PXOR X3, X1 + LOADM1(X3, 2, R13) + + // Rounds 12-15 + VMOVDQU 48(SI), X4 + PSHUFB X7, X4 + SHA1NEXTE X4, X6 + VMOVDQA X0, X5 + SHA1MSG2 X4, X1 + SHA1RNDS4 $0x00, X6, X0 + SHA1MSG1 X4, X3 + PXOR X4, X2 + LOADM1(X4, 3, R13) + + // Rounds 16-19 + SHA1NEXTE X1, X5 + VMOVDQA X0, X6 + SHA1MSG2 X1, X2 + SHA1RNDS4 $0x00, X5, X0 + SHA1MSG1 X1, X4 + PXOR X1, X3 + LOADM1(X1, 4, R13) + + // Rounds 20-23 + SHA1NEXTE X2, X6 + VMOVDQA X0, X5 + SHA1MSG2 X2, X3 + SHA1RNDS4 $0x01, X6, X0 + SHA1MSG1 X2, X1 + PXOR X2, X4 + LOADM1(X2, 5, R13) + + // Rounds 24-27 + SHA1NEXTE X3, X5 + VMOVDQA X0, X6 + SHA1MSG2 X3, X4 + SHA1RNDS4 $0x01, X5, X0 + SHA1MSG1 X3, X2 + PXOR X3, X1 + LOADM1(X3, 6, R13) + + // Rounds 28-31 + SHA1NEXTE X4, X6 + VMOVDQA X0, X5 + SHA1MSG2 X4, X1 + SHA1RNDS4 $0x01, X6, X0 + SHA1MSG1 X4, X3 + PXOR X4, X2 + LOADM1(X4, 7, R13) + + // Rounds 32-35 + SHA1NEXTE X1, X5 + VMOVDQA X0, X6 + SHA1MSG2 X1, X2 + SHA1RNDS4 $0x01, X5, X0 + SHA1MSG1 X1, X4 + PXOR X1, X3 + LOADM1(X1, 8, R13) + + // Rounds 36-39 + SHA1NEXTE X2, X6 + VMOVDQA X0, X5 + SHA1MSG2 X2, X3 + SHA1RNDS4 $0x01, X6, X0 + SHA1MSG1 X2, X1 + PXOR X2, X4 + LOADM1(X2, 9, R13) + + // Rounds 40-43 + SHA1NEXTE X3, X5 + VMOVDQA X0, X6 + SHA1MSG2 X3, X4 + SHA1RNDS4 $0x02, X5, X0 + SHA1MSG1 X3, X2 + PXOR X3, X1 + LOADM1(X3, 10, R13) + + // Rounds 44-47 + SHA1NEXTE X4, X6 + VMOVDQA X0, X5 + SHA1MSG2 X4, X1 + SHA1RNDS4 $0x02, X6, X0 + SHA1MSG1 X4, X3 + PXOR X4, X2 + LOADM1(X4, 11, R13) + + // Rounds 48-51 + SHA1NEXTE X1, X5 + VMOVDQA X0, X6 + SHA1MSG2 X1, X2 + SHA1RNDS4 $0x02, X5, X0 + VPEXTRD $0, X5, R12 + SHA1MSG1 X1, X4 + PXOR X1, X3 + LOADM1(X1, 12, R13) + + // derive pre-round 56's E out of round 51's A. + VPEXTRD $3, X0, R12 + ROLL $30, R12 + + // Rounds 52-55 + SHA1NEXTE X2, X6 + VMOVDQA X0, X5 + SHA1MSG2 X2, X3 + SHA1RNDS4 $0x02, X6, X0 + SHA1MSG1 X2, X1 + PXOR X2, X4 + LOADM1(X2, 13, R13) + + // LOAD CS 58 (gathers 56 which will be rectified in Go) + LOADCS(X0, R12, 1, R15) + + // Rounds 56-59 + SHA1NEXTE X3, X5 + VMOVDQA X0, X6 + SHA1MSG2 X3, X4 + SHA1RNDS4 $0x02, X5, X0 + VPEXTRD $0, X5, R12 + SHA1MSG1 X3, X2 + PXOR X3, X1 + LOADM1(X3, 14, R13) + + // derive pre-round 64's E out of round 59's A. + VPEXTRD $3, X0, R12 + ROLL $30, R12 + + // Rounds 60-63 + SHA1NEXTE X4, X6 + VMOVDQA X0, X5 + SHA1MSG2 X4, X1 + SHA1RNDS4 $0x03, X6, X0 + SHA1MSG1 X4, X3 + PXOR X4, X2 + LOADM1(X4, 15, R13) + + // LOAD CS 65 (gathers 64 which will be rectified in Go) + LOADCS(X0, R12, 2, R15) + + // Rounds 64-67 + SHA1NEXTE X1, X5 + VMOVDQA X0, X6 + SHA1MSG2 X1, X2 + SHA1RNDS4 $0x03, X5, X0 + SHA1MSG1 X1, X4 + PXOR X1, X3 + LOADM1(X1, 16, R13) + + // Rounds 68-71 + SHA1NEXTE X2, X6 + VMOVDQA X0, X5 + SHA1MSG2 X2, X3 + SHA1RNDS4 $0x03, X6, X0 + PXOR X2, X4 + LOADM1(X2, 17, R13) + + // Rounds 72-75 + SHA1NEXTE X3, X5 + VMOVDQA X0, X6 + SHA1MSG2 X3, X4 + SHA1RNDS4 $0x03, X5, X0 + LOADM1(X3, 18, R13) + + // Rounds 76-79 + SHA1NEXTE X4, X6 + VMOVDQA X0, X5 + SHA1RNDS4 $0x03, X6, X0 + LOADM1(X4, 19, R13) + + // Add saved E and ABCD + SHA1NEXTE (AX), X5 + PADDD 16(AX), X0 + + // Check if we are done, if not return to the loop + ADDQ $0x40, SI + CMPQ SI, DX + JNE loop + + // Write the hash state back to digest + PSHUFD $0x1b, X0, X0 + VMOVDQU X0, (DI) + PEXTRD $0x03, X5, 16(DI) + +done: RET + +DATA upper_mask<>+0(SB)/8, $0x0000000000000000 +DATA upper_mask<>+8(SB)/8, $0xffffffff00000000 +GLOBL upper_mask<>(SB), RODATA, $16 + +DATA shuffle_mask<>+0(SB)/8, $0x08090a0b0c0d0e0f +DATA shuffle_mask<>+8(SB)/8, $0x0001020304050607 +GLOBL shuffle_mask<>(SB), RODATA, $16 diff --git a/vendor/github.com/pjbgf/sha1cd/sha1cdblock_arm64.go b/vendor/github.com/pjbgf/sha1cd/sha1cdblock_arm64.go new file mode 100644 index 000000000..f44f22da4 --- /dev/null +++ b/vendor/github.com/pjbgf/sha1cd/sha1cdblock_arm64.go @@ -0,0 +1,48 @@ +//go:build !noasm && gc && arm64 && !amd64 +// +build !noasm,gc,arm64,!amd64 + +package sha1cd + +import ( + "runtime" + + "github.com/klauspost/cpuid/v2" + shared "github.com/pjbgf/sha1cd/internal" +) + +var hasSHA1 = (runtime.GOARCH == "arm64" && cpuid.CPU.Supports(cpuid.SHA1)) + +// blockARM64 hashes the message p into the current state in h. +// Both m1 and cs are used to store intermediate results which are used by the collision detection logic. +// +//go:noescape +func blockARM64(h []uint32, p []byte, m1 []uint32, cs [][5]uint32) + +func block(dig *digest, p []byte) { + if forceGeneric || !hasSHA1 { + blockGeneric(dig, p) + return + } + + m1 := [shared.Rounds]uint32{} + cs := [shared.PreStepState][shared.WordBuffers]uint32{} + + for len(p) >= shared.Chunk { + // The assembly code only supports processing a block at a time, + // so adjust the chunk accordingly. + chunk := p[:shared.Chunk] + + blockARM64(dig.h[:], chunk, m1[:], cs[:]) + + rectifyCompressionState(&m1, &cs) + col := checkCollision(&m1, &cs, &dig.h) + if col { + dig.col = true + + blockARM64(dig.h[:], chunk, m1[:], cs[:]) + blockARM64(dig.h[:], chunk, m1[:], cs[:]) + } + + p = p[shared.Chunk:] + } +} diff --git a/vendor/github.com/pjbgf/sha1cd/sha1cdblock_arm64.s b/vendor/github.com/pjbgf/sha1cd/sha1cdblock_arm64.s new file mode 100644 index 000000000..63762049a --- /dev/null +++ b/vendor/github.com/pjbgf/sha1cd/sha1cdblock_arm64.s @@ -0,0 +1,249 @@ +//go:build !noasm && gc && arm64 && !amd64 + +#include "textflag.h" + +// License information for the original SHA1 arm64 implemention: +// Copyright 2017 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found at: +// - https://github.com/golang/go/blob/master/LICENSE +// +// Reference implementations: +// - https://github.com/noloader/SHA-Intrinsics/blob/master/sha1-arm.c +// - https://github.com/golang/go/blob/master/src/crypto/sha1/sha1block_arm64.s + +#define HASHUPDATECHOOSE \ + SHA1C V16.S4, V1, V2 \ + SHA1H V3, V1 \ + VMOV V2.B16, V3.B16 + +#define HASHUPDATEPARITY \ + SHA1P V16.S4, V1, V2 \ + SHA1H V3, V1 \ + VMOV V2.B16, V3.B16 + +#define HASHUPDATEMAJ \ + SHA1M V16.S4, V1, V2 \ + SHA1H V3, V1 \ + VMOV V2.B16, V3.B16 + +// func blockARM64(h []uint32, p []byte, m1 []uint32, cs [][5]uint32) +TEXT ·blockARM64(SB), NOSPLIT, $80-96 + MOVD h_base+0(FP), R0 + MOVD p_base+24(FP), R1 + MOVD p_len+32(FP), R2 + MOVD m1_base+48(FP), R3 + MOVD cs_base+72(FP), R4 + + LSR $6, R2, R2 + LSL $6, R2, R2 + ADD R16, R2, R21 + + VLD1.P 16(R0), [V0.S4] + FMOVS (R0), F20 + SUB $16, R0, R0 + +loop: + CMP R16, R21 + BLS end + + // Load block (p) into 16-bytes vectors. + VLD1.P 16(R1), [V4.B16] + VLD1.P 16(R1), [V5.B16] + VLD1.P 16(R1), [V6.B16] + VLD1.P 16(R1), [V7.B16] + + // Load K constants to V19 + MOVD $·sha1Ks(SB), R22 + VLD1 (R22), [V19.S4] + + VMOV V0.B16, V2.B16 + VMOV V20.S[0], V1 + VMOV V2.B16, V3.B16 + VDUP V19.S[0], V17.S4 + + // Little Endian + VREV32 V4.B16, V4.B16 + VREV32 V5.B16, V5.B16 + VREV32 V6.B16, V6.B16 + VREV32 V7.B16, V7.B16 + + // LOAD M1 rounds 0-15 + VST1.P [V4.S4], (R3) + VST1.P [V5.S4], (R3) + VST1.P [V6.S4], (R3) + VST1.P [V7.S4], (R3) + + // LOAD CS 0 + VST1.P [V0.S4], (R4) // ABCD pre-round 0 + VST1.P V1.S[0], 4(R4) // E pre-round 0 + + // Rounds 0-3 + VDUP V19.S[1], V18.S4 + VADD V17.S4, V4.S4, V16.S4 + SHA1SU0 V6.S4, V5.S4, V4.S4 + HASHUPDATECHOOSE + SHA1SU1 V7.S4, V4.S4 + + // Rounds 4-7 + VADD V17.S4, V5.S4, V16.S4 + SHA1SU0 V7.S4, V6.S4, V5.S4 + HASHUPDATECHOOSE + SHA1SU1 V4.S4, V5.S4 + // LOAD M1 rounds 16-19 + VST1.P [V4.S4], (R3) + + // Rounds 8-11 + VADD V17.S4, V6.S4, V16.S4 + SHA1SU0 V4.S4, V7.S4, V6.S4 + HASHUPDATECHOOSE + SHA1SU1 V5.S4, V6.S4 + // LOAD M1 rounds 20-23 + VST1.P [V5.S4], (R3) + + // Rounds 12-15 + VADD V17.S4, V7.S4, V16.S4 + SHA1SU0 V5.S4, V4.S4, V7.S4 + HASHUPDATECHOOSE + SHA1SU1 V6.S4, V7.S4 + // LOAD M1 rounds 24-27 + VST1.P [V6.S4], (R3) + + // Rounds 16-19 + VADD V17.S4, V4.S4, V16.S4 + SHA1SU0 V6.S4, V5.S4, V4.S4 + HASHUPDATECHOOSE + SHA1SU1 V7.S4, V4.S4 + // LOAD M1 rounds 28-31 + VST1.P [V7.S4], (R3) + + // Rounds 20-23 + VDUP V19.S[2], V17.S4 + VADD V18.S4, V5.S4, V16.S4 + SHA1SU0 V7.S4, V6.S4, V5.S4 + HASHUPDATEPARITY + SHA1SU1 V4.S4, V5.S4 + // LOAD M1 rounds 32-35 + VST1.P [V4.S4], (R3) + + // Rounds 24-27 + VADD V18.S4, V6.S4, V16.S4 + SHA1SU0 V4.S4, V7.S4, V6.S4 + HASHUPDATEPARITY + SHA1SU1 V5.S4, V6.S4 + // LOAD M1 rounds 36-39 + VST1.P [V5.S4], (R3) + + // Rounds 28-31 + VADD V18.S4, V7.S4, V16.S4 + SHA1SU0 V5.S4, V4.S4, V7.S4 + HASHUPDATEPARITY + SHA1SU1 V6.S4, V7.S4 + // LOAD M1 rounds 40-43 + VST1.P [V6.S4], (R3) + + // Rounds 32-35 + VADD V18.S4, V4.S4, V16.S4 + SHA1SU0 V6.S4, V5.S4, V4.S4 + HASHUPDATEPARITY + SHA1SU1 V7.S4, V4.S4 + // LOAD M1 rounds 44-47 + VST1.P [V7.S4], (R3) + + // Rounds 36-39 + VADD V18.S4, V5.S4, V16.S4 + SHA1SU0 V7.S4, V6.S4, V5.S4 + HASHUPDATEPARITY + SHA1SU1 V4.S4, V5.S4 + // LOAD M1 rounds 48-51 + VST1.P [V4.S4], (R3) + + // Rounds 44-47 + VDUP V19.S[3], V18.S4 + VADD V17.S4, V6.S4, V16.S4 + SHA1SU0 V4.S4, V7.S4, V6.S4 + HASHUPDATEMAJ + SHA1SU1 V5.S4, V6.S4 + // LOAD M1 rounds 52-55 + VST1.P [V5.S4], (R3) + + // Rounds 44-47 + VADD V17.S4, V7.S4, V16.S4 + SHA1SU0 V5.S4, V4.S4, V7.S4 + HASHUPDATEMAJ + SHA1SU1 V6.S4, V7.S4 + // LOAD M1 rounds 56-59 + VST1.P [V6.S4], (R3) + + // Rounds 48-51 + VADD V17.S4, V4.S4, V16.S4 + SHA1SU0 V6.S4, V5.S4, V4.S4 + HASHUPDATEMAJ + SHA1SU1 V7.S4, V4.S4 + // LOAD M1 rounds 60-63 + VST1.P [V7.S4], (R3) + + // Rounds 52-55 + VADD V17.S4, V5.S4, V16.S4 + SHA1SU0 V7.S4, V6.S4, V5.S4 + HASHUPDATEMAJ + SHA1SU1 V4.S4, V5.S4 + + // LOAD CS 58 + VST1.P [V3.S4], (R4) // ABCD pre-round 56 + VST1.P V1.S[0], 4(R4) // E pre-round 56 + + // Rounds 56-59 + VADD V17.S4, V6.S4, V16.S4 + SHA1SU0 V4.S4, V7.S4, V6.S4 + HASHUPDATEMAJ + SHA1SU1 V5.S4, V6.S4 + + // Rounds 60-63 + VADD V18.S4, V7.S4, V16.S4 + SHA1SU0 V5.S4, V4.S4, V7.S4 + HASHUPDATEPARITY + SHA1SU1 V6.S4, V7.S4 + + // LOAD CS 65 + VST1.P [V3.S4], (R4) // ABCD pre-round 64 + VST1.P V1.S[0], 4(R4) // E pre-round 64 + + // Rounds 64-67 + VADD V18.S4, V4.S4, V16.S4 + HASHUPDATEPARITY + + // LOAD M1 rounds 68-79 + VST1.P [V4.S4], (R3) + VST1.P [V5.S4], (R3) + VST1.P [V6.S4], (R3) + VST1.P [V7.S4], (R3) + + // Rounds 68-71 + VADD V18.S4, V5.S4, V16.S4 + HASHUPDATEPARITY + + // Rounds 72-75 + VADD V18.S4, V6.S4, V16.S4 + HASHUPDATEPARITY + + // Rounds 76-79 + VADD V18.S4, V7.S4, V16.S4 + HASHUPDATEPARITY + + // Add working registers to hash state. + VADD V2.S4, V0.S4, V0.S4 + VADD V1.S4, V20.S4, V20.S4 + +end: + // Update h with final hash values. + VST1.P [V0.S4], (R0) + FMOVS F20, (R0) + + RET + +DATA ·sha1Ks+0(SB)/4, $0x5A827999 // K0 +DATA ·sha1Ks+4(SB)/4, $0x6ED9EBA1 // K1 +DATA ·sha1Ks+8(SB)/4, $0x8F1BBCDC // K2 +DATA ·sha1Ks+12(SB)/4, $0xCA62C1D6 // K3 +GLOBL ·sha1Ks(SB), RODATA, $16 diff --git a/vendor/github.com/pjbgf/sha1cd/sha1cdblock_generic.go b/vendor/github.com/pjbgf/sha1cd/sha1cdblock_generic.go index ba8b96e87..a80148eb9 100644 --- a/vendor/github.com/pjbgf/sha1cd/sha1cdblock_generic.go +++ b/vendor/github.com/pjbgf/sha1cd/sha1cdblock_generic.go @@ -15,6 +15,8 @@ import ( "github.com/pjbgf/sha1cd/ubc" ) +var forceGeneric bool + // blockGeneric is a portable, pure Go version of the SHA-1 block step. // It's used by sha1block_generic.go and tests. func blockGeneric(dig *digest, p []byte) { @@ -125,7 +127,8 @@ func blockGeneric(dig *digest, p []byte) { } if hi == 1 { - col := checkCollision(m1, cs, [shared.WordBuffers]uint32{h0, h1, h2, h3, h4}) + h := [shared.WordBuffers]uint32{h0, h1, h2, h3, h4} + col := checkCollision(&m1, &cs, &h) if col { dig.col = true hi++ @@ -139,24 +142,25 @@ func blockGeneric(dig *digest, p []byte) { dig.h[0], dig.h[1], dig.h[2], dig.h[3], dig.h[4] = h0, h1, h2, h3, h4 } +//go:noinline func checkCollision( - m1 [shared.Rounds]uint32, - cs [shared.PreStepState][shared.WordBuffers]uint32, - state [shared.WordBuffers]uint32) bool { - + m1 *[shared.Rounds]uint32, + cs *[shared.PreStepState][shared.WordBuffers]uint32, + h *[shared.WordBuffers]uint32, +) bool { if mask := ubc.CalculateDvMask(m1); mask != 0 { dvs := ubc.SHA1_dvs() for i := 0; dvs[i].DvType != 0; i++ { if (mask & ((uint32)(1) << uint32(dvs[i].MaskB))) != 0 { - var csState [shared.WordBuffers]uint32 + var csState *[shared.WordBuffers]uint32 switch dvs[i].TestT { case 58: - csState = cs[1] + csState = &cs[1] case 65: - csState = cs[2] + csState = &cs[2] case 0: - csState = cs[0] + csState = &cs[0] default: panic(fmt.Sprintf("dvs data is trying to use a testT that isn't available: %d", dvs[i].TestT)) } @@ -165,9 +169,9 @@ func checkCollision( dvs[i].TestT, // testT is the step number // m2 is a secondary message created XORing with // ubc's DM prior to the SHA recompression step. - m1, dvs[i].Dm, + m1, &dvs[i].Dm, csState, - state) + h) if col { return true @@ -178,8 +182,9 @@ func checkCollision( return false } -func hasCollided(step uint32, m1, dm [shared.Rounds]uint32, - state [shared.WordBuffers]uint32, h [shared.WordBuffers]uint32) bool { +//go:nosplit +func hasCollided(step uint32, m1, dm *[shared.Rounds]uint32, + state *[shared.WordBuffers]uint32, h *[shared.WordBuffers]uint32) bool { // Intermediary Hash Value. ihv := [shared.WordBuffers]uint32{} @@ -266,3 +271,42 @@ func hasCollided(step uint32, m1, dm [shared.Rounds]uint32, return false } + +// rectifyCompressionState fixes the compression state when using the +// SIMD implementations. +// +// Due to the way that hardware acceleration works, the rounds +// are executed 4 at a time. Therefore, the state for cs58 and cs65 +// are not available directly through the assembly logic. The states +// returned are for cs56 and cs64. This function updates indexes 1 and 2 +// of cs to contain the respective CS values for rounds 58 and 65. +// +//go:nosplit +func rectifyCompressionState( + m1 *[shared.Rounds]uint32, + cs *[shared.PreStepState][shared.WordBuffers]uint32, +) { + if cs == nil { + return + } + + func3 := func(state [shared.WordBuffers]uint32, i int) [shared.WordBuffers]uint32 { + a, b, c, d, e := state[0], state[1], state[2], state[3], state[4] + + f := ((b | c) & d) | (b & c) + t := bits.RotateLeft32(a, 5) + f + e + m1[i] + shared.K2 + a, b, c, d, e = t, a, bits.RotateLeft32(b, 30), c, d + return [shared.WordBuffers]uint32{a, b, c, d, e} + } + func4 := func(state [shared.WordBuffers]uint32, i int) [shared.WordBuffers]uint32 { + a, b, c, d, e := state[0], state[1], state[2], state[3], state[4] + f := b ^ c ^ d + t := bits.RotateLeft32(a, 5) + f + e + m1[i] + shared.K3 + a, b, c, d, e = t, a, bits.RotateLeft32(b, 30), c, d + return [shared.WordBuffers]uint32{a, b, c, d, e} + } + + cs57 := func3(cs[1], 56) + cs[1] = func3(cs57, 57) + cs[2] = func4(cs[2], 64) +} diff --git