chore(dependencies): bump reva

go.mod

@@ -56,7 +56,7 @@ require (
 	github.com/mna/pigeon v1.3.0
 	github.com/mohae/deepcopy v0.0.0-20170929034955-c48cc78d4826
 	github.com/nats-io/nats-server/v2 v2.11.7
-	github.com/nats-io/nats.go v1.43.0
+	github.com/nats-io/nats.go v1.44.0
 	github.com/oklog/run v1.2.0
 	github.com/olekukonko/tablewriter v1.0.8
 	github.com/onsi/ginkgo v1.16.5
@@ -64,7 +64,7 @@ require (
 	github.com/onsi/gomega v1.38.0
 	github.com/open-policy-agent/opa v1.6.0
 	github.com/opencloud-eu/libre-graph-api-go v1.0.8-0.20250724122329-41ba6b191e76
-	github.com/opencloud-eu/reva/v2 v2.36.0
+	github.com/opencloud-eu/reva/v2 v2.36.1-0.20250814151758-19625996460b
 	github.com/orcaman/concurrent-map v1.0.0
 	github.com/pkg/errors v0.9.1
 	github.com/pkg/xattr v0.4.12
@@ -97,17 +97,17 @@ require (
 	go.opentelemetry.io/otel/exporters/otlp/otlptrace/otlptracegrpc v1.37.0
 	go.opentelemetry.io/otel/sdk v1.37.0
 	go.opentelemetry.io/otel/trace v1.37.0
-	golang.org/x/crypto v0.40.0
+	golang.org/x/crypto v0.41.0
 	golang.org/x/exp v0.0.0-20250210185358-939b2ce775ac
 	golang.org/x/image v0.30.0
 	golang.org/x/net v0.42.0
 	golang.org/x/oauth2 v0.30.0
 	golang.org/x/sync v0.16.0
-	golang.org/x/term v0.33.0
+	golang.org/x/term v0.34.0
 	golang.org/x/text v0.28.0
 	google.golang.org/genproto/googleapis/api v0.0.0-20250603155806-513f23925822
 	google.golang.org/grpc v1.74.0
-	google.golang.org/protobuf v1.36.6
+	google.golang.org/protobuf v1.36.7
 	gopkg.in/yaml.v2 v2.4.0
 	gotest.tools/v3 v3.5.2
 	stash.kopano.io/kgol/rndm v1.1.2
@@ -238,7 +238,7 @@ require (
 	github.com/juliangruber/go-intersect v1.1.0 // indirect
 	github.com/kevinburke/ssh_config v1.2.0 // indirect
 	github.com/klauspost/compress v1.18.0 // indirect
-	github.com/klauspost/cpuid/v2 v2.2.10 // indirect
+	github.com/klauspost/cpuid/v2 v2.2.11 // indirect
 	github.com/leodido/go-urn v1.4.0 // indirect
 	github.com/libregraph/oidc-go v1.1.0 // indirect
 	github.com/longsleep/go-metrics v1.0.0 // indirect
@@ -252,10 +252,10 @@ require (
 	github.com/mendsley/gojwk v0.0.0-20141217222730-4d5ec6e58103 // indirect
 	github.com/miekg/dns v1.1.57 // indirect
 	github.com/mileusna/useragent v1.3.5 // indirect
-	github.com/minio/crc64nvme v1.0.1 // indirect
+	github.com/minio/crc64nvme v1.0.2 // indirect
 	github.com/minio/highwayhash v1.0.3 // indirect
 	github.com/minio/md5-simd v1.1.2 // indirect
-	github.com/minio/minio-go/v7 v7.0.94 // indirect
+	github.com/minio/minio-go/v7 v7.0.95 // indirect
 	github.com/mitchellh/copystructure v1.2.0 // indirect
 	github.com/mitchellh/reflectwalk v1.0.2 // indirect
 	github.com/modern-go/concurrent v0.0.0-20180306012644-bacd9c7ef1dd // indirect
@@ -273,7 +273,7 @@ require (
 	github.com/pablodz/inotifywaitgo v0.0.9 // indirect
 	github.com/patrickmn/go-cache v2.1.0+incompatible // indirect
 	github.com/pbnjay/memory v0.0.0-20210728143218-7b4eea64cf58 // indirect