a/vendor/github.com/pjbgf/sha1cd/sha1cdblock_noasm.go b/vendor/github.com/pjbgf/sha1cd/sha1cdblock_noasm.go index 15bae5a7e..4444c7531 100644 --- a/vendor/github.com/pjbgf/sha1cd/sha1cdblock_noasm.go +++ b/vendor/github.com/pjbgf/sha1cd/sha1cdblock_noasm.go @@ -1,5 +1,4 @@ -//go:build !amd64 || noasm || !gc -// +build !amd64 noasm !gc +//go:build (!amd64 && !arm64) || noasm package sha1cd diff --git a/vendor/github.com/pjbgf/sha1cd/ubc/ubc.go b/vendor/github.com/pjbgf/sha1cd/ubc/ubc.go index b0b4d76e3..bd932051b 100644 --- a/vendor/github.com/pjbgf/sha1cd/ubc/ubc.go +++ b/vendor/github.com/pjbgf/sha1cd/ubc/ubc.go @@ -2,4 +2,375 @@ // Unavoidable Bit Conditions that arise from crypto analysis attacks. package ubc -//go:generate go run -C asm . -out ../ubc_amd64.s -pkg $GOPACKAGE +// Based on the C implementation from Marc Stevens and Dan Shumow. +// https://github.com/cr-marcstevens/sha1collisiondetection + +type DvInfo struct { + // DvType, DvK and DvB define the DV: I(K,B) or II(K,B) (see the paper). + // https://marc-stevens.nl/research/papers/C13-S.pdf + DvType uint32 + DvK uint32 + DvB uint32 + + // TestT is the step to do the recompression from for collision detection. + TestT uint32 + + // MaskI and MaskB define the bit to check for each DV in the dvmask returned by ubc_check. + MaskI uint32 + MaskB uint32 + + // Dm is the expanded message block XOR-difference defined by the DV. + Dm [80]uint32 +} + +// CalculateDvMask takes as input an expanded message block and +// verifies the unavoidable bitconditions for all listed DVs. It returns +// a dvmask where each bit belonging to a DV is set if all unavoidable +// bitconditions for that DV have been met. +// +//go:nosplit +func CalculateDvMask(W *[80]uint32) uint32 { + if W == nil { + return 0 + } + mask := uint32(0xFFFFFFFF) + mask &= (((((W[44] ^ W[45]) >> 29) & 1) - 1) | ^(DV_I_48_0_bit | DV_I_51_0_bit | DV_I_52_0_bit | DV_II_45_0_bit | DV_II_46_0_bit | DV_II_50_0_bit | DV_II_51_0_bit)) + mask &= (((((W[49] ^ W[50]) >> 29) & 1) - 1) | ^(DV_I_46_0_bit | DV_II_45_0_bit | DV_II_50_0_bit | DV_II_51_0_bit | DV_II_55_0_bit | DV_II_56_0_bit)) + mask &= (((((W[48] ^ W[49]) >> 29) & 1) - 1) | ^(DV_I_45_0_bit | DV_I_52_0_bit | DV_II_49_0_bit | DV_II_50_0_bit | DV_II_54_0_bit | DV_II_55_0_bit)) + mask &= ((((W[47] ^ (W[50] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_I_47_0_bit | DV_I_49_0_bit | DV_I_51_0_bit | DV_II_45_0_bit | DV_II_51_0_bit | DV_II_56_0_bit)) + mask &= (((((W[47] ^ W[48]) >> 29) & 1) - 1) | ^(DV_I_44_0_bit | DV_I_51_0_bit | DV_II_48_0_bit | DV_II_49_0_bit | DV_II_53_0_bit | DV_II_54_0_bit)) + mask &= (((((W[46] >> 4) ^ (W[49] >> 29)) & 1) - 1) | ^(DV_I_46_0_bit | DV_I_48_0_bit | DV_I_50_0_bit | DV_I_52_0_bit | DV_II_50_0_bit | DV_II_55_0_bit)) + mask &= (((((W[46] ^ W[47]) >> 29) & 1) - 1) | ^(DV_I_43_0_bit | DV_I_50_0_bit | DV_II_47_0_bit | DV_II_48_0_bit | DV_II_52_0_bit | DV_II_53_0_bit)) + mask &= (((((W[45] >> 4) ^ (W[48] >> 29)) & 1) - 1) | ^(DV_I_45_0_bit | DV_I_47_0_bit | DV_I_49_0_bit | DV_I_51_0_bit | DV_II_49_0_bit | DV_II_54_0_bit)) + mask &= (((((W[45] ^ W[46]) >> 29) & 1) - 1) | ^(DV_I_49_0_bit | DV_I_52_0_bit | DV_II_46_0_bit | DV_II_47_0_bit | DV_II_51_0_bit | DV_II_52_0_bit)) + mask &= (((((W[44] >> 4) ^ (W[47] >> 29)) & 1) - 1) | ^(DV_I_44_0_bit | DV_I_46_0_bit | DV_I_48_0_bit | DV_I_50_0_bit | DV_II_48_0_bit | DV_II_53_0_bit)) + mask &= (((((W[43] >> 4) ^ (W[46] >> 29)) & 1) - 1) | ^(DV_I_43_0_bit | DV_I_45_0_bit | DV_I_47_0_bit | DV_I_49_0_bit | DV_II_47_0_bit | DV_II_52_0_bit)) + mask &= (((((W[43] ^ W[44]) >> 29) & 1) - 1) | ^(DV_I_47_0_bit | DV_I_50_0_bit | DV_I_51_0_bit | DV_II_45_0_bit | DV_II_49_0_bit | DV_II_50_0_bit)) + mask &= (((((W[42] >> 4) ^ (W[45] >> 29)) & 1) - 1) | ^(DV_I_44_0_bit | DV_I_46_0_bit | DV_I_48_0_bit | DV_I_52_0_bit | DV_II_46_0_bit | DV_II_51_0_bit)) + mask &= (((((W[41] >> 4) ^ (W[44] >> 29)) & 1) - 1) | ^(DV_I_43_0_bit | DV_I_45_0_bit | DV_I_47_0_bit | DV_I_51_0_bit | DV_II_45_0_bit | DV_II_50_0_bit)) + mask &= (((((W[40] ^ W[41]) >> 29) & 1) - 1) | ^(DV_I_44_0_bit | DV_I_47_0_bit | DV_I_48_0_bit | DV_II_46_0_bit | DV_II_47_0_bit | DV_II_56_0_bit)) + mask &= (((((W[54] ^ W[55]) >> 29) & 1) - 1) | ^(DV_I_51_0_bit | DV_II_47_0_bit | DV_II_50_0_bit | DV_II_55_0_bit | DV_II_56_0_bit)) + mask &= (((((W[53] ^ W[54]) >> 29) & 1) - 1) | ^(DV_I_50_0_bit | DV_II_46_0_bit | DV_II_49_0_bit | DV_II_54_0_bit | DV_II_55_0_bit)) + mask &= (((((W[52] ^ W[53]) >> 29) & 1) - 1) | ^(DV_I_49_0_bit | DV_II_45_0_bit | DV_II_48_0_bit | DV_II_53_0_bit | DV_II_54_0_bit)) + mask &= ((((W[50] ^ (W[53] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_I_50_0_bit | DV_I_52_0_bit | DV_II_46_0_bit | DV_II_48_0_bit | DV_II_54_0_bit)) + mask &= (((((W[50] ^ W[51]) >> 29) & 1) - 1) | ^(DV_I_47_0_bit | DV_II_46_0_bit | DV_II_51_0_bit | DV_II_52_0_bit | DV_II_56_0_bit)) + mask &= ((((W[49] ^ (W[52] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_I_49_0_bit | DV_I_51_0_bit | DV_II_45_0_bit | DV_II_47_0_bit | DV_II_53_0_bit)) + mask &= ((((W[48] ^ (W[51] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_I_48_0_bit | DV_I_50_0_bit | DV_I_52_0_bit | DV_II_46_0_bit | DV_II_52_0_bit)) + mask &= (((((W[42] ^ W[43]) >> 29) & 1) - 1) | ^(DV_I_46_0_bit | DV_I_49_0_bit | DV_I_50_0_bit | DV_II_48_0_bit | DV_II_49_0_bit)) + mask &= (((((W[41] ^ W[42]) >> 29) & 1) - 1) | ^(DV_I_45_0_bit | DV_I_48_0_bit | DV_I_49_0_bit | DV_II_47_0_bit | DV_II_48_0_bit)) + mask &= (((((W[40] >> 4) ^ (W[43] >> 29)) & 1) - 1) | ^(DV_I_44_0_bit | DV_I_46_0_bit | DV_I_50_0_bit | DV_II_49_0_bit | DV_II_56_0_bit)) + mask &= (((((W[39] >> 4) ^ (W[42] >> 29)) & 1) - 1) | ^(DV_I_43_0_bit | DV_I_45_0_bit | DV_I_49_0_bit | DV_II_48_0_bit | DV_II_55_0_bit)) + + if (mask & (DV_I_44_0_bit | DV_I_48_0_bit | DV_II_47_0_bit | DV_II_54_0_bit | DV_II_56_0_bit)) != 0 { + mask &= (((((W[38] >> 4) ^ (W[41] >> 29)) & 1) - 1) | ^(DV_I_44_0_bit | DV_I_48_0_bit | DV_II_47_0_bit | DV_II_54_0_bit | DV_II_56_0_bit)) + } + mask &= (((((W[37] >> 4) ^ (W[40] >> 29)) & 1) - 1) | ^(DV_I_43_0_bit | DV_I_47_0_bit | DV_II_46_0_bit | DV_II_53_0_bit | DV_II_55_0_bit)) + if (mask & (DV_I_52_0_bit | DV_II_48_0_bit | DV_II_51_0_bit | DV_II_56_0_bit)) != 0 { + mask &= (((((W[55] ^ W[56]) >> 29) & 1) - 1) | ^(DV_I_52_0_bit | DV_II_48_0_bit | DV_II_51_0_bit | DV_II_56_0_bit)) + } + if (mask & (DV_I_52_0_bit | DV_II_48_0_bit | DV_II_50_0_bit | DV_II_56_0_bit)) != 0 { + mask &= ((((W[52] ^ (W[55] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_I_52_0_bit | DV_II_48_0_bit | DV_II_50_0_bit | DV_II_56_0_bit)) + } + if (mask & (DV_I_51_0_bit | DV_II_47_0_bit | DV_II_49_0_bit | DV_II_55_0_bit)) != 0 { + mask &= ((((W[51] ^ (W[54] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_I_51_0_bit | DV_II_47_0_bit | DV_II_49_0_bit | DV_II_55_0_bit)) + } + if (mask & (DV_I_48_0_bit | DV_II_47_0_bit | DV_II_52_0_bit | DV_II_53_0_bit)) != 0 { + mask &= (((((W[51] ^ W[52]) >> 29) & 1) - 1) | ^(DV_I_48_0_bit | DV_II_47_0_bit | DV_II_52_0_bit | DV_II_53_0_bit)) + } + if (mask & (DV_I_46_0_bit | DV_I_49_0_bit | DV_II_45_0_bit | DV_II_48_0_bit)) != 0 { + mask &= (((((W[36] >> 4) ^ (W[40] >> 29)) & 1) - 1) | ^(DV_I_46_0_bit | DV_I_49_0_bit | DV_II_45_0_bit | DV_II_48_0_bit)) + } + if (mask & (DV_I_52_0_bit | DV_II_48_0_bit | DV_II_49_0_bit)) != 0 { + mask &= ((0 - (((W[53] ^ W[56]) >> 29) & 1)) | ^(DV_I_52_0_bit | DV_II_48_0_bit | DV_II_49_0_bit)) + } + if (mask & (DV_I_50_0_bit | DV_II_46_0_bit | DV_II_47_0_bit)) != 0 { + mask &= ((0 - (((W[51] ^ W[54]) >> 29) & 1)) | ^(DV_I_50_0_bit | DV_II_46_0_bit | DV_II_47_0_bit)) + } + if (mask & (DV_I_49_0_bit | DV_I_51_0_bit | DV_II_45_0_bit)) != 0 { + mask &= ((0 - (((W[50] ^ W[52]) >> 29) & 1)) | ^(DV_I_49_0_bit | DV_I_51_0_bit | DV_II_45_0_bit)) + } + if (mask & (DV_I_48_0_bit | DV_I_50_0_bit | DV_I_52_0_bit)) != 0 { + mask &= ((0 - (((W[49] ^ W[51]) >> 29) & 1)) | ^(DV_I_48_0_bit | DV_I_50_0_bit | DV_I_52_0_bit)) + } + if (mask & (DV_I_47_0_bit | DV_I_49_0_bit | DV_I_51_0_bit)) != 0 { + mask &= ((0 - (((W[48] ^ W[50]) >> 29) & 1)) | ^(DV_I_47_0_bit | DV_I_49_0_bit | DV_I_51_0_bit)) + } + if (mask & (DV_I_46_0_bit | DV_I_48_0_bit | DV_I_50_0_bit)) != 0 { + mask &= ((0 - (((W[47] ^ W[49]) >> 29) & 1)) | ^(DV_I_46_0_bit | DV_I_48_0_bit | DV_I_50_0_bit)) + } + if (mask & (DV_I_45_0_bit | DV_I_47_0_bit | DV_I_49_0_bit)) != 0 { + mask &= ((0 - (((W[46] ^ W[48]) >> 29) & 1)) | ^(DV_I_45_0_bit | DV_I_47_0_bit | DV_I_49_0_bit)) + } + mask &= ((((W[45] ^ W[47]) & (1 << 6)) - (1 << 6)) | ^(DV_I_47_2_bit | DV_I_49_2_bit | DV_I_51_2_bit)) + if (mask & (DV_I_44_0_bit | DV_I_46_0_bit | DV_I_48_0_bit)) != 0 { + mask &= ((0 - (((W[45] ^ W[47]) >> 29) & 1)) | ^(DV_I_44_0_bit | DV_I_46_0_bit | DV_I_48_0_bit)) + } + mask &= (((((W[44] ^ W[46]) >> 6) & 1) - 1) | ^(DV_I_46_2_bit | DV_I_48_2_bit | DV_I_50_2_bit)) + if (mask & (DV_I_43_0_bit | DV_I_45_0_bit | DV_I_47_0_bit)) != 0 { + mask &= ((0 - (((W[44] ^ W[46]) >> 29) & 1)) | ^(DV_I_43_0_bit | DV_I_45_0_bit | DV_I_47_0_bit)) + } + mask &= ((0 - ((W[41] ^ (W[42] >> 5)) & (1 << 1))) | ^(DV_I_48_2_bit | DV_II_46_2_bit | DV_II_51_2_bit)) + mask &= ((0 - ((W[40] ^ (W[41] >> 5)) & (1 << 1))) | ^(DV_I_47_2_bit | DV_I_51_2_bit | DV_II_50_2_bit)) + if (mask & (DV_I_44_0_bit | DV_I_46_0_bit | DV_II_56_0_bit)) != 0 { + mask &= ((0 - (((W[40] ^ W[42]) >> 4) & 1)) | ^(DV_I_44_0_bit | DV_I_46_0_bit | DV_II_56_0_bit)) + } + mask &= ((0 - ((W[39] ^ (W[40] >> 5)) & (1 << 1))) | ^(DV_I_46_2_bit | DV_I_50_2_bit | DV_II_49_2_bit)) + if (mask & (DV_I_43_0_bit | DV_I_45_0_bit | DV_II_55_0_bit)) != 0 { + mask &= ((0 - (((W[39] ^ W[41]) >> 4) & 1)) | ^(DV_I_43_0_bit | DV_I_45_0_bit | DV_II_55_0_bit)) + } + if (mask & (DV_I_44_0_bit | DV_II_54_0_bit | DV_II_56_0_bit)) != 0 { + mask &= ((0 - (((W[38] ^ W[40]) >> 4) & 1)) | ^(DV_I_44_0_bit | DV_II_54_0_bit | DV_II_56_0_bit)) + } + if (mask & (DV_I_43_0_bit | DV_II_53_0_bit | DV_II_55_0_bit)) != 0 { + mask &= ((0 - (((W[37] ^ W[39]) >> 4) & 1)) | ^(DV_I_43_0_bit | DV_II_53_0_bit | DV_II_55_0_bit)) + } + mask &= ((0 - ((W[36] ^ (W[37] >> 5)) & (1 << 1))) | ^(DV_I_47_2_bit | DV_I_50_2_bit | DV_II_46_2_bit)) + if (mask & (DV_I_45_0_bit | DV_I_48_0_bit | DV_II_47_0_bit)) != 0 { + mask &= (((((W[35] >> 4) ^ (W[39] >> 29)) & 1) - 1) | ^(DV_I_45_0_bit | DV_I_48_0_bit | DV_II_47_0_bit)) + } + if (mask & (DV_I_48_0_bit | DV_II_48_0_bit)) != 0 { + mask &= ((0 - ((W[63] ^ (W[64] >> 5)) & (1 << 0))) | ^(DV_I_48_0_bit | DV_II_48_0_bit)) + } + if (mask & (DV_I_45_0_bit | DV_II_45_0_bit)) != 0 { + mask &= ((0 - ((W[63] ^ (W[64] >> 5)) & (1 << 1))) | ^(DV_I_45_0_bit | DV_II_45_0_bit)) + } + if (mask & (DV_I_47_0_bit | DV_II_47_0_bit)) != 0 { + mask &= ((0 - ((W[62] ^ (W[63] >> 5)) & (1 << 0))) | ^(DV_I_47_0_bit | DV_II_47_0_bit)) + } + if (mask & (DV_I_46_0_bit | DV_II_46_0_bit)) != 0 { + mask &= ((0 - ((W[61] ^ (W[62] >> 5)) & (1 << 0))) | ^(DV_I_46_0_bit | DV_II_46_0_bit)) + } + mask &= ((0 - ((W[61] ^ (W[62] >> 5)) & (1 << 2))) | ^(DV_I_46_2_bit | DV_II_46_2_bit)) + if (mask & (DV_I_45_0_bit | DV_II_45_0_bit)) != 0 { + mask &= ((0 - ((W[60] ^ (W[61] >> 5)) & (1 << 0))) | ^(DV_I_45_0_bit | DV_II_45_0_bit)) + } + if (mask & (DV_II_51_0_bit | DV_II_54_0_bit)) != 0 { + mask &= (((((W[58] ^ W[59]) >> 29) & 1) - 1) | ^(DV_II_51_0_bit | DV_II_54_0_bit)) + } + if (mask & (DV_II_50_0_bit | DV_II_53_0_bit)) != 0 { + mask &= (((((W[57] ^ W[58]) >> 29) & 1) - 1) | ^(DV_II_50_0_bit | DV_II_53_0_bit)) + } + if (mask & (DV_II_52_0_bit | DV_II_54_0_bit)) != 0 { + mask &= ((((W[56] ^ (W[59] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_II_52_0_bit | DV_II_54_0_bit)) + } + if (mask & (DV_II_51_0_bit | DV_II_52_0_bit)) != 0 { + mask &= ((0 - (((W[56] ^ W[59]) >> 29) & 1)) | ^(DV_II_51_0_bit | DV_II_52_0_bit)) + } + if (mask & (DV_II_49_0_bit | DV_II_52_0_bit)) != 0 { + mask &= (((((W[56] ^ W[57]) >> 29) & 1) - 1) | ^(DV_II_49_0_bit | DV_II_52_0_bit)) + } + if (mask & (DV_II_51_0_bit | DV_II_53_0_bit)) != 0 { + mask &= ((((W[55] ^ (W[58] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_II_51_0_bit | DV_II_53_0_bit)) + } + if (mask & (DV_II_50_0_bit | DV_II_52_0_bit)) != 0 { + mask &= ((((W[54] ^ (W[57] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_II_50_0_bit | DV_II_52_0_bit)) + } + if (mask & (DV_II_49_0_bit | DV_II_51_0_bit)) != 0 { + mask &= ((((W[53] ^ (W[56] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_II_49_0_bit | DV_II_51_0_bit)) + } + mask &= ((((W[51] ^ (W[50] >> 5)) & (1 << 1)) - (1 << 1)) | ^(DV_I_50_2_bit | DV_II_46_2_bit)) + mask &= ((((W[48] ^ W[50]) & (1 << 6)) - (1 << 6)) | ^(DV_I_50_2_bit | DV_II_46_2_bit)) + if (mask & (DV_I_51_0_bit | DV_I_52_0_bit)) != 0 { + mask &= ((0 - (((W[48] ^ W[55]) >> 29) & 1)) | ^(DV_I_51_0_bit | DV_I_52_0_bit)) + } + mask &= ((((W[47] ^ W[49]) & (1 << 6)) - (1 << 6)) | ^(DV_I_49_2_bit | DV_I_51_2_bit)) + mask &= ((((W[48] ^ (W[47] >> 5)) & (1 << 1)) - (1 << 1)) | ^(DV_I_47_2_bit | DV_II_51_2_bit)) + mask &= ((((W[46] ^ W[48]) & (1 << 6)) - (1 << 6)) | ^(DV_I_48_2_bit | DV_I_50_2_bit)) + mask &= ((((W[47] ^ (W[46] >> 5)) & (1 << 1)) - (1 << 1)) | ^(DV_I_46_2_bit | DV_II_50_2_bit)) + mask &= ((0 - ((W[44] ^ (W[45] >> 5)) & (1 << 1))) | ^(DV_I_51_2_bit | DV_II_49_2_bit)) + mask &= ((((W[43] ^ W[45]) & (1 << 6)) - (1 << 6)) | ^(DV_I_47_2_bit | DV_I_49_2_bit)) + mask &= (((((W[42] ^ W[44]) >> 6) & 1) - 1) | ^(DV_I_46_2_bit | DV_I_48_2_bit)) + mask &= ((((W[43] ^ (W[42] >> 5)) & (1 << 1)) - (1 << 1)) | ^(DV_II_46_2_bit | DV_II_51_2_bit)) + mask &= ((((W[42] ^ (W[41] >> 5)) & (1 << 1)) - (1 << 1)) | ^(DV_I_51_2_bit | DV_II_50_2_bit)) + mask &= ((((W[41] ^ (W[40] >> 5)) & (1 << 1)) - (1 << 1)) | ^(DV_I_50_2_bit | DV_II_49_2_bit)) + if (mask & (DV_I_52_0_bit | DV_II_51_0_bit)) != 0 { + mask &= ((((W[39] ^ (W[43] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_I_52_0_bit | DV_II_51_0_bit)) + } + if (mask & (DV_I_51_0_bit | DV_II_50_0_bit)) != 0 { + mask &= ((((W[38] ^ (W[42] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_I_51_0_bit | DV_II_50_0_bit)) + } + if (mask & (DV_I_48_2_bit | DV_I_51_2_bit)) != 0 { + mask &= ((0 - ((W[37] ^ (W[38] >> 5)) & (1 << 1))) | ^(DV_I_48_2_bit | DV_I_51_2_bit)) + } + if (mask & (DV_I_50_0_bit | DV_II_49_0_bit)) != 0 { + mask &= ((((W[37] ^ (W[41] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_I_50_0_bit | DV_II_49_0_bit)) + } + if (mask & (DV_II_52_0_bit | DV_II_54_0_bit)) != 0 { + mask &= ((0 - ((W[36] ^ W[38]) & (1 << 4))) | ^(DV_II_52_0_bit | DV_II_54_0_bit)) + } + mask &= ((0 - ((W[35] ^ (W[36] >> 5)) & (1 << 1))) | ^(DV_I_46_2_bit | DV_I_49_2_bit)) + if (mask & (DV_I_51_0_bit | DV_II_47_0_bit)) != 0 { + mask &= ((((W[35] ^ (W[39] >> 25)) & (1 << 3)) - (1 << 3)) | ^(DV_I_51_0_bit | DV_II_47_0_bit)) + } + + if mask != 0 { + if (mask & DV_I_43_0_bit) != 0 { + if not((W[61]^(W[62]>>5))&(1<<1)) != 0 || + not(not((W[59]^(W[63]>>25))&(1<<5))) != 0 || + not((W[58]^(W[63]>>30))&(1<<0)) != 0 { + mask &= ^DV_I_43_0_bit + } + } + if (mask & DV_I_44_0_bit) != 0 { + if not((W[62]^(W[63]>>5))&(1<<1)) != 0 || + not(not((W[60]^(W[64]>>25))&(1<<5))) != 0 || + not((W[59]^(W[64]>>30))&(1<<0)) != 0 { + mask &= ^DV_I_44_0_bit + } + } + if (mask & DV_I_46_2_bit) != 0 { + mask &= ((^((W[40] ^ W[42]) >> 2)) | ^DV_I_46_2_bit) + } + if (mask & DV_I_47_2_bit) != 0 { + if not((W[62]^(W[63]>>5))&(1<<2)) != 0 || + not(not((W[41]^W[43])&(1<<6))) != 0 { + mask &= ^DV_I_47_2_bit + } + } + if (mask & DV_I_48_2_bit) != 0 { + if not((W[63]^(W[64]>>5))&(1<<2)) != 0 || + not(not((W[48]^(W[49]<<5))&(1<<6))) != 0 { + mask &= ^DV_I_48_2_bit + } + } + if (mask & DV_I_49_2_bit) != 0 { + if not(not((W[49]^(W[50]<<5))&(1<<6))) != 0 || + not((W[42]^W[50])&(1<<1)) != 0 || + not(not((W[39]^(W[40]<<5))&(1<<6))) != 0 || + not((W[38]^W[40])&(1<<1)) != 0 { + mask &= ^DV_I_49_2_bit + } + } + if (mask & DV_I_50_0_bit) != 0 { + mask &= (((W[36] ^ W[37]) << 7) | ^DV_I_50_0_bit) + } + if (mask & DV_I_50_2_bit) != 0 { + mask &= (((W[43] ^ W[51]) << 11) | ^DV_I_50_2_bit) + } + if (mask & DV_I_51_0_bit) != 0 { + mask &= (((W[37] ^ W[38]) << 9) | ^DV_I_51_0_bit) + } + if (mask & DV_I_51_2_bit) != 0 { + if not(not((W[51]^(W[52]<<5))&(1<<6))) != 0 || + not(not((W[49]^W[51])&(1<<6))) != 0 || + not(not((W[37]^(W[37]>>5))&(1<<1))) != 0 || + not(not((W[35]^(W[39]>>25))&(1<<5))) != 0 { + mask &= ^DV_I_51_2_bit + } + } + if (mask & DV_I_52_0_bit) != 0 { + mask &= (((W[38] ^ W[39]) << 11) | ^DV_I_52_0_bit) + } + if (mask & DV_II_46_2_bit) != 0 { + mask &= (((W[47] ^ W[51]) << 17) | ^DV_II_46_2_bit) + } + if (mask & DV_II_48_0_bit) != 0 { + if not(not((W[36]^(W[40]>>25))&(1<<3))) != 0 || + not((W[35]^(W[40]<<2))&(1<<30)) != 0 { + mask &= ^DV_II_48_0_bit + } + } + if (mask & DV_II_49_0_bit) != 0 { + if not(not((W[37]^(W[41]>>25))&(1<<3))) != 0 || + not((W[36]^(W[41]<<2))&(1<<30)) != 0 { + mask &= ^DV_II_49_0_bit + } + } + if (mask & DV_II_49_2_bit) != 0 { + if not(not((W[53]^(W[54]<<5))&(1<<6))) != 0 || + not(not((W[51]^W[53])&(1<<6))) != 0 || + not((W[50]^W[54])&(1<<1)) != 0 || + not(not((W[45]^(W[46]<<5))&(1<<6))) != 0 || + not(not((W[37]^(W[41]>>25))&(1<<5))) != 0 || + not((W[36]^(W[41]>>30))&(1<<0)) != 0 { + mask &= ^DV_II_49_2_bit + } + } + if (mask & DV_II_50_0_bit) != 0 { + if not((W[55]^W[58])&(1<<29)) != 0 || + not(not((W[38]^(W[42]>>25))&(1<<3))) != 0 || + not((W[37]^(W[42]<<2))&(1<<30)) != 0 { + mask &= ^DV_II_50_0_bit + } + } + if (mask & DV_II_50_2_bit) != 0 { + if not(not((W[54]^(W[55]<<5))&(1<<6))) != 0 || + not(not((W[52]^W[54])&(1<<6))) != 0 || + not((W[51]^W[55])&(1<<1)) != 0 || + not((W[45]^W[47])&(1<<1)) != 0 || + not(not((W[38]^(W[42]>>25))&(1<<5))) != 0 || + not((W[37]^(W[42]>>30))&(1<<0)) != 0 { + mask &= ^DV_II_50_2_bit + } + } + if (mask & DV_II_51_0_bit) != 0 { + if not(not((W[39]^(W[43]>>25))&(1<<3))) != 0 || + not((W[38]^(W[43]<<2))&(1<<30)) != 0 { + mask &= ^DV_II_51_0_bit + } + } + if (mask & DV_II_51_2_bit) != 0 { + if not(not((W[55]^(W[56]<<5))&(1<<6))) != 0 || + not(not((W[53]^W[55])&(1<<6))) != 0 || + not((W[52]^W[56])&(1<<1)) != 0 || + not((W[46]^W[48])&(1<<1)) != 0 || + not(not((W[39]^(W[43]>>25))&(1<<5))) != 0 || + not((W[38]^(W[43]>>30))&(1<<0)) != 0 { + mask &= ^DV_II_51_2_bit + } + } + if (mask & DV_II_52_0_bit) != 0 { + if not(not((W[59]^W[60])&(1<<29))) != 0 || + not(not((W[40]^(W[44]>>25))&(1<<3))) != 0 || + not(not((W[40]^(W[44]>>25))&(1<<4))) != 0 || + not((W[39]^(W[44]<<2))&(1<<30)) != 0 { + mask &= ^DV_II_52_0_bit + } + } + if (mask & DV_II_53_0_bit) != 0 { + if not((W[58]^W[61])&(1<<29)) != 0 || + not(not((W[57]^(W[61]>>25))&(1<<4))) != 0 || + not(not((W[41]^(W[45]>>25))&(1<<3))) != 0 || + not(not((W[41]^(W[45]>>25))&(1<<4))) != 0 { + mask &= ^DV_II_53_0_bit + } + } + if (mask & DV_II_54_0_bit) != 0 { + if not(not((W[58]^(W[62]>>25))&(1<<4))) != 0 || + not(not((W[42]^(W[46]>>25))&(1<<3))) != 0 || + not(not((W[42]^(W[46]>>25))&(1<<4))) != 0 { + mask &= ^DV_II_54_0_bit + } + } + if (mask & DV_II_55_0_bit) != 0 { + if not(not((W[59]^(W[63]>>25))&(1<<4))) != 0 || + not(not((W[57]^(W[59]>>25))&(1<<4))) != 0 || + not(not((W[43]^(W[47]>>25))&(1<<3))) != 0 || + not(not((W[43]^(W[47]>>25))&(1<<4))) != 0 { + mask &= ^DV_II_55_0_bit + } + } + if (mask & DV_II_56_0_bit) != 0 { + if not(not((W[60]^(W[64]>>25))&(1<<4))) != 0 || + not(not((W[44]^(W[48]>>25))&(1<<3))) != 0 || + not(not((W[44]^(W[48]>>25))&(1<<4))) != 0 { + mask &= ^DV_II_56_0_bit + } + } + } + + return mask +} + +func not(x uint32) uint32 { + if x == 0 { + return 1 + } + + return 0 +} + +//go:nosplit +func SHA1_dvs() []DvInfo { + return sha1_dvs +} diff --git a/vendor/github.com/pjbgf/sha1cd/ubc/ubc_amd64.go b/vendor/github.com/pjbgf/sha1cd/ubc/ubc_amd64.go deleted file mode 100644 index 09159bb5b..000000000 --- a/vendor/github.com/pjbgf/sha1cd/ubc/ubc_amd64.go +++ /dev/null @@ -1,14 +0,0 @@ -//go:build !noasm && gc && amd64 -// +build !noasm,gc,amd64 - -package ubc - -func CalculateDvMaskAMD64(W [80]uint32) uint32 - -// Check takes as input an expanded message block and verifies the unavoidable bitconditions -// for all listed DVs. It returns a dvmask where each bit belonging to a DV is set if all -// unavoidable bitconditions for that DV have been met. -// Thus, one needs to do the recompression check for each DV that has its bit set. -func CalculateDvMask(W [80]uint32) uint32 { - return CalculateDvMaskAMD64(W) -} diff --git a/vendor/github.com/pjbgf/sha1cd/ubc/ubc_amd64.s b/vendor/github.com/pjbgf/sha1cd/ubc/ubc_amd64.s deleted file mode 100644 index c77ea77ec..000000000 --- a/vendor/github.com/pjbgf/sha1cd/ubc/ubc_amd64.s +++ /dev/null @@ -1,1897 +0,0 @@ -// Code generated by command: go run asm.go -out ../ubc_amd64.s -pkg ubc. DO NOT EDIT. - -//go:build !noasm && gc && amd64 - -#include "textflag.h" - -// func CalculateDvMaskAMD64(W [80]uint32) uint32 -TEXT ·CalculateDvMaskAMD64(SB), NOSPLIT, $0-324 - MOVL $0xffffffff, AX - - // (((((W[44] ^ W[45]) >> 29) & 1) - 1) | ^(DV_I_48_0_bit | DV_I_51_0_bit | DV_I_52_0_bit | DV_II_45_0_bit | DV_II_46_0_bit | DV_II_50_0_bit | DV_II_51_0_bit)) - MOVL W_44+176(FP), CX - MOVL W_45+180(FP), DX - XORL DX, CX - SHRL $0x1d, CX - ANDL $0x00000001, CX - DECL CX - ORL $0xfd7c5f7f, CX - ANDL CX, AX - - // mask &= (((((W[49] ^ W[50]) >> 29) & 1) - 1) | ^(DV_I_46_0_bit | DV_II_45_0_bit | DV_II_50_0_bit | DV_II_51_0_bit | DV_II_55_0_bit | DV_II_56_0_bit)) - MOVL W_49+196(FP), CX - MOVL W_50+200(FP), DX - XORL DX, CX - SHRL $0x1d, CX - ANDL $0x00000001, CX - DECL CX - ORL $0x3d7efff7, CX - ANDL CX, AX - - // mask &= (((((W[48] ^ W[49]) >> 29) & 1) - 1) | ^(DV_I_45_0_bit | DV_I_52_0_bit | DV_II_49_0_bit | DV_II_50_0_bit | DV_II_54_0_bit | DV_II_55_0_bit)) - MOVL W_48+192(FP), CX - MOVL W_49+196(FP), DX - XORL DX, CX - SHRL $0x1d, CX - ANDL $0x00000001, CX - DECL CX - ORL $0x9f5f7ffb, CX - ANDL CX, AX - - // mask &= ((((W[47] ^ (W[50] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_I_47_0_bit | DV_I_49_0_bit | DV_I_51_0_bit | DV_II_45_0_bit | DV_II_51_0_bit | DV_II_56_0_bit)) - MOVL W_47+188(FP), CX - MOVL W_50+200(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000010, CX - SUBL $0x00000010, CX - ORL $0x7dfedddf, CX - ANDL CX, AX - - // mask &= (((((W[47] ^ W[48]) >> 29) & 1) - 1) | ^(DV_I_44_0_bit | DV_I_51_0_bit | DV_II_48_0_bit | DV_II_49_0_bit | DV_II_53_0_bit | DV_II_54_0_bit)) - MOVL W_47+188(FP), CX - MOVL W_48+192(FP), DX - XORL DX, CX - SHRL $0x1d, CX - ANDL $0x00000001, CX - DECL CX - ORL $0xcfcfdffd, CX - ANDL CX, AX - - // mask &= (((((W[46] >> 4) ^ (W[49] >> 29)) & 1) - 1) | ^(DV_I_46_0_bit | DV_I_48_0_bit | DV_I_50_0_bit | DV_I_52_0_bit | DV_II_50_0_bit | DV_II_55_0_bit)) - MOVL W_46+184(FP), CX - SHRL $0x04, CX - MOVL W_49+196(FP), DX - SHRL $0x1d, DX - XORL DX, CX - ANDL $0x00000001, CX - DECL CX - ORL $0xbf7f7777, CX - ANDL CX, AX - - // mask &= (((((W[46] ^ W[47]) >> 29) & 1) - 1) | ^(DV_I_43_0_bit | DV_I_50_0_bit | DV_II_47_0_bit | DV_II_48_0_bit | DV_II_52_0_bit | DV_II_53_0_bit)) - MOVL W_46+184(FP), CX - MOVL W_47+188(FP), DX - XORL DX, CX - SHRL $0x1d, CX - ANDL $0x00000001, CX - DECL CX - ORL $0xe7e7f7fe, CX - ANDL CX, AX - - // mask &= (((((W[45] >> 4) ^ (W[48] >> 29)) & 1) - 1) | ^(DV_I_45_0_bit | DV_I_47_0_bit | DV_I_49_0_bit | DV_I_51_0_bit | DV_II_49_0_bit | DV_II_54_0_bit)) - MOVL W_45+180(FP), CX - SHRL $0x04, CX - MOVL W_48+192(FP), DX - SHRL $0x1d, DX - XORL DX, CX - ANDL $0x00000001, CX - DECL CX - ORL $0xdfdfdddb, CX - ANDL CX, AX - - // mask &= (((((W[45] ^ W[46]) >> 29) & 1) - 1) | ^(DV_I_49_0_bit | DV_I_52_0_bit | DV_II_46_0_bit | DV_II_47_0_bit | DV_II_51_0_bit | DV_II_52_0_bit)) - MOVL W_45+180(FP), CX - MOVL W_46+184(FP), DX - XORL DX, CX - SHRL $0x1d, CX - ANDL $0x00000001, CX - DECL CX - ORL $0xf5f57dff, CX - ANDL CX, AX - - // mask &= (((((W[44] >> 4) ^ (W[47] >> 29)) & 1) - 1) | ^(DV_I_44_0_bit | DV_I_46_0_bit | DV_I_48_0_bit | DV_I_50_0_bit | DV_II_48_0_bit | DV_II_53_0_bit)) - MOVL W_44+176(FP), CX - SHRL $0x04, CX - MOVL W_47+188(FP), DX - SHRL $0x1d, DX - XORL DX, CX - ANDL $0x00000001, CX - DECL CX - ORL $0xefeff775, CX - ANDL CX, AX - - // mask &= (((((W[43] >> 4) ^ (W[46] >> 29)) & 1) - 1) | ^(DV_I_43_0_bit | DV_I_45_0_bit | DV_I_47_0_bit | DV_I_49_0_bit | DV_II_47_0_bit | DV_II_52_0_bit)) - MOVL W_43+172(FP), CX - SHRL $0x04, CX - MOVL W_46+184(FP), DX - SHRL $0x1d, DX - XORL DX, CX - ANDL $0x00000001, CX - DECL CX - ORL $0xf7f7fdda, CX - ANDL CX, AX - - // mask &= (((((W[43] ^ W[44]) >> 29) & 1) - 1) | ^(DV_I_47_0_bit | DV_I_50_0_bit | DV_I_51_0_bit | DV_II_45_0_bit | DV_II_49_0_bit | DV_II_50_0_bit)) - MOVL W_43+172(FP), CX - MOVL W_44+176(FP), DX - XORL DX, CX - SHRL $0x1d, CX - ANDL $0x00000001, CX - DECL CX - ORL $0xff5ed7df, CX - ANDL CX, AX - - // mask &= (((((W[42] >> 4) ^ (W[45] >> 29)) & 1) - 1) | ^(DV_I_44_0_bit | DV_I_46_0_bit | DV_I_48_0_bit | DV_I_52_0_bit | DV_II_46_0_bit | DV_II_51_0_bit)) - MOVL W_42+168(FP), CX - SHRL $0x04, CX - MOVL W_45+180(FP), DX - SHRL $0x1d, DX - XORL DX, CX - ANDL $0x00000001, CX - DECL CX - ORL $0xfdfd7f75, CX - ANDL CX, AX - - // mask &= (((((W[41] >> 4) ^ (W[44] >> 29)) & 1) - 1) | ^(DV_I_43_0_bit | DV_I_45_0_bit | DV_I_47_0_bit | DV_I_51_0_bit | DV_II_45_0_bit | DV_II_50_0_bit)) - MOVL W_41+164(FP), CX - SHRL $0x04, CX - MOVL W_44+176(FP), DX - SHRL $0x1d, DX - XORL DX, CX - ANDL $0x00000001, CX - DECL CX - ORL $0xff7edfda, CX - ANDL CX, AX - - // mask &= (((((W[40] ^ W[41]) >> 29) & 1) - 1) | ^(DV_I_44_0_bit | DV_I_47_0_bit | DV_I_48_0_bit | DV_II_46_0_bit | DV_II_47_0_bit | DV_II_56_0_bit)) - MOVL W_40+160(FP), CX - MOVL W_41+164(FP), DX - XORL DX, CX - SHRL $0x1d, CX - ANDL $0x00000001, CX - DECL CX - ORL $0x7ff5ff5d, CX - ANDL CX, AX - - // mask &= (((((W[54] ^ W[55]) >> 29) & 1) - 1) | ^(DV_I_51_0_bit | DV_II_47_0_bit | DV_II_50_0_bit | DV_II_55_0_bit | DV_II_56_0_bit)) - MOVL W_54+216(FP), CX - MOVL W_55+220(FP), DX - XORL DX, CX - SHRL $0x1d, CX - ANDL $0x00000001, CX - DECL CX - ORL $0x3f77dfff, CX - ANDL CX, AX - - // mask &= (((((W[53] ^ W[54]) >> 29) & 1) - 1) | ^(DV_I_50_0_bit | DV_II_46_0_bit | DV_II_49_0_bit | DV_II_54_0_bit | DV_II_55_0_bit)) - MOVL W_53+212(FP), CX - MOVL W_54+216(FP), DX - XORL DX, CX - SHRL $0x1d, CX - ANDL $0x00000001, CX - DECL CX - ORL $0x9fddf7ff, CX - ANDL CX, AX - - // mask &= (((((W[52] ^ W[53]) >> 29) & 1) - 1) | ^(DV_I_49_0_bit | DV_II_45_0_bit | DV_II_48_0_bit | DV_II_53_0_bit | DV_II_54_0_bit)) - MOVL W_52+208(FP), CX - MOVL W_53+212(FP), DX - XORL DX, CX - SHRL $0x1d, CX - ANDL $0x00000001, CX - DECL CX - ORL $0xcfeefdff, CX - ANDL CX, AX - - // mask &= ((((W[50] ^ (W[53] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_I_50_0_bit | DV_I_52_0_bit | DV_II_46_0_bit | DV_II_48_0_bit | DV_II_54_0_bit)) - MOVL W_50+200(FP), CX - MOVL W_53+212(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000010, CX - SUBL $0x00000010, CX - ORL $0xdfed77ff, CX - ANDL CX, AX - - // mask &= (((((W[50] ^ W[51]) >> 29) & 1) - 1) | ^(DV_I_47_0_bit | DV_II_46_0_bit | DV_II_51_0_bit | DV_II_52_0_bit | DV_II_56_0_bit)) - MOVL W_50+200(FP), CX - MOVL W_51+204(FP), DX - XORL DX, CX - SHRL $0x1d, CX - ANDL $0x00000001, CX - DECL CX - ORL $0x75fdffdf, CX - ANDL CX, AX - - // mask &= ((((W[49] ^ (W[52] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_I_49_0_bit | DV_I_51_0_bit | DV_II_45_0_bit | DV_II_47_0_bit | DV_II_53_0_bit)) - MOVL W_49+196(FP), CX - MOVL W_52+208(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000010, CX - SUBL $0x00000010, CX - ORL $0xeff6ddff, CX - ANDL CX, AX - - // mask &= ((((W[48] ^ (W[51] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_I_48_0_bit | DV_I_50_0_bit | DV_I_52_0_bit | DV_II_46_0_bit | DV_II_52_0_bit)) - MOVL W_48+192(FP), CX - MOVL W_51+204(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000010, CX - SUBL $0x00000010, CX - ORL $0xf7fd777f, CX - ANDL CX, AX - - // mask &= (((((W[42] ^ W[43]) >> 29) & 1) - 1) | ^(DV_I_46_0_bit | DV_I_49_0_bit | DV_I_50_0_bit | DV_II_48_0_bit | DV_II_49_0_bit)) - MOVL W_42+168(FP), CX - MOVL W_43+172(FP), DX - XORL DX, CX - SHRL $0x1d, CX - ANDL $0x00000001, CX - DECL CX - ORL $0xffcff5f7, CX - ANDL CX, AX - - // mask &= (((((W[41] ^ W[42]) >> 29) & 1) - 1) | ^(DV_I_45_0_bit | DV_I_48_0_bit | DV_I_49_0_bit | DV_II_47_0_bit | DV_II_48_0_bit)) - MOVL W_41+164(FP), CX - MOVL W_42+168(FP), DX - XORL DX, CX - SHRL $0x1d, CX - ANDL $0x00000001, CX - DECL CX - ORL $0xffe7fd7b, CX - ANDL CX, AX - - // mask &= (((((W[40] >> 4) ^ (W[43] >> 29)) & 1) - 1) | ^(DV_I_44_0_bit | DV_I_46_0_bit | DV_I_50_0_bit | DV_II_49_0_bit | DV_II_56_0_bit)) - MOVL W_40+160(FP), CX - MOVL W_43+172(FP), DX - SHRL $0x04, CX - SHRL $0x1d, DX - XORL DX, CX - ANDL $0x00000001, CX - DECL CX - ORL $0x7fdff7f5, CX - ANDL CX, AX - - // mask &= (((((W[39] >> 4) ^ (W[42] >> 29)) & 1) - 1) | ^(DV_I_43_0_bit | DV_I_45_0_bit | DV_I_49_0_bit | DV_II_48_0_bit | DV_II_55_0_bit)) - MOVL W_39+156(FP), CX - MOVL W_42+168(FP), DX - SHRL $0x04, CX - SHRL $0x1d, DX - XORL DX, CX - ANDL $0x00000001, CX - DECL CX - ORL $0xbfeffdfa, CX - ANDL CX, AX - - // if (mask & (DV_I_44_0_bit | DV_I_48_0_bit | DV_II_47_0_bit | DV_II_54_0_bit | DV_II_56_0_bit)) != 0 { - // mask &= (((((W[38] >> 4) ^ (W[41] >> 29)) & 1) - 1) | ^(DV_I_44_0_bit | DV_I_48_0_bit | DV_II_47_0_bit | DV_II_54_0_bit | DV_II_56_0_bit)) - // } - TESTL $0xa0080082, AX - JE f1 - MOVL W_38+152(FP), CX - MOVL W_41+164(FP), DX - SHRL $0x04, CX - SHRL $0x1d, DX - XORL DX, CX - ANDL $0x00000001, CX - DECL CX - ORL $0x5ff7ff7d, CX - ANDL CX, AX - -f1: - // mask &= (((((W[37] >> 4) ^ (W[40] >> 29)) & 1) - 1) | ^(DV_I_43_0_bit | DV_I_47_0_bit | DV_II_46_0_bit | DV_II_53_0_bit | DV_II_55_0_bit)) - MOVL W_37+148(FP), CX - MOVL W_40+160(FP), DX - SHRL $0x04, CX - SHRL $0x1d, DX - XORL DX, CX - ANDL $0x00000001, CX - DECL CX - ORL $0xaffdffde, CX - ANDL CX, AX - - // if (mask & (DV_I_52_0_bit | DV_II_48_0_bit | DV_II_51_0_bit | DV_II_56_0_bit)) != 0 { - // mask &= (((((W[55] ^ W[56]) >> 29) & 1) - 1) | ^(DV_I_52_0_bit | DV_II_48_0_bit | DV_II_51_0_bit | DV_II_56_0_bit)) - // } - TESTL $0x82108000, AX - JE f2 - MOVL W_55+220(FP), CX - MOVL W_56+224(FP), DX - XORL DX, CX - SHRL $0x1d, CX - ANDL $0x00000001, CX - DECL CX - ORL $0x7def7fff, CX - ANDL CX, AX - -f2: - // if (mask & (DV_I_52_0_bit | DV_II_48_0_bit | DV_II_50_0_bit | DV_II_56_0_bit)) != 0 { - // mask &= ((((W[52] ^ (W[55] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_I_52_0_bit | DV_II_48_0_bit | DV_II_50_0_bit | DV_II_56_0_bit)) - // } - TESTL $0x80908000, AX - JE f3 - MOVL W_52+208(FP), CX - MOVL W_55+220(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000010, CX - SUBL $0x00000010, CX - ORL $0x7f6f7fff, CX - ANDL CX, AX - -f3: - // if (mask & (DV_I_51_0_bit | DV_II_47_0_bit | DV_II_49_0_bit | DV_II_55_0_bit)) != 0 { - // mask &= ((((W[51] ^ (W[54] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_I_51_0_bit | DV_II_47_0_bit | DV_II_49_0_bit | DV_II_55_0_bit)) - // } - TESTL $0x40282000, AX - JE f4 - MOVL W_51+204(FP), CX - MOVL W_54+216(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000010, CX - SUBL $0x00000010, CX - ORL $0xbfd7dfff, CX - ANDL CX, AX - -f4: - // if (mask & (DV_I_48_0_bit | DV_II_47_0_bit | DV_II_52_0_bit | DV_II_53_0_bit)) != 0 { - // mask &= (((((W[51] ^ W[52]) >> 29) & 1) - 1) | ^(DV_I_48_0_bit | DV_II_47_0_bit | DV_II_52_0_bit | DV_II_53_0_bit)) - // } - TESTL $0x18080080, AX - JE f5 - MOVL W_51+204(FP), CX - MOVL W_52+208(FP), DX - XORL DX, CX - SHRL $0x1d, CX - ANDL $0x00000001, CX - DECL CX - ORL $0xe7f7ff7f, CX - ANDL CX, AX - -f5: - // if (mask & (DV_I_46_0_bit | DV_I_49_0_bit | DV_II_45_0_bit | DV_II_48_0_bit)) != 0 { - // mask &= (((((W[36] >> 4) ^ (W[40] >> 29)) & 1) - 1) | ^(DV_I_46_0_bit | DV_I_49_0_bit | DV_II_45_0_bit | DV_II_48_0_bit)) - // } - TESTL $0x00110208, AX - JE f6 - MOVL W_36+144(FP), CX - SHRL $0x04, CX - MOVL W_40+160(FP), DX - SHRL $0x1d, DX - XORL DX, CX - ANDL $0x00000001, CX - DECL CX - ORL $0xffeefdf7, CX - ANDL CX, AX - -f6: - // if (mask & (DV_I_52_0_bit | DV_II_48_0_bit | DV_II_49_0_bit)) != 0 { - // mask &= ((0 - (((W[53] ^ W[56]) >> 29) & 1)) | ^(DV_I_52_0_bit | DV_II_48_0_bit | DV_II_49_0_bit)) - // } - TESTL $0x00308000, AX - JE f7 - MOVL W_53+212(FP), CX - MOVL W_56+224(FP), DX - XORL DX, CX - SHRL $0x1d, CX - ANDL $0x00000001, CX - NEGL CX - ORL $0xffcf7fff, CX - ANDL CX, AX - -f7: - // if (mask & (DV_I_50_0_bit | DV_II_46_0_bit | DV_II_47_0_bit)) != 0 { - // mask &= ((0 - (((W[51] ^ W[54]) >> 29) & 1)) | ^(DV_I_50_0_bit | DV_II_46_0_bit | DV_II_47_0_bit)) - // } - TESTL $0x000a0800, AX - JE f8 - MOVL W_51+204(FP), CX - MOVL W_54+216(FP), DX - XORL DX, CX - SHRL $0x1d, CX - ANDL $0x00000001, CX - NEGL CX - ORL $0xfff5f7ff, CX - ANDL CX, AX - -f8: - // if (mask & (DV_I_49_0_bit | DV_I_51_0_bit | DV_II_45_0_bit)) != 0 { - // mask &= ((0 - (((W[50] ^ W[52]) >> 29) & 1)) | ^(DV_I_49_0_bit | DV_I_51_0_bit | DV_II_45_0_bit)) - // } - TESTL $0x00012200, AX - JE f9 - MOVL W_50+200(FP), CX - MOVL W_52+208(FP), DX - XORL DX, CX - SHRL $0x1d, CX - ANDL $0x00000001, CX - NEGL CX - ORL $0xfffeddff, CX - ANDL CX, AX - -f9: - // if (mask & (DV_I_48_0_bit | DV_I_50_0_bit | DV_I_52_0_bit)) != 0 { - // mask &= ((0 - (((W[49] ^ W[51]) >> 29) & 1)) | ^(DV_I_48_0_bit | DV_I_50_0_bit | DV_I_52_0_bit)) - // } - TESTL $0x00008880, AX - JE f10 - MOVL W_49+196(FP), CX - MOVL W_51+204(FP), DX - XORL DX, CX - SHRL $0x1d, CX - ANDL $0x00000001, CX - NEGL CX - ORL $0xffff777f, CX - ANDL CX, AX - -f10: - // if (mask & (DV_I_47_0_bit | DV_I_49_0_bit | DV_I_51_0_bit)) != 0 { - // mask &= ((0 - (((W[48] ^ W[50]) >> 29) & 1)) | ^(DV_I_47_0_bit | DV_I_49_0_bit | DV_I_51_0_bit)) - // } - TESTL $0x00002220, AX - JE f11 - MOVL W_48+192(FP), CX - MOVL W_50+200(FP), DX - XORL DX, CX - SHRL $0x1d, CX - ANDL $0x00000001, CX - NEGL CX - ORL $0xffffdddf, CX - ANDL CX, AX - -f11: - // if (mask & (DV_I_46_0_bit | DV_I_48_0_bit | DV_I_50_0_bit)) != 0 { - // mask &= ((0 - (((W[47] ^ W[49]) >> 29) & 1)) | ^(DV_I_46_0_bit | DV_I_48_0_bit | DV_I_50_0_bit)) - // } - TESTL $0x00000888, AX - JE f12 - MOVL W_47+188(FP), CX - MOVL W_49+196(FP), DX - XORL DX, CX - SHRL $0x1d, CX - ANDL $0x00000001, CX - NEGL CX - ORL $0xfffff777, CX - ANDL CX, AX - -f12: - // if (mask & (DV_I_45_0_bit | DV_I_47_0_bit | DV_I_49_0_bit)) != 0 { - // mask &= ((0 - (((W[46] ^ W[48]) >> 29) & 1)) | ^(DV_I_45_0_bit | DV_I_47_0_bit | DV_I_49_0_bit)) - // } - TESTL $0x00000224, AX - JE f13 - MOVL W_46+184(FP), CX - MOVL W_48+192(FP), DX - XORL DX, CX - SHRL $0x1d, CX - ANDL $0x00000001, CX - NEGL CX - ORL $0xfffffddb, CX - ANDL CX, AX - -f13: - // mask &= ((((W[45] ^ W[47]) & (1 << 6)) - (1 << 6)) | ^(DV_I_47_2_bit | DV_I_49_2_bit | DV_I_51_2_bit)) - MOVL W_45+180(FP), CX - MOVL W_47+188(FP), DX - XORL DX, CX - ANDL $0x00000040, CX - SUBL $0x00000040, CX - ORL $0xffffbbbf, CX - ANDL CX, AX - - // if (mask & (DV_I_44_0_bit | DV_I_46_0_bit | DV_I_48_0_bit)) != 0 { - // mask &= ((0 - (((W[45] ^ W[47]) >> 29) & 1)) | ^(DV_I_44_0_bit | DV_I_46_0_bit | DV_I_48_0_bit)) - // } - TESTL $0x0000008a, AX - JE f14 - MOVL W_45+180(FP), CX - MOVL W_47+188(FP), DX - XORL DX, CX - SHRL $0x1d, CX - ANDL $0x00000001, CX - NEGL CX - ORL $0xffffff75, CX - ANDL CX, AX - -f14: - // mask &= (((((W[44] ^ W[46]) >> 6) & 1) - 1) | ^(DV_I_46_2_bit | DV_I_48_2_bit | DV_I_50_2_bit)) - MOVL W_44+176(FP), CX - MOVL W_46+184(FP), DX - XORL DX, CX - SHRL $0x06, CX - ANDL $0x00000001, CX - DECL CX - ORL $0xffffeeef, CX - ANDL CX, AX - - // if (mask & (DV_I_43_0_bit | DV_I_45_0_bit | DV_I_47_0_bit)) != 0 { - // mask &= ((0 - (((W[44] ^ W[46]) >> 29) & 1)) | ^(DV_I_43_0_bit | DV_I_45_0_bit | DV_I_47_0_bit)) - // } - TESTL $0x00000025, AX - JE f15 - MOVL W_44+176(FP), CX - MOVL W_46+184(FP), DX - XORL DX, CX - SHRL $0x1d, CX - ANDL $0x00000001, CX - NEGL CX - ORL $0xffffffda, CX - ANDL CX, AX - -f15: - // mask &= ((0 - ((W[41] ^ (W[42] >> 5)) & (1 << 1))) | ^(DV_I_48_2_bit | DV_II_46_2_bit | DV_II_51_2_bit)) - MOVL W_41+164(FP), CX - MOVL W_42+168(FP), DX - SHRL $0x05, DX - XORL DX, CX - ANDL $0x00000002, CX - NEGL CX - ORL $0xfbfbfeff, CX - ANDL CX, AX - - // mask &= ((0 - ((W[40] ^ (W[41] >> 5)) & (1 << 1))) | ^(DV_I_47_2_bit | DV_I_51_2_bit | DV_II_50_2_bit)) - MOVL W_40+160(FP), CX - MOVL W_41+164(FP), DX - SHRL $0x05, DX - XORL DX, CX - ANDL $0x00000002, CX - NEGL CX - ORL $0xfeffbfbf, CX - ANDL CX, AX - - // if (mask & (DV_I_44_0_bit | DV_I_46_0_bit | DV_II_56_0_bit)) != 0 { - // mask &= ((0 - (((W[40] ^ W[42]) >> 4) & 1)) | ^(DV_I_44_0_bit | DV_I_46_0_bit | DV_II_56_0_bit)) - // } - TESTL $0x8000000a, AX - JE f16 - MOVL W_40+160(FP), CX - MOVL W_42+168(FP), DX - XORL DX, CX - SHRL $0x04, CX - ANDL $0x00000001, CX - NEGL CX - ORL $0x7ffffff5, CX - ANDL CX, AX - -f16: - // mask &= ((0 - ((W[39] ^ (W[40] >> 5)) & (1 << 1))) | ^(DV_I_46_2_bit | DV_I_50_2_bit | DV_II_49_2_bit)) - MOVL W_39+156(FP), CX - MOVL W_40+160(FP), DX - SHRL $0x05, DX - XORL DX, CX - ANDL $0x00000002, CX - NEGL CX - ORL $0xffbfefef, CX - ANDL CX, AX - - // if (mask & (DV_I_43_0_bit | DV_I_45_0_bit | DV_II_55_0_bit)) != 0 { - // mask &= ((0 - (((W[39] ^ W[41]) >> 4) & 1)) | ^(DV_I_43_0_bit | DV_I_45_0_bit | DV_II_55_0_bit)) - // } - TESTL $0x40000005, AX - JE f17 - MOVL W_39+156(FP), CX - MOVL W_41+164(FP), DX - XORL DX, CX - SHRL $0x04, CX - ANDL $0x00000001, CX - NEGL CX - ORL $0xbffffffa, CX - ANDL CX, AX - -f17: - // if (mask & (DV_I_44_0_bit | DV_II_54_0_bit | DV_II_56_0_bit)) != 0 { - // mask &= ((0 - (((W[38] ^ W[40]) >> 4) & 1)) | ^(DV_I_44_0_bit | DV_II_54_0_bit | DV_II_56_0_bit)) - // } - TESTL $0xa0000002, AX - JE f18 - MOVL W_38+152(FP), CX - MOVL W_40+160(FP), DX - XORL DX, CX - SHRL $0x04, CX - ANDL $0x00000001, CX - NEGL CX - ORL $0x5ffffffd, CX - ANDL CX, AX - -f18: - // if (mask & (DV_I_43_0_bit | DV_II_53_0_bit | DV_II_55_0_bit)) != 0 { - // mask &= ((0 - (((W[37] ^ W[39]) >> 4) & 1)) | ^(DV_I_43_0_bit | DV_II_53_0_bit | DV_II_55_0_bit)) - // } - TESTL $0x50000001, AX - JE f19 - MOVL W_37+148(FP), CX - MOVL W_39+156(FP), DX - XORL DX, CX - SHRL $0x04, CX - ANDL $0x00000001, CX - NEGL CX - ORL $0xaffffffe, CX - ANDL CX, AX - -f19: - // mask &= ((0 - ((W[36] ^ (W[37] >> 5)) & (1 << 1))) | ^(DV_I_47_2_bit | DV_I_50_2_bit | DV_II_46_2_bit)) - MOVL W_36+144(FP), CX - MOVL W_37+148(FP), DX - SHRL $0x05, DX - XORL DX, CX - ANDL $0x00000002, CX - NEGL CX - ORL $0xfffbefbf, CX - ANDL CX, AX - - // if (mask & (DV_I_45_0_bit | DV_I_48_0_bit | DV_II_47_0_bit)) != 0 { - // mask &= (((((W[35] >> 4) ^ (W[39] >> 29)) & 1) - 1) | ^(DV_I_45_0_bit | DV_I_48_0_bit | DV_II_47_0_bit)) - // } - TESTL $0x00080084, AX - JE f20 - MOVL W_35+140(FP), CX - MOVL W_39+156(FP), DX - SHRL $0x04, CX - SHRL $0x1d, DX - XORL DX, CX - ANDL $0x00000001, CX - SUBL $0x00000001, CX - ORL $0xfff7ff7b, CX - ANDL CX, AX - -f20: - // if (mask & (DV_I_48_0_bit | DV_II_48_0_bit)) != 0 { - // mask &= ((0 - ((W[63] ^ (W[64] >> 5)) & (1 << 0))) | ^(DV_I_48_0_bit | DV_II_48_0_bit)) - // } - TESTL $0x00100080, AX - JE f21 - MOVL W_63+252(FP), CX - MOVL W_64+256(FP), DX - SHRL $0x05, DX - XORL DX, CX - ANDL $0x00000001, CX - NEGL CX - ORL $0xffefff7f, CX - ANDL CX, AX - -f21: - // if (mask & (DV_I_45_0_bit | DV_II_45_0_bit)) != 0 { - // mask &= ((0 - ((W[63] ^ (W[64] >> 5)) & (1 << 1))) | ^(DV_I_45_0_bit | DV_II_45_0_bit)) - // } - TESTL $0x00010004, AX - JE f22 - MOVL W_63+252(FP), CX - MOVL W_64+256(FP), DX - SHRL $0x05, DX - XORL DX, CX - ANDL $0x00000002, CX - NEGL CX - ORL $0xfffefffb, CX - ANDL CX, AX - -f22: - // if (mask & (DV_I_47_0_bit | DV_II_47_0_bit)) != 0 { - // mask &= ((0 - ((W[62] ^ (W[63] >> 5)) & (1 << 0))) | ^(DV_I_47_0_bit | DV_II_47_0_bit)) - // } - TESTL $0x00080020, AX - JE f23 - MOVL W_62+248(FP), CX - MOVL W_63+252(FP), DX - SHRL $0x05, DX - XORL DX, CX - ANDL $0x00000001, CX - NEGL CX - ORL $0xfff7ffdf, CX - ANDL CX, AX - -f23: - // if (mask & (DV_I_46_0_bit | DV_II_46_0_bit)) != 0 { - // mask &= ((0 - ((W[61] ^ (W[62] >> 5)) & (1 << 0))) | ^(DV_I_46_0_bit | DV_II_46_0_bit)) - // } - TESTL $0x00020008, AX - JE f24 - MOVL W_61+244(FP), CX - MOVL W_62+248(FP), DX - SHRL $0x05, DX - XORL DX, CX - ANDL $0x00000001, CX - NEGL CX - ORL $0xfffdfff7, CX - ANDL CX, AX - -f24: - // mask &= ((0 - ((W[61] ^ (W[62] >> 5)) & (1 << 2))) | ^(DV_I_46_2_bit | DV_II_46_2_bit)) - MOVL W_61+244(FP), CX - MOVL W_62+248(FP), DX - SHRL $0x05, DX - XORL DX, CX - ANDL $0x00000004, CX - NEGL CX - ORL $0xfffbffef, CX - ANDL CX, AX - - // if (mask & (DV_I_45_0_bit | DV_II_45_0_bit)) != 0 { - // mask &= ((0 - ((W[60] ^ (W[61] >> 5)) & (1 << 0))) | ^(DV_I_45_0_bit | DV_II_45_0_bit)) - // } - TESTL $0x00010004, AX - JE f25 - MOVL W_60+240(FP), CX - MOVL W_61+244(FP), DX - SHRL $0x05, DX - XORL DX, CX - ANDL $0x00000001, CX - NEGL CX - ORL $0xfffefffb, CX - ANDL CX, AX - -f25: - // if (mask & (DV_II_51_0_bit | DV_II_54_0_bit)) != 0 { - // mask &= (((((W[58] ^ W[59]) >> 29) & 1) - 1) | ^(DV_II_51_0_bit | DV_II_54_0_bit)) - // } - TESTL $0x22000000, AX - JE f26 - MOVL W_58+232(FP), CX - MOVL W_59+236(FP), DX - XORL DX, CX - SHRL $0x1d, CX - ANDL $0x00000001, CX - SUBL $0x00000001, CX - ORL $0xddffffff, CX - ANDL CX, AX - -f26: - // if (mask & (DV_II_50_0_bit | DV_II_53_0_bit)) != 0 { - // mask &= (((((W[57] ^ W[58]) >> 29) & 1) - 1) | ^(DV_II_50_0_bit | DV_II_53_0_bit)) - // } - TESTL $0x10800000, AX - JE f27 - MOVL W_57+228(FP), CX - MOVL W_58+232(FP), DX - XORL DX, CX - SHRL $0x1d, CX - ANDL $0x00000001, CX - SUBL $0x00000001, CX - ORL $0xef7fffff, CX - ANDL CX, AX - -f27: - // if (mask & (DV_II_52_0_bit | DV_II_54_0_bit)) != 0 { - // mask &= ((((W[56] ^ (W[59] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_II_52_0_bit | DV_II_54_0_bit)) - // } - TESTL $0x28000000, AX - JE f28 - MOVL W_56+224(FP), CX - MOVL W_59+236(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000010, CX - SUBL $0x00000010, CX - ORL $0xd7ffffff, CX - ANDL CX, AX - -f28: - // if (mask & (DV_II_51_0_bit | DV_II_52_0_bit)) != 0 { - // mask &= ((0 - (((W[56] ^ W[59]) >> 29) & 1)) | ^(DV_II_51_0_bit | DV_II_52_0_bit)) - // } - TESTL $0x0a000000, AX - JE f29 - MOVL W_56+224(FP), CX - MOVL W_59+236(FP), DX - XORL DX, CX - SHRL $0x1d, CX - ANDL $0x00000001, CX - NEGL CX - ORL $0xf5ffffff, CX - ANDL CX, AX - -f29: - // if (mask & (DV_II_49_0_bit | DV_II_52_0_bit)) != 0 { - // mask &= (((((W[56] ^ W[57]) >> 29) & 1) - 1) | ^(DV_II_49_0_bit | DV_II_52_0_bit)) - // } - TESTL $0x08200000, AX - JE f30 - MOVL W_56+224(FP), CX - MOVL W_57+228(FP), DX - XORL DX, CX - SHRL $0x1d, CX - ANDL $0x00000001, CX - SUBL $0x00000001, CX - ORL $0xf7dfffff, CX - ANDL CX, AX - -f30: - // if (mask & (DV_II_51_0_bit | DV_II_53_0_bit)) != 0 { - // mask &= ((((W[55] ^ (W[58] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_II_51_0_bit | DV_II_53_0_bit)) - // } - TESTL $0x12000000, AX - JE f31 - MOVL W_55+220(FP), CX - MOVL W_58+232(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000010, CX - SUBL $0x00000010, CX - ORL $0xedffffff, CX - ANDL CX, AX - -f31: - // if (mask & (DV_II_50_0_bit | DV_II_52_0_bit)) != 0 { - // mask &= ((((W[54] ^ (W[57] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_II_50_0_bit | DV_II_52_0_bit)) - // } - TESTL $0x08800000, AX - JE f32 - MOVL W_54+216(FP), CX - MOVL W_57+228(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000010, CX - SUBL $0x00000010, CX - ORL $0xf77fffff, CX - ANDL CX, AX - -f32: - // if (mask & (DV_II_49_0_bit | DV_II_51_0_bit)) != 0 { - // mask &= ((((W[53] ^ (W[56] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_II_49_0_bit | DV_II_51_0_bit)) - // } - TESTL $0x02200000, AX - JE f33 - MOVL W_53+212(FP), CX - MOVL W_56+224(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000010, CX - SUBL $0x00000010, CX - ORL $0xfddfffff, CX - ANDL CX, AX - -f33: - // mask &= ((((W[51] ^ (W[50] >> 5)) & (1 << 1)) - (1 << 1)) | ^(DV_I_50_2_bit | DV_II_46_2_bit)) - MOVL W_51+204(FP), CX - MOVL W_50+200(FP), DX - SHRL $0x05, DX - XORL DX, CX - ANDL $0x00000002, CX - SUBL $0x00000002, CX - ORL $0xfffbefff, CX - ANDL CX, AX - - // mask &= ((((W[48] ^ W[50]) & (1 << 6)) - (1 << 6)) | ^(DV_I_50_2_bit | DV_II_46_2_bit)) - MOVL W_48+192(FP), CX - MOVL W_50+200(FP), DX - XORL DX, CX - ANDL $0x00000040, CX - SUBL $0x00000040, CX - ORL $0xfffbefff, CX - ANDL CX, AX - - // if (mask & (DV_I_51_0_bit | DV_I_52_0_bit)) != 0 { - // mask &= ((0 - (((W[48] ^ W[55]) >> 29) & 1)) | ^(DV_I_51_0_bit | DV_I_52_0_bit)) - // } - TESTL $0x0000a000, AX - JE f34 - MOVL W_48+192(FP), CX - MOVL W_55+220(FP), DX - XORL DX, CX - SHRL $0x1d, CX - ANDL $0x00000001, CX - NEGL CX - ORL $0xffff5fff, CX - ANDL CX, AX - -f34: - // mask &= ((((W[47] ^ W[49]) & (1 << 6)) - (1 << 6)) | ^(DV_I_49_2_bit | DV_I_51_2_bit)) - MOVL W_47+188(FP), CX - MOVL W_49+196(FP), DX - XORL DX, CX - ANDL $0x00000040, CX - SUBL $0x00000040, CX - ORL $0xffffbbff, CX - ANDL CX, AX - - // mask &= ((((W[48] ^ (W[47] >> 5)) & (1 << 1)) - (1 << 1)) | ^(DV_I_47_2_bit | DV_II_51_2_bit)) - MOVL W_48+192(FP), CX - MOVL W_47+188(FP), DX - SHRL $0x05, DX - XORL DX, CX - ANDL $0x00000002, CX - SUBL $0x00000002, CX - ORL $0xfbffffbf, CX - ANDL CX, AX - - // mask &= ((((W[46] ^ W[48]) & (1 << 6)) - (1 << 6)) | ^(DV_I_48_2_bit | DV_I_50_2_bit)) - MOVL W_46+184(FP), CX - MOVL W_48+192(FP), DX - XORL DX, CX - ANDL $0x00000040, CX - SUBL $0x00000040, CX - ORL $0xffffeeff, CX - ANDL CX, AX - - // mask &= ((((W[47] ^ (W[46] >> 5)) & (1 << 1)) - (1 << 1)) | ^(DV_I_46_2_bit | DV_II_50_2_bit)) - MOVL W_47+188(FP), CX - MOVL W_46+184(FP), DX - SHRL $0x05, DX - XORL DX, CX - ANDL $0x00000002, CX - SUBL $0x00000002, CX - ORL $0xfeffffef, CX - ANDL CX, AX - - // mask &= ((0 - ((W[44] ^ (W[45] >> 5)) & (1 << 1))) | ^(DV_I_51_2_bit | DV_II_49_2_bit)) - MOVL W_44+176(FP), CX - MOVL W_45+180(FP), DX - SHRL $0x05, DX - XORL DX, CX - ANDL $0x00000002, CX - NEGL CX - ORL $0xffbfbfff, CX - ANDL CX, AX - - // mask &= ((((W[43] ^ W[45]) & (1 << 6)) - (1 << 6)) | ^(DV_I_47_2_bit | DV_I_49_2_bit)) - MOVL W_43+172(FP), CX - MOVL W_45+180(FP), DX - XORL DX, CX - ANDL $0x00000040, CX - SUBL $0x00000040, CX - ORL $0xfffffbbf, CX - ANDL CX, AX - - // mask &= (((((W[42] ^ W[44]) >> 6) & 1) - 1) | ^(DV_I_46_2_bit | DV_I_48_2_bit)) - MOVL W_42+168(FP), CX - MOVL W_44+176(FP), DX - XORL DX, CX - SHRL $0x06, CX - ANDL $0x00000001, CX - SUBL $0x00000001, CX - ORL $0xfffffeef, CX - ANDL CX, AX - - // mask &= ((((W[43] ^ (W[42] >> 5)) & (1 << 1)) - (1 << 1)) | ^(DV_II_46_2_bit | DV_II_51_2_bit)) - MOVL W_43+172(FP), CX - MOVL W_42+168(FP), DX - SHRL $0x05, DX - XORL DX, CX - ANDL $0x00000002, CX - SUBL $0x00000002, CX - ORL $0xfbfbffff, CX - ANDL CX, AX - - // mask &= ((((W[42] ^ (W[41] >> 5)) & (1 << 1)) - (1 << 1)) | ^(DV_I_51_2_bit | DV_II_50_2_bit)) - MOVL W_42+168(FP), CX - MOVL W_41+164(FP), DX - SHRL $0x05, DX - XORL DX, CX - ANDL $0x00000002, CX - SUBL $0x00000002, CX - ORL $0xfeffbfff, CX - ANDL CX, AX - - // mask &= ((((W[41] ^ (W[40] >> 5)) & (1 << 1)) - (1 << 1)) | ^(DV_I_50_2_bit | DV_II_49_2_bit)) - MOVL W_41+164(FP), CX - MOVL W_40+160(FP), DX - SHRL $0x05, DX - XORL DX, CX - ANDL $0x00000002, CX - SUBL $0x00000002, CX - ORL $0xffbfefff, CX - ANDL CX, AX - - // if (mask & (DV_I_52_0_bit | DV_II_51_0_bit)) != 0 { - // mask &= ((((W[39] ^ (W[43] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_I_52_0_bit | DV_II_51_0_bit)) - // } - TESTL $0x02008000, AX - JE f35 - MOVL W_39+156(FP), CX - MOVL W_43+172(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000010, CX - SUBL $0x00000010, CX - ORL $0xfdff7fff, CX - ANDL CX, AX - -f35: - // if (mask & (DV_I_51_0_bit | DV_II_50_0_bit)) != 0 { - // mask &= ((((W[38] ^ (W[42] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_I_51_0_bit | DV_II_50_0_bit)) - // } - TESTL $0x00802000, AX - JE f36 - MOVL W_38+152(FP), CX - MOVL W_42+168(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000010, CX - SUBL $0x00000010, CX - ORL $0xff7fdfff, CX - ANDL CX, AX - -f36: - // if (mask & (DV_I_48_2_bit | DV_I_51_2_bit)) != 0 { - // mask &= ((0 - ((W[37] ^ (W[38] >> 5)) & (1 << 1))) | ^(DV_I_48_2_bit | DV_I_51_2_bit)) - // } - TESTL $0x00004100, AX - JE f37 - MOVL W_37+148(FP), CX - MOVL W_38+152(FP), DX - SHRL $0x05, DX - XORL DX, CX - ANDL $0x00000002, CX - NEGL CX - ORL $0xffffbeff, CX - ANDL CX, AX - -f37: - // if (mask & (DV_I_50_0_bit | DV_II_49_0_bit)) != 0 { - // mask &= ((((W[37] ^ (W[41] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_I_50_0_bit | DV_II_49_0_bit)) - // } - TESTL $0x00200800, AX - JE f38 - MOVL W_37+148(FP), CX - MOVL W_41+164(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000010, CX - SUBL $0x00000010, CX - ORL $0xffdff7ff, CX - ANDL CX, AX - -f38: - // if (mask & (DV_II_52_0_bit | DV_II_54_0_bit)) != 0 { - // mask &= ((0 - ((W[36] ^ W[38]) & (1 << 4))) | ^(DV_II_52_0_bit | DV_II_54_0_bit)) - // } - TESTL $0x28000000, AX - JE f39 - MOVL W_36+144(FP), CX - MOVL W_38+152(FP), DX - XORL DX, CX - ANDL $0x00000010, CX - NEGL CX - ORL $0xd7ffffff, CX - ANDL CX, AX - -f39: - // mask &= ((0 - ((W[35] ^ (W[36] >> 5)) & (1 << 1))) | ^(DV_I_46_2_bit | DV_I_49_2_bit)) - MOVL W_35+140(FP), CX - MOVL W_36+144(FP), DX - SHRL $0x05, DX - XORL DX, CX - ANDL $0x00000002, CX - NEGL CX - ORL $0xfffffbef, CX - ANDL CX, AX - - // if (mask & (DV_I_51_0_bit | DV_II_47_0_bit)) != 0 { - // mask &= ((((W[35] ^ (W[39] >> 25)) & (1 << 3)) - (1 << 3)) | ^(DV_I_51_0_bit | DV_II_47_0_bit)) - // } - TESTL $0x00082000, AX - JE f40 - MOVL W_35+140(FP), CX - MOVL W_39+156(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000008, CX - SUBL $0x00000008, CX - ORL $0xfff7dfff, CX - ANDL CX, AX - -f40: - // if mask != 0 - TESTL $0x00000000, AX - JNE end - - // if (mask & DV_I_43_0_bit) != 0 { - // if not((W[61]^(W[62]>>5))&(1<<1)) != 0 || - // not(not((W[59]^(W[63]>>25))&(1<<5))) != 0 || - // not((W[58]^(W[63]>>30))&(1<<0)) != 0 { - // mask &= ^DV_I_43_0_bit - // } - // } - BTL $0x00, AX - JNC f41_skip - MOVL W_61+244(FP), CX - MOVL W_62+248(FP), DX - SHRL $0x05, DX - XORL DX, CX - ANDL $0x00000002, CX - NEGL CX - CMPL CX, $0x00000000 - JE f41_in - MOVL W_59+236(FP), CX - MOVL W_63+252(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000020, CX - CMPL CX, $0x00000000 - JNE f41_in - MOVL W_58+232(FP), CX - MOVL W_63+252(FP), DX - SHRL $0x1e, DX - XORL DX, CX - ANDL $0x00000001, CX - NEGL CX - CMPL CX, $0x00000000 - JE f41_in - JMP f41_skip - -f41_in: - ANDL $0xfffffffe, AX - -f41_skip: - // if (mask & DV_I_44_0_bit) != 0 { - // if not((W[62]^(W[63]>>5))&(1<<1)) != 0 || - // not(not((W[60]^(W[64]>>25))&(1<<5))) != 0 || - // not((W[59]^(W[64]>>30))&(1<<0)) != 0 { - // mask &= ^DV_I_44_0_bit - // } - // } - BTL $0x01, AX - JNC f42_skip - MOVL W_62+248(FP), CX - MOVL W_63+252(FP), DX - SHRL $0x05, DX - XORL DX, CX - ANDL $0x00000002, CX - NEGL CX - CMPL CX, $0x00000000 - JE f42_in - MOVL W_60+240(FP), CX - MOVL W_64+256(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000020, CX - CMPL CX, $0x00000000 - JNE f42_in - MOVL W_59+236(FP), CX - MOVL W_64+256(FP), DX - SHRL $0x1e, DX - XORL DX, CX - ANDL $0x00000001, CX - NEGL CX - CMPL CX, $0x00000000 - JE f42_in - JMP f42_skip - -f42_in: - ANDL $0xfffffffd, AX - -f42_skip: - // if (mask & DV_I_46_2_bit) != 0 { - // mask &= ((^((W[40] ^ W[42]) >> 2)) | ^DV_I_46_2_bit) - // } - BTL $0x04, AX - JNC f43 - MOVL W_40+160(FP), CX - MOVL W_42+168(FP), DX - XORL DX, CX - SHRL $0x02, CX - NOTL CX - ORL $0xffffffef, CX - ANDL CX, AX - -f43: - // if (mask & DV_I_47_2_bit) != 0 { - // if not((W[62]^(W[63]>>5))&(1<<2)) != 0 || - // not(not((W[41]^W[43])&(1<<6))) != 0 { - // mask &= ^DV_I_47_2_bit - // } - // } - BTL $0x06, AX - JNC f44_skip - MOVL W_62+248(FP), CX - MOVL W_63+252(FP), DX - SHRL $0x05, DX - XORL DX, CX - ANDL $0x00000004, CX - NEGL CX - CMPL CX, $0x00000000 - JE f44_in - MOVL W_41+164(FP), CX - MOVL W_43+172(FP), DX - XORL DX, CX - ANDL $0x00000040, CX - CMPL CX, $0x00000000 - JNE f44_in - JMP f44_skip - -f44_in: - ANDL $0xffffffbf, AX - -f44_skip: - // if (mask & DV_I_48_2_bit) != 0 { - // if not((W[63]^(W[64]>>5))&(1<<2)) != 0 || - // not(not((W[48]^(W[49]<<5))&(1<<6))) != 0 { - // mask &= ^DV_I_48_2_bit - // } - // } - BTL $0x08, AX - JNC f45_skip - MOVL W_63+252(FP), CX - MOVL W_64+256(FP), DX - SHRL $0x05, DX - XORL DX, CX - ANDL $0x00000004, CX - NEGL CX - CMPL CX, $0x00000000 - JE f45_in - MOVL W_48+192(FP), CX - MOVL W_49+196(FP), DX - SHLL $0x05, DX - XORL DX, CX - ANDL $0x00000040, CX - CMPL CX, $0x00000000 - JNE f45_in - JMP f45_skip - -f45_in: - ANDL $0xfffffeff, AX - -f45_skip: - // if (mask & DV_I_49_2_bit) != 0 { - // if not(not((W[49]^(W[50]<<5))&(1<<6))) != 0 || - // not((W[42]^W[50])&(1<<1)) != 0 || - // not(not((W[39]^(W[40]<<5))&(1<<6))) != 0 || - // not((W[38]^W[40])&(1<<1)) != 0 { - // mask &= ^DV_I_49_2_bit - // } - // } - BTL $0x0a, AX - JNC f46_skip - MOVL W_49+196(FP), CX - MOVL W_50+200(FP), DX - SHLL $0x05, DX - XORL DX, CX - ANDL $0x00000040, CX - CMPL CX, $0x00000000 - JNE f46_in - MOVL W_42+168(FP), CX - MOVL W_50+200(FP), DX - XORL DX, CX - ANDL $0x00000002, CX - CMPL CX, $0x00000000 - JE f46_in - MOVL W_39+156(FP), CX - MOVL W_40+160(FP), DX - SHLL $0x05, DX - XORL DX, CX - ANDL $0x00000040, CX - CMPL CX, $0x00000000 - JNE f46_in - MOVL W_38+152(FP), CX - MOVL W_40+160(FP), DX - XORL DX, CX - ANDL $0x00000002, CX - CMPL CX, $0x00000000 - JE f46_in - JMP f46_skip - -f46_in: - ANDL $0xfffffbff, AX - -f46_skip: - // if (mask & DV_I_50_0_bit) != 0 { - // mask &= (((W[36] ^ W[37]) << 7) | ^DV_I_50_0_bit) - // } - BTL $0x0b, AX - JNC f47 - MOVL W_36+144(FP), CX - MOVL W_37+148(FP), DX - XORL DX, CX - SHLL $0x07, CX - ORL $0xfffff7ff, CX - ANDL CX, AX - -f47: - // if (mask & DV_I_50_2_bit) != 0 { - // mask &= (((W[43] ^ W[51]) << 11) | ^DV_I_50_2_bit) - // } - BTL $0x0c, AX - JNC f48 - MOVL W_43+172(FP), CX - MOVL W_51+204(FP), DX - XORL DX, CX - SHLL $0x0b, CX - ORL $0xffffefff, CX - ANDL CX, AX - -f48: - // if (mask & DV_I_51_0_bit) != 0 { - // mask &= (((W[37] ^ W[38]) << 9) | ^DV_I_51_0_bit) - // } - BTL $0x0d, AX - JNC f49 - MOVL W_37+148(FP), CX - MOVL W_38+152(FP), DX - XORL DX, CX - SHLL $0x09, CX - ORL $0xffffdfff, CX - ANDL CX, AX - -f49: - // if (mask & DV_I_51_2_bit) != 0 { - // if not(not((W[51]^(W[52]<<5))&(1<<6))) != 0 || - // not(not((W[49]^W[51])&(1<<6))) != 0 || - // not(not((W[37]^(W[37]>>5))&(1<<1))) != 0 || - // not(not((W[35]^(W[39]>>25))&(1<<5))) != 0 { - // mask &= ^DV_I_51_2_bit - // } - // } - BTL $0x0e, AX - JNC f50_skip - MOVL W_51+204(FP), CX - MOVL W_52+208(FP), DX - SHLL $0x05, DX - XORL DX, CX - ANDL $0x00000040, CX - CMPL CX, $0x00000000 - JNE f50_in - MOVL W_49+196(FP), CX - MOVL W_51+204(FP), DX - XORL DX, CX - ANDL $0x00000040, CX - CMPL CX, $0x00000000 - JNE f50_in - MOVL W_37+148(FP), CX - MOVL W_37+148(FP), DX - SHRL $0x05, DX - XORL DX, CX - ANDL $0x00000002, CX - CMPL CX, $0x00000000 - JNE f50_in - MOVL W_35+140(FP), CX - MOVL W_39+156(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000020, CX - CMPL CX, $0x00000000 - JNE f50_in - JMP f50_skip - -f50_in: - ANDL $0xffffbfff, AX - -f50_skip: - // if (mask & DV_I_52_0_bit) != 0 { - // mask &= (((W[38] ^ W[39]) << 11) | ^DV_I_52_0_bit) - // } - BTL $0x0f, AX - JNC f51 - MOVL W_38+152(FP), CX - MOVL W_39+156(FP), DX - XORL DX, CX - SHLL $0x0b, CX - ORL $0xffff7fff, CX - ANDL CX, AX - -f51: - // if (mask & DV_II_46_2_bit) != 0 { - // mask &= (((W[47] ^ W[51]) << 17) | ^DV_II_46_2_bit) - // } - TESTL $0x00040000, AX - BTL $0x12, AX - JNC f52 - MOVL W_47+188(FP), CX - MOVL W_51+204(FP), DX - XORL DX, CX - SHLL $0x11, CX - ORL $0xfffbffff, CX - ANDL CX, AX - -f52: - // if (mask & DV_II_48_0_bit) != 0 { - // if not(not((W[36]^(W[40]>>25))&(1<<3))) != 0 || - // not((W[35]^(W[40]<<2))&(1<<30)) != 0 { - // mask &= ^DV_II_48_0_bit - // } - // } - BTL $0x14, AX - JNC f53_skip - MOVL W_36+144(FP), CX - MOVL W_40+160(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000008, CX - CMPL CX, $0x00000000 - JNE f53_in - MOVL W_35+140(FP), CX - MOVL W_40+160(FP), DX - SHLL $0x02, DX - XORL DX, CX - ANDL $0x40000000, CX - CMPL CX, $0x00000000 - JNE f53_in - JMP f53_skip - -f53_in: - ANDL $0xffefffff, AX - -f53_skip: - // if (mask & DV_II_49_0_bit) != 0 { - // if not(not((W[37]^(W[41]>>25))&(1<<3))) != 0 || - // not((W[36]^(W[41]<<2))&(1<<30)) != 0 { - // mask &= ^DV_II_49_0_bit - // } - // } - BTL $0x15, AX - JNC f54_skip - MOVL W_37+148(FP), CX - MOVL W_41+164(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000008, CX - CMPL CX, $0x00000000 - JNE f54_in - MOVL W_36+144(FP), CX - MOVL W_41+164(FP), DX - SHLL $0x02, DX - XORL DX, CX - ANDL $0x40000000, CX - CMPL CX, $0x00000000 - JNE f54_in - JMP f54_skip - -f54_in: - ANDL $0xffdfffff, AX - -f54_skip: - // if (mask & DV_II_49_2_bit) != 0 { - // if not(not((W[53]^(W[54]<<5))&(1<<6))) != 0 || - // not(not((W[51]^W[53])&(1<<6))) != 0 || - // not((W[50]^W[54])&(1<<1)) != 0 || - // not(not((W[45]^(W[46]<<5))&(1<<6))) != 0 || - // not(not((W[37]^(W[41]>>25))&(1<<5))) != 0 || - // not((W[36]^(W[41]>>30))&(1<<0)) != 0 { - // mask &= ^DV_II_49_2_bit - // } - // } - BTL $0x16, AX - JNC f55_skip - MOVL W_53+212(FP), CX - MOVL W_54+216(FP), DX - SHLL $0x05, DX - XORL DX, CX - ANDL $0x00000040, CX - CMPL CX, $0x00000000 - JNE f55_in - MOVL W_51+204(FP), CX - MOVL W_53+212(FP), DX - XORL DX, CX - ANDL $0x00000040, CX - CMPL CX, $0x00000000 - JNE f55_in - MOVL W_50+200(FP), CX - MOVL W_54+216(FP), DX - XORL DX, CX - ANDL $0x00000002, CX - NEGL CX - CMPL CX, $0x00000000 - JE f55_in - MOVL W_45+180(FP), CX - MOVL W_46+184(FP), DX - SHLL $0x05, DX - XORL DX, CX - ANDL $0x00000040, CX - CMPL CX, $0x00000000 - JNE f55_in - MOVL W_37+148(FP), CX - MOVL W_41+164(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000020, CX - CMPL CX, $0x00000000 - JNE f55_in - MOVL W_36+144(FP), CX - MOVL W_41+164(FP), DX - SHRL $0x1e, DX - XORL DX, CX - ANDL $0x00000001, CX - NEGL CX - CMPL CX, $0x00000000 - JE f55_in - JMP f55_skip - -f55_in: - ANDL $0xffbfffff, AX - -f55_skip: - // if (mask & DV_II_50_0_bit) != 0 { - // if not((W[55]^W[58])&(1<<29)) != 0 || - // not(not((W[38]^(W[42]>>25))&(1<<3))) != 0 || - // not((W[37]^(W[42]<<2))&(1<<30)) != 0 { - // mask &= ^DV_II_50_0_bit - // } - // } - BTL $0x17, AX - JNC f56_skip - MOVL W_55+220(FP), CX - MOVL W_58+232(FP), DX - XORL DX, CX - ANDL $0x20000000, CX - NEGL CX - CMPL CX, $0x00000000 - JE f56_in - MOVL W_38+152(FP), CX - MOVL W_42+168(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000008, CX - CMPL CX, $0x00000000 - JNE f56_in - MOVL W_37+148(FP), CX - MOVL W_42+168(FP), DX - SHRL $0x02, DX - XORL DX, CX - ANDL $0x40000000, CX - NEGL CX - CMPL CX, $0x00000000 - JE f56_in - JMP f56_skip - -f56_in: - ANDL $0xff7fffff, AX - -f56_skip: - // if (mask & DV_II_50_2_bit) != 0 { - // if not(not((W[54]^(W[55]<<5))&(1<<6))) != 0 || - // not(not((W[52]^W[54])&(1<<6))) != 0 || - // not((W[51]^W[55])&(1<<1)) != 0 || - // not((W[45]^W[47])&(1<<1)) != 0 || - // not(not((W[38]^(W[42]>>25))&(1<<5))) != 0 || - // not((W[37]^(W[42]>>30))&(1<<0)) != 0 { - // mask &= ^DV_II_50_2_bit - // } - // } - BTL $0x18, AX - JNC f57_skip - MOVL W_54+216(FP), CX - MOVL W_55+220(FP), DX - SHLL $0x05, DX - XORL DX, CX - ANDL $0x00000040, CX - CMPL CX, $0x00000000 - JNE f57_in - MOVL W_52+208(FP), CX - MOVL W_54+216(FP), DX - XORL DX, CX - ANDL $0x00000040, CX - CMPL CX, $0x00000000 - JNE f57_in - MOVL W_51+204(FP), CX - MOVL W_55+220(FP), DX - XORL DX, CX - ANDL $0x00000002, CX - NEGL CX - CMPL CX, $0x00000000 - JE f57_in - MOVL W_45+180(FP), CX - MOVL W_47+188(FP), DX - XORL DX, CX - ANDL $0x00000002, CX - NEGL CX - CMPL CX, $0x00000000 - JE f57_in - MOVL W_38+152(FP), CX - MOVL W_42+168(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000020, CX - CMPL CX, $0x00000000 - JNE f57_in - MOVL W_37+148(FP), CX - MOVL W_42+168(FP), DX - SHRL $0x1e, DX - XORL DX, CX - ANDL $0x00000001, CX - NEGL CX - CMPL CX, $0x00000000 - JE f57_in - JMP f57_skip - -f57_in: - ANDL $0xfeffffff, AX - -f57_skip: - // if (mask & DV_II_51_0_bit) != 0 { - // if not(not((W[39]^(W[43]>>25))&(1<<3))) != 0 || - // not((W[38]^(W[43]<<2))&(1<<30)) != 0 { - // mask &= ^DV_II_51_0_bit - // } - // } - BTL $0x19, AX - JNC f58_skip - MOVL W_39+156(FP), CX - MOVL W_43+172(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000008, CX - CMPL CX, $0x00000000 - JNE f58_in - MOVL W_38+152(FP), CX - MOVL W_43+172(FP), DX - SHLL $0x02, DX - XORL DX, CX - ANDL $0x40000000, CX - NEGL CX - CMPL CX, $0x00000000 - JE f58_in - JMP f58_skip - -f58_in: - ANDL $0xfdffffff, AX - -f58_skip: - // if (mask & DV_II_51_2_bit) != 0 { - // if not(not((W[55]^(W[56]<<5))&(1<<6))) != 0 || - // not(not((W[53]^W[55])&(1<<6))) != 0 || - // not((W[52]^W[56])&(1<<1)) != 0 || - // not((W[46]^W[48])&(1<<1)) != 0 || - // not(not((W[39]^(W[43]>>25))&(1<<5))) != 0 || - // not((W[38]^(W[43]>>30))&(1<<0)) != 0 { - // mask &= ^DV_II_51_2_bit - // } - // } - BTL $0x1a, AX - JNC f59_skip - MOVL W_55+220(FP), CX - MOVL W_56+224(FP), DX - SHLL $0x05, DX - XORL DX, CX - ANDL $0x00000040, CX - CMPL CX, $0x00000000 - JNE f59_in - MOVL W_53+212(FP), CX - MOVL W_55+220(FP), DX - XORL DX, CX - ANDL $0x00000040, CX - CMPL CX, $0x00000000 - JNE f59_in - MOVL W_52+208(FP), CX - MOVL W_56+224(FP), DX - XORL DX, CX - ANDL $0x00000002, CX - NEGL CX - CMPL CX, $0x00000000 - JE f59_in - MOVL W_46+184(FP), CX - MOVL W_48+192(FP), DX - XORL DX, CX - ANDL $0x00000002, CX - NEGL CX - CMPL CX, $0x00000000 - JE f59_in - MOVL W_39+156(FP), CX - MOVL W_43+172(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000020, CX - CMPL CX, $0x00000000 - JNE f59_in - MOVL W_38+152(FP), CX - MOVL W_43+172(FP), DX - SHRL $0x1e, DX - XORL DX, CX - ANDL $0x00000001, CX - NEGL CX - CMPL CX, $0x00000000 - JE f59_in - JMP f59_skip - -f59_in: - ANDL $0xfbffffff, AX - -f59_skip: - // if (mask & DV_II_52_0_bit) != 0 { - // if not(not((W[59]^W[60])&(1<<29))) != 0 || - // not(not((W[40]^(W[44]>>25))&(1<<3))) != 0 || - // not(not((W[40]^(W[44]>>25))&(1<<4))) != 0 || - // not((W[39]^(W[44]<<2))&(1<<30)) != 0 { - // mask &= ^DV_II_52_0_bit - // } - // } - BTL $0x1b, AX - JNC f60_skip - MOVL W_59+236(FP), CX - MOVL W_60+240(FP), DX - XORL DX, CX - ANDL $0x20000000, CX - CMPL CX, $0x00000000 - JNE f60_in - MOVL W_40+160(FP), CX - MOVL W_44+176(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000008, CX - CMPL CX, $0x00000000 - JNE f60_in - MOVL W_40+160(FP), CX - MOVL W_44+176(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000010, CX - CMPL CX, $0x00000000 - JNE f60_in - MOVL W_39+156(FP), CX - MOVL W_44+176(FP), DX - SHLL $0x02, DX - XORL DX, CX - ANDL $0x40000000, CX - NEGL CX - CMPL CX, $0x00000000 - JE f60_in - JMP f60_skip - -f60_in: - ANDL $0xf7ffffff, AX - -f60_skip: - // if (mask & DV_II_53_0_bit) != 0 { - // if not((W[58]^W[61])&(1<<29)) != 0 || - // not(not((W[57]^(W[61]>>25))&(1<<4))) != 0 || - // not(not((W[41]^(W[45]>>25))&(1<<3))) != 0 || - // not(not((W[41]^(W[45]>>25))&(1<<4))) != 0 { - // mask &= ^DV_II_53_0_bit - // } - // } - BTL $0x1c, AX - JNC f61_skip - MOVL W_58+232(FP), CX - MOVL W_61+244(FP), DX - XORL DX, CX - ANDL $0x20000000, CX - NEGL CX - CMPL CX, $0x00000000 - JE f61_in - MOVL W_57+228(FP), CX - MOVL W_61+244(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000010, CX - CMPL CX, $0x00000000 - JNE f61_in - MOVL W_41+164(FP), CX - MOVL W_45+180(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000008, CX - CMPL CX, $0x00000000 - JNE f61_in - MOVL W_41+164(FP), CX - MOVL W_45+180(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000010, CX - CMPL CX, $0x00000000 - JNE f61_in - JMP f61_skip - -f61_in: - ANDL $0xefffffff, AX - -f61_skip: - // if (mask & DV_II_54_0_bit) != 0 { - // if not(not((W[58]^(W[62]>>25))&(1<<4))) != 0 || - // not(not((W[42]^(W[46]>>25))&(1<<3))) != 0 || - // not(not((W[42]^(W[46]>>25))&(1<<4))) != 0 { - // mask &= ^DV_II_54_0_bit - // } - // } - BTL $0x1d, AX - JNC f62_skip - MOVL W_58+232(FP), CX - MOVL W_62+248(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000010, CX - CMPL CX, $0x00000000 - JNE f62_in - MOVL W_42+168(FP), CX - MOVL W_46+184(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000008, CX - CMPL CX, $0x00000000 - JNE f62_in - MOVL W_42+168(FP), CX - MOVL W_46+184(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000010, CX - CMPL CX, $0x00000000 - JNE f62_in - JMP f62_skip - -f62_in: - ANDL $0xdfffffff, AX - -f62_skip: - // if (mask & DV_II_55_0_bit) != 0 { - // if not(not((W[59]^(W[63]>>25))&(1<<4))) != 0 || - // not(not((W[57]^(W[59]>>25))&(1<<4))) != 0 || - // not(not((W[43]^(W[47]>>25))&(1<<3))) != 0 || - // not(not((W[43]^(W[47]>>25))&(1<<4))) != 0 { - // mask &= ^DV_II_55_0_bit - // } - // } - BTL $0x1e, AX - JNC f63_skip - MOVL W_59+236(FP), CX - MOVL W_63+252(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000010, CX - CMPL CX, $0x00000000 - JNE f63_in - MOVL W_57+228(FP), CX - MOVL W_59+236(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000010, CX - CMPL CX, $0x00000000 - JNE f63_in - MOVL W_43+172(FP), CX - MOVL W_47+188(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000008, CX - CMPL CX, $0x00000000 - JNE f63_in - MOVL W_43+172(FP), CX - MOVL W_47+188(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000010, CX - CMPL CX, $0x00000000 - JNE f63_in - JMP f63_skip - -f63_in: - ANDL $0xbfffffff, AX - -f63_skip: - // if (mask & DV_II_56_0_bit) != 0 { - // if not(not((W[60]^(W[64]>>25))&(1<<4))) != 0 || - // not(not((W[44]^(W[48]>>25))&(1<<3))) != 0 || - // not(not((W[44]^(W[48]>>25))&(1<<4))) != 0 { - // mask &= ^DV_II_56_0_bit - // } - // } - BTL $0x1f, AX - JNC f64_skip - MOVL W_60+240(FP), CX - MOVL W_64+256(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000010, CX - CMPL CX, $0x00000000 - JNE f64_in - MOVL W_44+176(FP), CX - MOVL W_48+192(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000008, CX - CMPL CX, $0x00000000 - JNE f64_in - MOVL W_44+176(FP), CX - MOVL W_48+192(FP), DX - SHRL $0x19, DX - XORL DX, CX - ANDL $0x00000010, CX - CMPL CX, $0x00000000 - JNE f64_in - JMP f64_skip - -f64_in: - ANDL $0x7fffffff, AX - -f64_skip: -end: - MOVL AX, ret+320(FP) - RET diff --git a/vendor/github.com/pjbgf/sha1cd/ubc/ubc_generic.go b/vendor/github.com/pjbgf/sha1cd/ubc/ubc_generic.go deleted file mode 100644 index ee95bd52d..000000000 --- a/vendor/github.com/pjbgf/sha1cd/ubc/ubc_generic.go +++ /dev/null @@ -1,368 +0,0 @@ -// Based on the C implementation from Marc Stevens and Dan Shumow. -// https://github.com/cr-marcstevens/sha1collisiondetection - -package ubc - -type DvInfo struct { - // DvType, DvK and DvB define the DV: I(K,B) or II(K,B) (see the paper). - // https://marc-stevens.nl/research/papers/C13-S.pdf - DvType uint32 - DvK uint32 - DvB uint32 - - // TestT is the step to do the recompression from for collision detection. - TestT uint32 - - // MaskI and MaskB define the bit to check for each DV in the dvmask returned by ubc_check. - MaskI uint32 - MaskB uint32 - - // Dm is the expanded message block XOR-difference defined by the DV. - Dm [80]uint32 -} - -// CalculateDvMask takes as input an expanded message block and verifies the unavoidable bitconditions -// for all listed DVs. It returns a dvmask where each bit belonging to a DV is set if all -// unavoidable bitconditions for that DV have been met. -// Thus, one needs to do the recompression check for each DV that has its bit set. -func CalculateDvMaskGeneric(W [80]uint32) uint32 { - mask := uint32(0xFFFFFFFF) - mask &= (((((W[44] ^ W[45]) >> 29) & 1) - 1) | ^(DV_I_48_0_bit | DV_I_51_0_bit | DV_I_52_0_bit | DV_II_45_0_bit | DV_II_46_0_bit | DV_II_50_0_bit | DV_II_51_0_bit)) - mask &= (((((W[49] ^ W[50]) >> 29) & 1) - 1) | ^(DV_I_46_0_bit | DV_II_45_0_bit | DV_II_50_0_bit | DV_II_51_0_bit | DV_II_55_0_bit | DV_II_56_0_bit)) - mask &= (((((W[48] ^ W[49]) >> 29) & 1) - 1) | ^(DV_I_45_0_bit | DV_I_52_0_bit | DV_II_49_0_bit | DV_II_50_0_bit | DV_II_54_0_bit | DV_II_55_0_bit)) - mask &= ((((W[47] ^ (W[50] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_I_47_0_bit | DV_I_49_0_bit | DV_I_51_0_bit | DV_II_45_0_bit | DV_II_51_0_bit | DV_II_56_0_bit)) - mask &= (((((W[47] ^ W[48]) >> 29) & 1) - 1) | ^(DV_I_44_0_bit | DV_I_51_0_bit | DV_II_48_0_bit | DV_II_49_0_bit | DV_II_53_0_bit | DV_II_54_0_bit)) - mask &= (((((W[46] >> 4) ^ (W[49] >> 29)) & 1) - 1) | ^(DV_I_46_0_bit | DV_I_48_0_bit | DV_I_50_0_bit | DV_I_52_0_bit | DV_II_50_0_bit | DV_II_55_0_bit)) - mask &= (((((W[46] ^ W[47]) >> 29) & 1) - 1) | ^(DV_I_43_0_bit | DV_I_50_0_bit | DV_II_47_0_bit | DV_II_48_0_bit | DV_II_52_0_bit | DV_II_53_0_bit)) - mask &= (((((W[45] >> 4) ^ (W[48] >> 29)) & 1) - 1) | ^(DV_I_45_0_bit | DV_I_47_0_bit | DV_I_49_0_bit | DV_I_51_0_bit | DV_II_49_0_bit | DV_II_54_0_bit)) - mask &= (((((W[45] ^ W[46]) >> 29) & 1) - 1) | ^(DV_I_49_0_bit | DV_I_52_0_bit | DV_II_46_0_bit | DV_II_47_0_bit | DV_II_51_0_bit | DV_II_52_0_bit)) - mask &= (((((W[44] >> 4) ^ (W[47] >> 29)) & 1) - 1) | ^(DV_I_44_0_bit | DV_I_46_0_bit | DV_I_48_0_bit | DV_I_50_0_bit | DV_II_48_0_bit | DV_II_53_0_bit)) - mask &= (((((W[43] >> 4) ^ (W[46] >> 29)) & 1) - 1) | ^(DV_I_43_0_bit | DV_I_45_0_bit | DV_I_47_0_bit | DV_I_49_0_bit | DV_II_47_0_bit | DV_II_52_0_bit)) - mask &= (((((W[43] ^ W[44]) >> 29) & 1) - 1) | ^(DV_I_47_0_bit | DV_I_50_0_bit | DV_I_51_0_bit | DV_II_45_0_bit | DV_II_49_0_bit | DV_II_50_0_bit)) - mask &= (((((W[42] >> 4) ^ (W[45] >> 29)) & 1) - 1) | ^(DV_I_44_0_bit | DV_I_46_0_bit | DV_I_48_0_bit | DV_I_52_0_bit | DV_II_46_0_bit | DV_II_51_0_bit)) - mask &= (((((W[41] >> 4) ^ (W[44] >> 29)) & 1) - 1) | ^(DV_I_43_0_bit | DV_I_45_0_bit | DV_I_47_0_bit | DV_I_51_0_bit | DV_II_45_0_bit | DV_II_50_0_bit)) - mask &= (((((W[40] ^ W[41]) >> 29) & 1) - 1) | ^(DV_I_44_0_bit | DV_I_47_0_bit | DV_I_48_0_bit | DV_II_46_0_bit | DV_II_47_0_bit | DV_II_56_0_bit)) - mask &= (((((W[54] ^ W[55]) >> 29) & 1) - 1) | ^(DV_I_51_0_bit | DV_II_47_0_bit | DV_II_50_0_bit | DV_II_55_0_bit | DV_II_56_0_bit)) - mask &= (((((W[53] ^ W[54]) >> 29) & 1) - 1) | ^(DV_I_50_0_bit | DV_II_46_0_bit | DV_II_49_0_bit | DV_II_54_0_bit | DV_II_55_0_bit)) - mask &= (((((W[52] ^ W[53]) >> 29) & 1) - 1) | ^(DV_I_49_0_bit | DV_II_45_0_bit | DV_II_48_0_bit | DV_II_53_0_bit | DV_II_54_0_bit)) - mask &= ((((W[50] ^ (W[53] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_I_50_0_bit | DV_I_52_0_bit | DV_II_46_0_bit | DV_II_48_0_bit | DV_II_54_0_bit)) - mask &= (((((W[50] ^ W[51]) >> 29) & 1) - 1) | ^(DV_I_47_0_bit | DV_II_46_0_bit | DV_II_51_0_bit | DV_II_52_0_bit | DV_II_56_0_bit)) - mask &= ((((W[49] ^ (W[52] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_I_49_0_bit | DV_I_51_0_bit | DV_II_45_0_bit | DV_II_47_0_bit | DV_II_53_0_bit)) - mask &= ((((W[48] ^ (W[51] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_I_48_0_bit | DV_I_50_0_bit | DV_I_52_0_bit | DV_II_46_0_bit | DV_II_52_0_bit)) - mask &= (((((W[42] ^ W[43]) >> 29) & 1) - 1) | ^(DV_I_46_0_bit | DV_I_49_0_bit | DV_I_50_0_bit | DV_II_48_0_bit | DV_II_49_0_bit)) - mask &= (((((W[41] ^ W[42]) >> 29) & 1) - 1) | ^(DV_I_45_0_bit | DV_I_48_0_bit | DV_I_49_0_bit | DV_II_47_0_bit | DV_II_48_0_bit)) - mask &= (((((W[40] >> 4) ^ (W[43] >> 29)) & 1) - 1) | ^(DV_I_44_0_bit | DV_I_46_0_bit | DV_I_50_0_bit | DV_II_49_0_bit | DV_II_56_0_bit)) - mask &= (((((W[39] >> 4) ^ (W[42] >> 29)) & 1) - 1) | ^(DV_I_43_0_bit | DV_I_45_0_bit | DV_I_49_0_bit | DV_II_48_0_bit | DV_II_55_0_bit)) - - if (mask & (DV_I_44_0_bit | DV_I_48_0_bit | DV_II_47_0_bit | DV_II_54_0_bit | DV_II_56_0_bit)) != 0 { - mask &= (((((W[38] >> 4) ^ (W[41] >> 29)) & 1) - 1) | ^(DV_I_44_0_bit | DV_I_48_0_bit | DV_II_47_0_bit | DV_II_54_0_bit | DV_II_56_0_bit)) - } - mask &= (((((W[37] >> 4) ^ (W[40] >> 29)) & 1) - 1) | ^(DV_I_43_0_bit | DV_I_47_0_bit | DV_II_46_0_bit | DV_II_53_0_bit | DV_II_55_0_bit)) - if (mask & (DV_I_52_0_bit | DV_II_48_0_bit | DV_II_51_0_bit | DV_II_56_0_bit)) != 0 { - mask &= (((((W[55] ^ W[56]) >> 29) & 1) - 1) | ^(DV_I_52_0_bit | DV_II_48_0_bit | DV_II_51_0_bit | DV_II_56_0_bit)) - } - if (mask & (DV_I_52_0_bit | DV_II_48_0_bit | DV_II_50_0_bit | DV_II_56_0_bit)) != 0 { - mask &= ((((W[52] ^ (W[55] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_I_52_0_bit | DV_II_48_0_bit | DV_II_50_0_bit | DV_II_56_0_bit)) - } - if (mask & (DV_I_51_0_bit | DV_II_47_0_bit | DV_II_49_0_bit | DV_II_55_0_bit)) != 0 { - mask &= ((((W[51] ^ (W[54] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_I_51_0_bit | DV_II_47_0_bit | DV_II_49_0_bit | DV_II_55_0_bit)) - } - if (mask & (DV_I_48_0_bit | DV_II_47_0_bit | DV_II_52_0_bit | DV_II_53_0_bit)) != 0 { - mask &= (((((W[51] ^ W[52]) >> 29) & 1) - 1) | ^(DV_I_48_0_bit | DV_II_47_0_bit | DV_II_52_0_bit | DV_II_53_0_bit)) - } - if (mask & (DV_I_46_0_bit | DV_I_49_0_bit | DV_II_45_0_bit | DV_II_48_0_bit)) != 0 { - mask &= (((((W[36] >> 4) ^ (W[40] >> 29)) & 1) - 1) | ^(DV_I_46_0_bit | DV_I_49_0_bit | DV_II_45_0_bit | DV_II_48_0_bit)) - } - if (mask & (DV_I_52_0_bit | DV_II_48_0_bit | DV_II_49_0_bit)) != 0 { - mask &= ((0 - (((W[53] ^ W[56]) >> 29) & 1)) | ^(DV_I_52_0_bit | DV_II_48_0_bit | DV_II_49_0_bit)) - } - if (mask & (DV_I_50_0_bit | DV_II_46_0_bit | DV_II_47_0_bit)) != 0 { - mask &= ((0 - (((W[51] ^ W[54]) >> 29) & 1)) | ^(DV_I_50_0_bit | DV_II_46_0_bit | DV_II_47_0_bit)) - } - if (mask & (DV_I_49_0_bit | DV_I_51_0_bit | DV_II_45_0_bit)) != 0 { - mask &= ((0 - (((W[50] ^ W[52]) >> 29) & 1)) | ^(DV_I_49_0_bit | DV_I_51_0_bit | DV_II_45_0_bit)) - } - if (mask & (DV_I_48_0_bit | DV_I_50_0_bit | DV_I_52_0_bit)) != 0 { - mask &= ((0 - (((W[49] ^ W[51]) >> 29) & 1)) | ^(DV_I_48_0_bit | DV_I_50_0_bit | DV_I_52_0_bit)) - } - if (mask & (DV_I_47_0_bit | DV_I_49_0_bit | DV_I_51_0_bit)) != 0 { - mask &= ((0 - (((W[48] ^ W[50]) >> 29) & 1)) | ^(DV_I_47_0_bit | DV_I_49_0_bit | DV_I_51_0_bit)) - } - if (mask & (DV_I_46_0_bit | DV_I_48_0_bit | DV_I_50_0_bit)) != 0 { - mask &= ((0 - (((W[47] ^ W[49]) >> 29) & 1)) | ^(DV_I_46_0_bit | DV_I_48_0_bit | DV_I_50_0_bit)) - } - if (mask & (DV_I_45_0_bit | DV_I_47_0_bit | DV_I_49_0_bit)) != 0 { - mask &= ((0 - (((W[46] ^ W[48]) >> 29) & 1)) | ^(DV_I_45_0_bit | DV_I_47_0_bit | DV_I_49_0_bit)) - } - mask &= ((((W[45] ^ W[47]) & (1 << 6)) - (1 << 6)) | ^(DV_I_47_2_bit | DV_I_49_2_bit | DV_I_51_2_bit)) - if (mask & (DV_I_44_0_bit | DV_I_46_0_bit | DV_I_48_0_bit)) != 0 { - mask &= ((0 - (((W[45] ^ W[47]) >> 29) & 1)) | ^(DV_I_44_0_bit | DV_I_46_0_bit | DV_I_48_0_bit)) - } - mask &= (((((W[44] ^ W[46]) >> 6) & 1) - 1) | ^(DV_I_46_2_bit | DV_I_48_2_bit | DV_I_50_2_bit)) - if (mask & (DV_I_43_0_bit | DV_I_45_0_bit | DV_I_47_0_bit)) != 0 { - mask &= ((0 - (((W[44] ^ W[46]) >> 29) & 1)) | ^(DV_I_43_0_bit | DV_I_45_0_bit | DV_I_47_0_bit)) - } - mask &= ((0 - ((W[41] ^ (W[42] >> 5)) & (1 << 1))) | ^(DV_I_48_2_bit | DV_II_46_2_bit | DV_II_51_2_bit)) - mask &= ((0 - ((W[40] ^ (W[41] >> 5)) & (1 << 1))) | ^(DV_I_47_2_bit | DV_I_51_2_bit | DV_II_50_2_bit)) - if (mask & (DV_I_44_0_bit | DV_I_46_0_bit | DV_II_56_0_bit)) != 0 { - mask &= ((0 - (((W[40] ^ W[42]) >> 4) & 1)) | ^(DV_I_44_0_bit | DV_I_46_0_bit | DV_II_56_0_bit)) - } - mask &= ((0 - ((W[39] ^ (W[40] >> 5)) & (1 << 1))) | ^(DV_I_46_2_bit | DV_I_50_2_bit | DV_II_49_2_bit)) - if (mask & (DV_I_43_0_bit | DV_I_45_0_bit | DV_II_55_0_bit)) != 0 { - mask &= ((0 - (((W[39] ^ W[41]) >> 4) & 1)) | ^(DV_I_43_0_bit | DV_I_45_0_bit | DV_II_55_0_bit)) - } - if (mask & (DV_I_44_0_bit | DV_II_54_0_bit | DV_II_56_0_bit)) != 0 { - mask &= ((0 - (((W[38] ^ W[40]) >> 4) & 1)) | ^(DV_I_44_0_bit | DV_II_54_0_bit | DV_II_56_0_bit)) - } - if (mask & (DV_I_43_0_bit | DV_II_53_0_bit | DV_II_55_0_bit)) != 0 { - mask &= ((0 - (((W[37] ^ W[39]) >> 4) & 1)) | ^(DV_I_43_0_bit | DV_II_53_0_bit | DV_II_55_0_bit)) - } - mask &= ((0 - ((W[36] ^ (W[37] >> 5)) & (1 << 1))) | ^(DV_I_47_2_bit | DV_I_50_2_bit | DV_II_46_2_bit)) - if (mask & (DV_I_45_0_bit | DV_I_48_0_bit | DV_II_47_0_bit)) != 0 { - mask &= (((((W[35] >> 4) ^ (W[39] >> 29)) & 1) - 1) | ^(DV_I_45_0_bit | DV_I_48_0_bit | DV_II_47_0_bit)) - } - if (mask & (DV_I_48_0_bit | DV_II_48_0_bit)) != 0 { - mask &= ((0 - ((W[63] ^ (W[64] >> 5)) & (1 << 0))) | ^(DV_I_48_0_bit | DV_II_48_0_bit)) - } - if (mask & (DV_I_45_0_bit | DV_II_45_0_bit)) != 0 { - mask &= ((0 - ((W[63] ^ (W[64] >> 5)) & (1 << 1))) | ^(DV_I_45_0_bit | DV_II_45_0_bit)) - } - if (mask & (DV_I_47_0_bit | DV_II_47_0_bit)) != 0 { - mask &= ((0 - ((W[62] ^ (W[63] >> 5)) & (1 << 0))) | ^(DV_I_47_0_bit | DV_II_47_0_bit)) - } - if (mask & (DV_I_46_0_bit | DV_II_46_0_bit)) != 0 { - mask &= ((0 - ((W[61] ^ (W[62] >> 5)) & (1 << 0))) | ^(DV_I_46_0_bit | DV_II_46_0_bit)) - } - mask &= ((0 - ((W[61] ^ (W[62] >> 5)) & (1 << 2))) | ^(DV_I_46_2_bit | DV_II_46_2_bit)) - if (mask & (DV_I_45_0_bit | DV_II_45_0_bit)) != 0 { - mask &= ((0 - ((W[60] ^ (W[61] >> 5)) & (1 << 0))) | ^(DV_I_45_0_bit | DV_II_45_0_bit)) - } - if (mask & (DV_II_51_0_bit | DV_II_54_0_bit)) != 0 { - mask &= (((((W[58] ^ W[59]) >> 29) & 1) - 1) | ^(DV_II_51_0_bit | DV_II_54_0_bit)) - } - if (mask & (DV_II_50_0_bit | DV_II_53_0_bit)) != 0 { - mask &= (((((W[57] ^ W[58]) >> 29) & 1) - 1) | ^(DV_II_50_0_bit | DV_II_53_0_bit)) - } - if (mask & (DV_II_52_0_bit | DV_II_54_0_bit)) != 0 { - mask &= ((((W[56] ^ (W[59] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_II_52_0_bit | DV_II_54_0_bit)) - } - if (mask & (DV_II_51_0_bit | DV_II_52_0_bit)) != 0 { - mask &= ((0 - (((W[56] ^ W[59]) >> 29) & 1)) | ^(DV_II_51_0_bit | DV_II_52_0_bit)) - } - if (mask & (DV_II_49_0_bit | DV_II_52_0_bit)) != 0 { - mask &= (((((W[56] ^ W[57]) >> 29) & 1) - 1) | ^(DV_II_49_0_bit | DV_II_52_0_bit)) - } - if (mask & (DV_II_51_0_bit | DV_II_53_0_bit)) != 0 { - mask &= ((((W[55] ^ (W[58] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_II_51_0_bit | DV_II_53_0_bit)) - } - if (mask & (DV_II_50_0_bit | DV_II_52_0_bit)) != 0 { - mask &= ((((W[54] ^ (W[57] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_II_50_0_bit | DV_II_52_0_bit)) - } - if (mask & (DV_II_49_0_bit | DV_II_51_0_bit)) != 0 { - mask &= ((((W[53] ^ (W[56] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_II_49_0_bit | DV_II_51_0_bit)) - } - mask &= ((((W[51] ^ (W[50] >> 5)) & (1 << 1)) - (1 << 1)) | ^(DV_I_50_2_bit | DV_II_46_2_bit)) - mask &= ((((W[48] ^ W[50]) & (1 << 6)) - (1 << 6)) | ^(DV_I_50_2_bit | DV_II_46_2_bit)) - if (mask & (DV_I_51_0_bit | DV_I_52_0_bit)) != 0 { - mask &= ((0 - (((W[48] ^ W[55]) >> 29) & 1)) | ^(DV_I_51_0_bit | DV_I_52_0_bit)) - } - mask &= ((((W[47] ^ W[49]) & (1 << 6)) - (1 << 6)) | ^(DV_I_49_2_bit | DV_I_51_2_bit)) - mask &= ((((W[48] ^ (W[47] >> 5)) & (1 << 1)) - (1 << 1)) | ^(DV_I_47_2_bit | DV_II_51_2_bit)) - mask &= ((((W[46] ^ W[48]) & (1 << 6)) - (1 << 6)) | ^(DV_I_48_2_bit | DV_I_50_2_bit)) - mask &= ((((W[47] ^ (W[46] >> 5)) & (1 << 1)) - (1 << 1)) | ^(DV_I_46_2_bit | DV_II_50_2_bit)) - mask &= ((0 - ((W[44] ^ (W[45] >> 5)) & (1 << 1))) | ^(DV_I_51_2_bit | DV_II_49_2_bit)) - mask &= ((((W[43] ^ W[45]) & (1 << 6)) - (1 << 6)) | ^(DV_I_47_2_bit | DV_I_49_2_bit)) - mask &= (((((W[42] ^ W[44]) >> 6) & 1) - 1) | ^(DV_I_46_2_bit | DV_I_48_2_bit)) - mask &= ((((W[43] ^ (W[42] >> 5)) & (1 << 1)) - (1 << 1)) | ^(DV_II_46_2_bit | DV_II_51_2_bit)) - mask &= ((((W[42] ^ (W[41] >> 5)) & (1 << 1)) - (1 << 1)) | ^(DV_I_51_2_bit | DV_II_50_2_bit)) - mask &= ((((W[41] ^ (W[40] >> 5)) & (1 << 1)) - (1 << 1)) | ^(DV_I_50_2_bit | DV_II_49_2_bit)) - if (mask & (DV_I_52_0_bit | DV_II_51_0_bit)) != 0 { - mask &= ((((W[39] ^ (W[43] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_I_52_0_bit | DV_II_51_0_bit)) - } - if (mask & (DV_I_51_0_bit | DV_II_50_0_bit)) != 0 { - mask &= ((((W[38] ^ (W[42] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_I_51_0_bit | DV_II_50_0_bit)) - } - if (mask & (DV_I_48_2_bit | DV_I_51_2_bit)) != 0 { - mask &= ((0 - ((W[37] ^ (W[38] >> 5)) & (1 << 1))) | ^(DV_I_48_2_bit | DV_I_51_2_bit)) - } - if (mask & (DV_I_50_0_bit | DV_II_49_0_bit)) != 0 { - mask &= ((((W[37] ^ (W[41] >> 25)) & (1 << 4)) - (1 << 4)) | ^(DV_I_50_0_bit | DV_II_49_0_bit)) - } - if (mask & (DV_II_52_0_bit | DV_II_54_0_bit)) != 0 { - mask &= ((0 - ((W[36] ^ W[38]) & (1 << 4))) | ^(DV_II_52_0_bit | DV_II_54_0_bit)) - } - mask &= ((0 - ((W[35] ^ (W[36] >> 5)) & (1 << 1))) | ^(DV_I_46_2_bit | DV_I_49_2_bit)) - if (mask & (DV_I_51_0_bit | DV_II_47_0_bit)) != 0 { - mask &= ((((W[35] ^ (W[39] >> 25)) & (1 << 3)) - (1 << 3)) | ^(DV_I_51_0_bit | DV_II_47_0_bit)) - } - - if mask != 0 { - if (mask & DV_I_43_0_bit) != 0 { - if not((W[61]^(W[62]>>5))&(1<<1)) != 0 || - not(not((W[59]^(W[63]>>25))&(1<<5))) != 0 || - not((W[58]^(W[63]>>30))&(1<<0)) != 0 { - mask &= ^DV_I_43_0_bit - } - } - if (mask & DV_I_44_0_bit) != 0 { - if not((W[62]^(W[63]>>5))&(1<<1)) != 0 || - not(not((W[60]^(W[64]>>25))&(1<<5))) != 0 || - not((W[59]^(W[64]>>30))&(1<<0)) != 0 { - mask &= ^DV_I_44_0_bit - } - } - if (mask & DV_I_46_2_bit) != 0 { - mask &= ((^((W[40] ^ W[42]) >> 2)) | ^DV_I_46_2_bit) - } - if (mask & DV_I_47_2_bit) != 0 { - if not((W[62]^(W[63]>>5))&(1<<2)) != 0 || - not(not((W[41]^W[43])&(1<<6))) != 0 { - mask &= ^DV_I_47_2_bit - } - } - if (mask & DV_I_48_2_bit) != 0 { - if not((W[63]^(W[64]>>5))&(1<<2)) != 0 || - not(not((W[48]^(W[49]<<5))&(1<<6))) != 0 { - mask &= ^DV_I_48_2_bit - } - } - if (mask & DV_I_49_2_bit) != 0 { - if not(not((W[49]^(W[50]<<5))&(1<<6))) != 0 || - not((W[42]^W[50])&(1<<1)) != 0 || - not(not((W[39]^(W[40]<<5))&(1<<6))) != 0 || - not((W[38]^W[40])&(1<<1)) != 0 { - mask &= ^DV_I_49_2_bit - } - } - if (mask & DV_I_50_0_bit) != 0 { - mask &= (((W[36] ^ W[37]) << 7) | ^DV_I_50_0_bit) - } - if (mask & DV_I_50_2_bit) != 0 { - mask &= (((W[43] ^ W[51]) << 11) | ^DV_I_50_2_bit) - } - if (mask & DV_I_51_0_bit) != 0 { - mask &= (((W[37] ^ W[38]) << 9) | ^DV_I_51_0_bit) - } - if (mask & DV_I_51_2_bit) != 0 { - if not(not((W[51]^(W[52]<<5))&(1<<6))) != 0 || - not(not((W[49]^W[51])&(1<<6))) != 0 || - not(not((W[37]^(W[37]>>5))&(1<<1))) != 0 || - not(not((W[35]^(W[39]>>25))&(1<<5))) != 0 { - mask &= ^DV_I_51_2_bit - } - } - if (mask & DV_I_52_0_bit) != 0 { - mask &= (((W[38] ^ W[39]) << 11) | ^DV_I_52_0_bit) - } - if (mask & DV_II_46_2_bit) != 0 { - mask &= (((W[47] ^ W[51]) << 17) | ^DV_II_46_2_bit) - } - if (mask & DV_II_48_0_bit) != 0 { - if not(not((W[36]^(W[40]>>25))&(1<<3))) != 0 || - not((W[35]^(W[40]<<2))&(1<<30)) != 0 { - mask &= ^DV_II_48_0_bit - } - } - if (mask & DV_II_49_0_bit) != 0 { - if not(not((W[37]^(W[41]>>25))&(1<<3))) != 0 || - not((W[36]^(W[41]<<2))&(1<<30)) != 0 { - mask &= ^DV_II_49_0_bit - } - } - if (mask & DV_II_49_2_bit) != 0 { - if not(not((W[53]^(W[54]<<5))&(1<<6))) != 0 || - not(not((W[51]^W[53])&(1<<6))) != 0 || - not((W[50]^W[54])&(1<<1)) != 0 || - not(not((W[45]^(W[46]<<5))&(1<<6))) != 0 || - not(not((W[37]^(W[41]>>25))&(1<<5))) != 0 || - not((W[36]^(W[41]>>30))&(1<<0)) != 0 { - mask &= ^DV_II_49_2_bit - } - } - if (mask & DV_II_50_0_bit) != 0 { - if not((W[55]^W[58])&(1<<29)) != 0 || - not(not((W[38]^(W[42]>>25))&(1<<3))) != 0 || - not((W[37]^(W[42]<<2))&(1<<30)) != 0 { - mask &= ^DV_II_50_0_bit - } - } - if (mask & DV_II_50_2_bit) != 0 { - if not(not((W[54]^(W[55]<<5))&(1<<6))) != 0 || - not(not((W[52]^W[54])&(1<<6))) != 0 || - not((W[51]^W[55])&(1<<1)) != 0 || - not((W[45]^W[47])&(1<<1)) != 0 || - not(not((W[38]^(W[42]>>25))&(1<<5))) != 0 || - not((W[37]^(W[42]>>30))&(1<<0)) != 0 { - mask &= ^DV_II_50_2_bit - } - } - if (mask & DV_II_51_0_bit) != 0 { - if not(not((W[39]^(W[43]>>25))&(1<<3))) != 0 || - not((W[38]^(W[43]<<2))&(1<<30)) != 0 { - mask &= ^DV_II_51_0_bit - } - } - if (mask & DV_II_51_2_bit) != 0 { - if not(not((W[55]^(W[56]<<5))&(1<<6))) != 0 || - not(not((W[53]^W[55])&(1<<6))) != 0 || - not((W[52]^W[56])&(1<<1)) != 0 || - not((W[46]^W[48])&(1<<1)) != 0 || - not(not((W[39]^(W[43]>>25))&(1<<5))) != 0 || - not((W[38]^(W[43]>>30))&(1<<0)) != 0 { - mask &= ^DV_II_51_2_bit - } - } - if (mask & DV_II_52_0_bit) != 0 { - if not(not((W[59]^W[60])&(1<<29))) != 0 || - not(not((W[40]^(W[44]>>25))&(1<<3))) != 0 || - not(not((W[40]^(W[44]>>25))&(1<<4))) != 0 || - not((W[39]^(W[44]<<2))&(1<<30)) != 0 { - mask &= ^DV_II_52_0_bit - } - } - if (mask & DV_II_53_0_bit) != 0 { - if not((W[58]^W[61])&(1<<29)) != 0 || - not(not((W[57]^(W[61]>>25))&(1<<4))) != 0 || - not(not((W[41]^(W[45]>>25))&(1<<3))) != 0 || - not(not((W[41]^(W[45]>>25))&(1<<4))) != 0 { - mask &= ^DV_II_53_0_bit - } - } - if (mask & DV_II_54_0_bit) != 0 { - if not(not((W[58]^(W[62]>>25))&(1<<4))) != 0 || - not(not((W[42]^(W[46]>>25))&(1<<3))) != 0 || - not(not((W[42]^(W[46]>>25))&(1<<4))) != 0 { - mask &= ^DV_II_54_0_bit - } - } - if (mask & DV_II_55_0_bit) != 0 { - if not(not((W[59]^(W[63]>>25))&(1<<4))) != 0 || - not(not((W[57]^(W[59]>>25))&(1<<4))) != 0 || - not(not((W[43]^(W[47]>>25))&(1<<3))) != 0 || - not(not((W[43]^(W[47]>>25))&(1<<4))) != 0 { - mask &= ^DV_II_55_0_bit - } - } - if (mask & DV_II_56_0_bit) != 0 { - if not(not((W[60]^(W[64]>>25))&(1<<4))) != 0 || - not(not((W[44]^(W[48]>>25))&(1<<3))) != 0 || - not(not((W[44]^(W[48]>>25))&(1<<4))) != 0 { - mask &= ^DV_II_56_0_bit - } - } - } - - return mask -} - -func not(x uint32) uint32 { - if x == 0 { - return 1 - } - - return 0 -} - -func SHA1_dvs() []DvInfo { - return sha1_dvs -} diff --git a/vendor/github.com/pjbgf/sha1cd/ubc/ubc_noasm.go b/vendor/github.com/pjbgf/sha1cd/ubc/ubc_noasm.go deleted file mode 100644 index 48d6dff16..000000000 --- a/vendor/github.com/pjbgf/sha1cd/ubc/ubc_noasm.go +++ /dev/null @@ -1,12 +0,0 @@ -//go:build !amd64 || noasm || !gc -// +build !amd64 noasm !gc - -package ubc - -// Check takes as input an expanded message block and verifies the unavoidable bitconditions -// for all listed DVs. It returns a dvmask where each bit belonging to a DV is set if all -// unavoidable bitconditions for that DV have been met. -// Thus, one needs to do the recompression check for each DV that has its bit set. -func CalculateDvMask(W [80]uint32) uint32 { - return CalculateDvMaskGeneric(W) -} diff --git a/vendor/golang.org/x/exp/maps/maps.go b/vendor/golang.org/x/exp/maps/maps.go index c25939b92..4a9747ef4 100644 --- a/vendor/golang.org/x/exp/maps/maps.go +++ b/vendor/golang.org/x/exp/maps/maps.go @@ -7,17 +7,13 @@ package maps import "maps" -// TODO(adonovan): when https://go.dev/issue/32816 is accepted, all of -// these functions except Keys and Values should be annotated -// (provisionally with "//go:fix inline") so that tools can safely and -// automatically replace calls to exp/maps with calls to std maps by -// inlining them. - // Keys returns the keys of the map m. // The keys will be in an indeterminate order. +// +// The simplest true equivalent using the standard library is: +// +// slices.AppendSeq(make([]K, 0, len(m)), maps.Keys(m)) func Keys[M ~map[K]V, K comparable, V any](m M) []K { - // The simplest true equivalent using std is: - // return slices.AppendSeq(make([]K, 0, len(m)), maps.Keys(m)). r := make([]K, 0, len(m)) for k := range m { @@ -28,9 +24,11 @@ func Keys[M ~map[K]V, K comparable, V any](m M) []K { // Values returns the values of the map m. // The values will be in an indeterminate order. +// +// The simplest true equivalent using the standard library is: +// +// slices.AppendSeq(make([]V, 0, len(m)), maps.Values(m)) func Values[M ~map[K]V, K comparable, V any](m M) []V { - // The simplest true equivalent using std is: - // return slices.AppendSeq(make([]V, 0, len(m)), maps.Values(m)). r := make([]V, 0, len(m)) for _, v := range m { @@ -41,23 +39,31 @@ func Values[M ~map[K]V, K comparable, V any](m M) []V { // Equal reports whether two maps contain the same key/value pairs. // Values are compared using ==. +// +//go:fix inline func Equal[M1, M2 ~map[K]V, K, V comparable](m1 M1, m2 M2) bool { return maps.Equal(m1, m2) } // EqualFunc is like Equal, but compares values using eq. // Keys are still compared