-	github.com/philhofer/fwd v1.1.3-0.20240916144458-20a13a1f6b7c // indirect
+	github.com/philhofer/fwd v1.2.0 // indirect
 	github.com/pierrec/lz4/v4 v4.1.15 // indirect
 	github.com/pjbgf/sha1cd v0.3.2 // indirect
 	github.com/pmezard/go-difflib v1.0.1-0.20181226105442-5d4384ee4fb2 // indirect
@@ -317,9 +317,9 @@ require (
 	github.com/xo/terminfo v0.0.0-20220910002029-abceb7e1c41e // indirect
 	github.com/xrash/smetrics v0.0.0-20240521201337-686a1a2994c1 // indirect
 	github.com/yashtewari/glob-intersection v0.2.0 // indirect
-	go.etcd.io/etcd/api/v3 v3.6.2 // indirect
+	go.etcd.io/etcd/api/v3 v3.6.4 // indirect
-	go.etcd.io/etcd/client/pkg/v3 v3.6.2 // indirect
+	go.etcd.io/etcd/client/pkg/v3 v3.6.4 // indirect
-	go.etcd.io/etcd/client/v3 v3.6.2 // indirect
+	go.etcd.io/etcd/client/v3 v3.6.4 // indirect
 	go.opencensus.io v0.24.0 // indirect
 	go.opentelemetry.io/auto/sdk v1.1.0 // indirect
 	go.opentelemetry.io/otel/exporters/otlp/otlptrace v1.37.0 // indirect
@@ -329,7 +329,7 @@ require (
 	go.uber.org/multierr v1.11.0 // indirect
 	go.uber.org/zap v1.27.0 // indirect
 	golang.org/x/mod v0.26.0 // indirect
-	golang.org/x/sys v0.34.0 // indirect
+	golang.org/x/sys v0.35.0 // indirect
 	golang.org/x/time v0.12.0 // indirect
 	golang.org/x/tools v0.35.0 // indirect
 	golang.org/x/xerrors v0.0.0-20220907171357-04be3eba64a2 // indirect

go.sum

@@ -687,8 +687,8 @@ github.com/klauspost/compress v1.15.9/go.mod h1:PhcZ0MbTNciWF3rruxRgKxI5NkcHHrHU
 github.com/klauspost/compress v1.18.0 h1:c/Cqfb0r+Yi+JtIEq73FWXVkRonBlf0CRNYc8Zttxdo=
 github.com/klauspost/compress v1.18.0/go.mod h1:2Pp+KzxcywXVXMr50+X0Q/Lsb43OQHYWRCY2AiWywWQ=
 github.com/klauspost/cpuid/v2 v2.0.1/go.mod h1:FInQzS24/EEf25PyTYn52gqo7WaD8xa0213Md/qVLRg=
-github.com/klauspost/cpuid/v2 v2.2.10 h1:tBs3QSyvjDyFTq3uoc/9xFpCuOsJQFNPiAhYdw2skhE=
+github.com/klauspost/cpuid/v2 v2.2.11 h1:0OwqZRYI2rFrjS4kvkDnqJkKHdHaRnCm68/DY4OxRzU=
-github.com/klauspost/cpuid/v2 v2.2.10/go.mod h1:hqwkgyIinND0mEev00jJYCxPNVRVXFQeu1XKlok6oO0=
+github.com/klauspost/cpuid/v2 v2.2.11/go.mod h1:hqwkgyIinND0mEev00jJYCxPNVRVXFQeu1XKlok6oO0=
 github.com/kobergj/gowebdav v0.0.0-20250102091030-aa65266db202 h1:A1xJ2NKgiYFiaHiLl9B5yw/gUBACSs9crDykTS3GuQI=
 github.com/kobergj/gowebdav v0.0.0-20250102091030-aa65266db202/go.mod h1:bHA7t77X/QFExdeAnDzK6vKM34kEZAcE1OX4MfiwjkE=
 github.com/kolo/xmlrpc v0.0.0-20200310150728-e0350524596b/go.mod h1:o03bZfuBwAXHetKXuInt4S7omeXUu62/A845kiycsSQ=
@@ -777,14 +777,14 @@ github.com/miekg/dns v1.1.57 h1:Jzi7ApEIzwEPLHWRcafCN9LZSBbqQpxjt/wpgvg7wcM=
 github.com/miekg/dns v1.1.57/go.mod h1:uqRjCRUuEAA6qsOiJvDd+CFo/vW+y5WR6SNmHE55hZk=
 github.com/mileusna/useragent v1.3.5 h1:SJM5NzBmh/hO+4LGeATKpaEX9+b4vcGg2qXGLiNGDws=
 github.com/mileusna/useragent v1.3.5/go.mod h1:3d8TOmwL/5I8pJjyVDteHtgDGcefrFUX4ccGOMKNYYc=
-github.com/minio/crc64nvme v1.0.1 h1:DHQPrYPdqK7jQG/Ls5CTBZWeex/2FMS3G5XGkycuFrY=
+github.com/minio/crc64nvme v1.0.2 h1:6uO1UxGAD+kwqWWp7mBFsi5gAse66C4NXO8cmcVculg=