with ==. +// +//go:fix inline func EqualFunc[M1 ~map[K]V1, M2 ~map[K]V2, K comparable, V1, V2 any](m1 M1, m2 M2, eq func(V1, V2) bool) bool { return maps.EqualFunc(m1, m2, eq) } // Clear removes all entries from m, leaving it empty. +// +//go:fix inline func Clear[M ~map[K]V, K comparable, V any](m M) { clear(m) } // Clone returns a copy of m. This is a shallow clone: // the new keys and values are set using ordinary assignment. +// +//go:fix inline func Clone[M ~map[K]V, K comparable, V any](m M) M { return maps.Clone(m) } @@ -66,11 +72,15 @@ func Clone[M ~map[K]V, K comparable, V any](m M) M { // When a key in src is already present in dst, // the value in dst will be overwritten by the value associated // with the key in src. +// +//go:fix inline func Copy[M1 ~map[K]V, M2 ~map[K]V, K comparable, V any](dst M1, src M2) { maps.Copy(dst, src) } // DeleteFunc deletes any key/value pairs from m for which del returns true. +// +//go:fix inline func DeleteFunc[M ~map[K]V, K comparable, V any](m M, del func(K, V) bool) { maps.DeleteFunc(m, del) } diff --git a/vendor/golang.org/x/exp/slices/slices.go b/vendor/golang.org/x/exp/slices/slices.go index 757383ea1..da0df370d 100644 --- a/vendor/golang.org/x/exp/slices/slices.go +++ b/vendor/golang.org/x/exp/slices/slices.go @@ -10,16 +10,13 @@ import ( "slices" ) -// TODO(adonovan): when https://go.dev/issue/32816 is accepted, all of -// these functions should be annotated (provisionally with "//go:fix -// inline") so that tools can safely and automatically replace calls -// to exp/slices with calls to std slices by inlining them. - // Equal reports whether two slices are equal: the same length and all // elements equal. If the lengths are different, Equal returns false. // Otherwise, the elements are compared in increasing index order, and the // comparison stops at the first unequal pair. // Floating point NaNs are not considered equal. +// +//go:fix inline func Equal[S ~[]E, E comparable](s1, s2 S) bool { return slices.Equal(s1, s2) } @@ -29,6 +26,8 @@ func Equal[S ~[]E, E comparable](s1, s2 S) bool { // EqualFunc returns false. Otherwise, the elements are compared in // increasing index order, and the comparison stops at the first index // for which eq returns false. +// +//go:fix inline func EqualFunc[S1 ~[]E1, S2 ~[]E2, E1, E2 any](s1 S1, s2 S2, eq func(E1, E2) bool) bool { return slices.EqualFunc(s1, s2, eq) } @@ -40,6 +39,8 @@ func EqualFunc[S1 ~[]E1, S2 ~[]E2, E1, E2 any](s1 S1, s2 S2, eq func(E1, E2) boo // If both slices are equal until one of them ends, the shorter slice is // considered less than the longer one. // The result is 0 if s1 == s2, -1 if s1 < s2, and +1 if s1 > s2. +// +//go:fix inline func Compare[S ~[]E, E cmp.Ordered](s1, s2 S) int { return slices.Compare(s1, s2) } @@ -49,29 +50,39 @@ func Compare[S ~[]E, E cmp.Ordered](s1, s2 S) int { // The result is the first non-zero result of cmp; if cmp always // returns 0 the result is 0 if len(s1) == len(s2), -1 if len(s1) < len(s2), // and +1 if len(s1) > len(s2). +// +//go:fix inline func CompareFunc[S1 ~[]E1, S2 ~[]E2, E1, E2 any](s1 S1, s2 S2, cmp func(E1, E2) int) int { return slices.CompareFunc(s1, s2, cmp) } // Index returns the index of the first occurrence of v in s, // or -1 if not present. +// +//go:fix inline func Index[S ~[]E, E comparable](s S, v E) int { return slices.Index(s, v) } // IndexFunc returns the first index i satisfying f(s[i]), // or -1 if none do. +// +//go:fix inline func IndexFunc[S ~[]E, E any](s S, f func(E) bool) int { return slices.IndexFunc(s, f) } // Contains reports whether v is present in s. +// +//go:fix inline func Contains[S ~[]E, E comparable](s S, v E) bool { return slices.Contains(s, v) } // ContainsFunc reports whether at least one // element e of s satisfies f(e). +// +//go:fix inline func ContainsFunc[S ~[]E, E any](s S, f func(E) bool) bool { return slices.ContainsFunc(s, f) } @@ -83,6 +94,8 @@ func ContainsFunc[S ~[]E, E any](s S, f func(E) bool) bool { // and r[i+len(v)] == value originally at r[i]. // Insert panics if i is out of range. // This function is O(len(s) + len(v)). +// +//go:fix inline func Insert[S ~[]E, E any](s S, i int, v ...E) S { return slices.Insert(s, i, v...) } @@ -92,6 +105,8 @@ func Insert[S ~[]E, E any](s S, i int, v ...E) S { // Delete is O(len(s)-i), so if many items must be deleted, it is better to // make a single call deleting them all together than to delete one at a time. // Delete zeroes the elements s[len(s)-(j-i):len(s)]. +// +//go:fix inline func Delete[S ~[]E, E any](s S, i, j int) S { return slices.Delete(s, i, j) } @@ -99,6 +114,8 @@ func Delete[S ~[]E, E any](s S, i, j int) S { // DeleteFunc removes any elements from s for which del returns true, // returning the modified slice. // DeleteFunc zeroes the elements between the new length and the original length. +// +//go:fix inline func DeleteFunc[S ~[]E, E any](s S, del func(E) bool) S { return slices.DeleteFunc(s, del) } @@ -106,12 +123,16 @@ func DeleteFunc[S ~[]E, E any](s S, del func(E) bool) S { // Replace replaces the elements s[i:j] by the given v, and returns the // modified slice. Replace panics if s[i:j] is not a valid slice of s. // When len(v) < (j-i), Replace zeroes the elements between the new length and the original length. +// +//go:fix inline func Replace[S ~[]E, E any](s S, i, j int, v ...E) S { return slices.Replace(s, i, j, v...) } // Clone returns a copy of the slice. // The elements are copied using assignment, so this is a shallow clone. +// +//go:fix inline func Clone[S ~[]E, E any](s S) S { return slices.Clone(s) } @@ -121,6 +142,8 @@ func Clone[S ~[]E, E any](s S) S { // Compact modifies the contents of the slice s and returns the modified slice, // which may have a smaller length. // Compact zeroes the elements between the new length and the original length. +// +//go:fix inline func Compact[S ~[]E, E comparable](s S) S { return slices.Compact(s) } @@ -128,6 +151,8 @@ func Compact[S ~[]E, E comparable](s S) S { // CompactFunc is like [Compact] but uses an equality function to compare elements. // For runs of elements that compare equal, CompactFunc keeps the first one. // CompactFunc zeroes the elements between the new length and the original length. +// +//go:fix inline func CompactFunc[S ~[]E, E any](s S, eq func(E, E) bool) S { return slices.CompactFunc(s, eq) } @@ -136,16 +161,22 @@ func CompactFunc[S ~[]E, E any](s S, eq func(E, E) bool) S { // another n elements. After Grow(n), at least n elements can be appended // to the slice without another allocation. If n is negative or too large to // allocate the memory, Grow panics. +// +//go:fix inline func Grow[S ~[]E, E any](s S, n int) S { return slices.Grow(s, n) } // Clip removes unused capacity from the slice, returning s[:len(s):len(s)]. +// +//go:fix inline func Clip[S ~[]E, E any](s S) S { return slices.Clip(s) } // Reverse reverses the elements of the slice in place. +// +//go:fix inline func Reverse[S ~[]E, E any](s S) { slices.Reverse(s) } diff --git a/vendor/golang.org/x/exp/slices/sort.go b/vendor/golang.org/x/exp/slices/sort.go index e270a7465..bd91a8d40 100644 --- a/vendor/golang.org/x/exp/slices/sort.go +++ b/vendor/golang.org/x/exp/slices/sort.go @@ -9,11 +9,10 @@ import ( "slices" ) -// TODO(adonovan): add a "//go:fix inline" annotation to each function -// in this file; see https://go.dev/issue/32816. - // Sort sorts a slice of any ordered type in ascending order. // When sorting floating-point numbers, NaNs are ordered before other values. +// +//go:fix inline func Sort[S ~[]E, E cmp.Ordered](x S) { slices.Sort(x) } @@ -27,23 +26,31 @@ func Sort[S ~[]E, E cmp.Ordered](x S) { // SortFunc requires that cmp is a strict weak ordering. // See https://en.wikipedia.org/wiki/Weak_ordering#Strict_weak_orderings. // To indicate 'uncomparable', return 0 from the function. +// +//go:fix inline func SortFunc[S ~[]E, E any](x S, cmp func(a, b E) int) { slices.SortFunc(x, cmp) } // SortStableFunc sorts the slice x while keeping the original order of equal // elements, using cmp to compare elements in the same way as [SortFunc]. +// +//go:fix inline func SortStableFunc[S ~[]E, E any](x S, cmp func(a, b E) int) { slices.SortStableFunc(x, cmp) } // IsSorted reports whether x is sorted in ascending order. +// +//go:fix inline func IsSorted[S ~[]E, E cmp.Ordered](x S) bool { return slices.IsSorted(x) } // IsSortedFunc reports whether x is sorted in ascending order, with cmp as the // comparison function as defined by [SortFunc]. +// +//go:fix inline func IsSortedFunc[S ~[]E, E any](x S, cmp func(a, b E) int) bool { return slices.IsSortedFunc(x, cmp) } @@ -51,6 +58,8 @@ func IsSortedFunc[S ~[]E, E any](x S, cmp func(a, b E) int) bool { // Min returns the minimal value in x. It panics if x is empty. // For floating-point numbers, Min propagates NaNs (any NaN value in x // forces the output to be NaN). +// +//go:fix inline func Min[S ~[]E, E cmp.Ordered](x S) E { return slices.Min(x) } @@ -58,6 +67,8 @@ func Min[S ~[]E, E cmp.Ordered](x S) E { // MinFunc returns the minimal value in x, using cmp to compare elements. // It panics if x is empty. If there is more than one minimal element // according to the cmp function, MinFunc returns the first one. +// +//go:fix inline func MinFunc[S ~[]E, E any](x S, cmp func(a, b E) int) E { return slices.MinFunc(x, cmp) } @@ -65,6 +76,8 @@ func MinFunc[S ~[]E, E any](x S, cmp func(a, b E) int) E { // Max returns the maximal value in x. It panics if x is empty. // For floating-point E, Max propagates NaNs (any NaN value in x // forces the output to be NaN). +// +//go:fix inline func Max[S ~[]E, E cmp.Ordered](x S) E { return slices.Max(x) } @@ -72,6 +85,8 @@ func Max[S ~[]E, E cmp.Ordered](x S) E { // MaxFunc returns the maximal value in x, using cmp to compare elements. // It panics if x is empty. If there is more than one maximal element // according to the cmp function, MaxFunc returns the first one. +// +//go:fix inline func MaxFunc[S ~[]E, E any](x S, cmp func(a, b E) int) E { return slices.MaxFunc(x, cmp) } @@ -80,6 +95,8 @@ func MaxFunc[S ~[]E, E any](x S, cmp func(a, b E) int) E { // where target is found, or the position where target would appear in the // sort order; it also returns a bool saying whether the target is really found // in the slice. The slice must be sorted in increasing order. +// +//go:fix inline func BinarySearch[S ~[]E, E cmp.Ordered](x S, target E) (int, bool) { return slices.BinarySearch(x, target) } @@ -91,6 +108,8 @@ func BinarySearch[S ~[]E, E cmp.Ordered](x S, target E) (int, bool) { // or a positive number if the slice element follows the target. // cmp must implement the same ordering as the slice, such that if // cmp(a, t) < 0 and cmp(b, t) >= 0, then a must precede b in the slice. +// +//go:fix inline func BinarySearchFunc[S ~[]E, E, T any](x S, target T, cmp func(E, T) int) (int, bool) { return slices.BinarySearchFunc(x, target, cmp) } diff --git a/vendor/modules.txt b/vendor/modules.txt index 7ad152201..f4ceb38be 100644 --- a/vendor/modules.txt +++ b/vendor/modules.txt @@ -341,19 +341,10 @@ github.com/cs3org/go-cs3apis/cs3/storage/provider/v1beta1 github.com/cs3org/go-cs3apis/cs3/storage/registry/v1beta1 github.com/cs3org/go-cs3apis/cs3/tx/v1beta1 github.com/cs3org/go-cs3apis/cs3/types/v1beta1 -# github.com/cyphar/filepath-securejoin v0.5.1 +# github.com/cyphar/filepath-securejoin v0.6.1 ## explicit; go 1.18 github.com/cyphar/filepath-securejoin github.com/cyphar/filepath-securejoin/internal/consts -github.com/cyphar/filepath-securejoin/pathrs-lite -github.com/cyphar/filepath-securejoin/pathrs-lite/internal -github.com/cyphar/filepath-securejoin/pathrs-lite/internal/assert -github.com/cyphar/filepath-securejoin/pathrs-lite/internal/fd -github.com/cyphar/filepath-securejoin/pathrs-lite/internal/gocompat -github.com/cyphar/filepath-securejoin/pathrs-lite/internal/kernelversion -github.com/cyphar/filepath-securejoin/pathrs-lite/internal/linux -github.com/cyphar/filepath-securejoin/pathrs-lite/internal/procfs -github.com/cyphar/filepath-securejoin/pathrs-lite/procfs # github.com/davecgh/go-spew v1.1.2-0.20180830191138-d8f796af33cc ## explicit github.com/davecgh/go-spew/spew @@ -471,16 +462,16 @@ github.com/go-git/gcfg github.com/go-git/gcfg/scanner github.com/go-git/gcfg/token github.com/go-git/gcfg/types -# github.com/go-git/go-billy/v5 v5.8.0 -## explicit; go 1.24.0 +# github.com/go-git/go-billy/v5 v5.9.0 +## explicit; go 1.25.0 github.com/go-git/go-billy/v5 github.com/go-git/go-billy/v5/helper/chroot github.com/go-git/go-billy/v5/helper/polyfill github.com/go-git/go-billy/v5/memfs github.com/go-git/go-billy/v5/osfs github.com/go-git/go-billy/v5/util -# github.com/go-git/go-git/v5 v5.18.0 -## explicit; go 1.24.0 +# github.com/go-git/go-git/v5 v5.19.0 +## explicit; go 1.25.0 github.com/go-git/go-git/v5 github.com/go-git/go-git/v5/config github.com/go-git/go-git/v5/internal/path_util @@ -868,7 +859,7 @@ github.com/klauspost/compress/s2 github.com/klauspost/compress/snappy github.com/klauspost/compress/zstd github.com/klauspost/compress/zstd/internal/xxhash -# github.com/klauspost/cpuid/v2 v2.2.11 +# github.com/klauspost/cpuid/v2 v2.3.0 ## explicit; go 1.22 github.com/klauspost/cpuid/v2 # github.com/klauspost/crc32 v1.3.0 @@ -1371,7 +1362,7 @@ github.com/opencloud-eu/icap-client # github.com/opencloud-eu/libre-graph-api-go v1.0.8-0.20260310090739-853d972b282d ## explicit; go 1.18 github.com/opencloud-eu/libre-graph-api-go -# github.com/opencloud-eu/reva/v2 v2.43.1-0.20260512061040-cd4be86c66b0 +# github.com/opencloud-eu/reva/v2 v2.44.1-0.20260513122109-583a11875721 ## explicit; go 1.25.0 github.com/opencloud-eu/reva/v2/cmd/revad/internal/grace github.com/opencloud-eu/reva/v2/cmd/revad/runtime @@ -1798,8 +1789,8 @@ github.com/pierrec/lz4/v4/internal/lz4block github.com/pierrec/lz4/v4/internal/lz4errors github.com/pierrec/lz4/v4/internal/lz4stream github.com/pierrec/lz4/v4/internal/xxh32 -# github.com/pjbgf/sha1cd v0.3.2 -## explicit; go 1.21 +# github.com/pjbgf/sha1cd v0.6.0 +## explicit; go 1.22 github.com/pjbgf/sha1cd github.com/pjbgf/sha1cd/internal github.com/pjbgf/sha1cd/ubc @@ -2446,8 +2437,8 @@ golang.org/x/crypto/ssh golang.org/x/crypto/ssh/agent golang.org/x/crypto/ssh/internal/bcrypt_pbkdf golang.org/x/crypto/ssh/knownhosts -# golang.org/x/exp v0.0.0-20250210185358-939b2ce775ac -## explicit; go 1.22.0 +# golang.org/x/exp v0.0.0-20260410095643-746e56fc9e2f +## explicit; go 1.25.0 golang.org/x/exp/maps golang.org/x/exp/slices golang.org/x/exp/slog