-github.com/minio/crc64nvme v1.0.1/go.mod h1:eVfm2fAzLlxMdUGc0EEBGSMmPwmXD5XiNRpnu9J3bvg=
+github.com/minio/crc64nvme v1.0.2/go.mod h1:eVfm2fAzLlxMdUGc0EEBGSMmPwmXD5XiNRpnu9J3bvg=
 github.com/minio/highwayhash v1.0.3 h1:kbnuUMoHYyVl7szWjSxJnxw11k2U709jqFPPmIUyD6Q=
 github.com/minio/highwayhash v1.0.3/go.mod h1:GGYsuwP/fPD6Y9hMiXuapVvlIUEhFhMTh0rxU3ik1LQ=
 github.com/minio/md5-simd v1.1.2 h1:Gdi1DZK69+ZVMoNHRXJyNcxrMA4dSxoYHZSQbirFg34=
 github.com/minio/md5-simd v1.1.2/go.mod h1:MzdKDxYpY2BT9XQFocsiZf/NKVtR7nkE4RoEpN+20RM=
-github.com/minio/minio-go/v7 v7.0.94 h1:1ZoksIKPyaSt64AVOyaQvhDOgVC3MfZsWM6mZXRUGtM=
+github.com/minio/minio-go/v7 v7.0.95 h1:ywOUPg+PebTMTzn9VDsoFJy32ZuARN9zhB+K3IYEvYU=
-github.com/minio/minio-go/v7 v7.0.94/go.mod h1:71t2CqDt3ThzESgZUlU1rBN54mksGGlkLcFgguDnnAc=
+github.com/minio/minio-go/v7 v7.0.95/go.mod h1:wOOX3uxS334vImCNRVyIDdXX9OsXDm89ToynKgqUKlo=
 github.com/mitchellh/cli v1.0.0/go.mod h1:hNIlj7HEI86fIcpObd7a0FcrxTWetlwJDGcceTlRvqc=
 github.com/mitchellh/copystructure v1.2.0 h1:vpKXTN4ewci03Vljg/q9QvCGUDttBOGBIa15WveJJGw=
 github.com/mitchellh/copystructure v1.2.0/go.mod h1:qLl+cE2AmVv+CoeAwDPye/v+N2HKCj9FbZEVFJRxO9s=
@@ -823,8 +823,8 @@ github.com/nats-io/jwt/v2 v2.7.4 h1:jXFuDDxs/GQjGDZGhNgH4tXzSUK6WQi2rsj4xmsNOtI=
 github.com/nats-io/jwt/v2 v2.7.4/go.mod h1:me11pOkwObtcBNR8AiMrUbtVOUGkqYjMQZ6jnSdVUIA=
 github.com/nats-io/nats-server/v2 v2.11.7 h1:lINWQ/Hb3cnaoHmWTjj/7WppZnaSh9C/1cD//nHCbms=
 github.com/nats-io/nats-server/v2 v2.11.7/go.mod h1:DchDPVzAsAPqhqm7VLedX0L7hjnV/SYtlmsl9F8U53s=
-github.com/nats-io/nats.go v1.43.0 h1:uRFZ2FEoRvP64+UUhaTokyS18XBCR/xM2vQZKO4i8ug=
+github.com/nats-io/nats.go v1.44.0 h1:ECKVrDLdh/kDPV1g0gAQ+2+m2KprqZK5O/eJAyAnH2M=
-github.com/nats-io/nats.go v1.43.0/go.mod h1:iRWIPokVIFbVijxuMQq4y9ttaBTMe0SFdlZfMDd+33g=
+github.com/nats-io/nats.go v1.44.0/go.mod h1:iRWIPokVIFbVijxuMQq4y9ttaBTMe0SFdlZfMDd+33g=
 github.com/nats-io/nkeys v0.4.11 h1:q44qGV008kYd9W1b1nEBkNzvnWxtRSQ7A8BoqRrcfa0=
 github.com/nats-io/nkeys v0.4.11/go.mod h1:szDimtgmfOi9n25JpfIdGw12tZFYXqhGxjhVxsatHVE=
 github.com/nats-io/nuid v1.0.1 h1:5iA8DT8V7q8WK2EScv2padNa/rTESc1KdnPw4TC2paw=
@@ -868,8 +868,8 @@ github.com/opencloud-eu/go-micro-plugins/v4/store/nats-js-kv v0.0.0-202505121527
 github.com/opencloud-eu/go-micro-plugins/v4/store/nats-js-kv v0.0.0-20250512152754-23325793059a/go.mod h1:pjcozWijkNPbEtX5SIQaxEW/h8VAVZYTLx+70bmB3LY=
 github.com/opencloud-eu/libre-graph-api-go v1.0.8-0.20250724122329-41ba6b191e76 h1:vD/EdfDUrv4omSFjrinT8Mvf+8D7f9g4vgQ2oiDrVUI=
 github.com/opencloud-eu/libre-graph-api-go v1.0.8-0.20250724122329-41ba6b191e76/go.mod h1:pzatilMEHZFT3qV7C/X3MqOa3NlRQuYhlRhZTL+hN6Q=
-github.com/opencloud-eu/reva/v2 v2.36.0 h1:5FBjhXqW8F4v7F76vGYpH7IGuRtcbKHoyOyj3syG7W8=
+github.com/opencloud-eu/reva/v2 v2.36.1-0.20250814151758-19625996460b h1:8yoJkKcaI/DXKeUn0lIkkPFzxMOrgnFdI/CYvbYQoOU=
-github.com/opencloud-eu/reva/v2 v2.36.0/go.mod h1:/FyYaUWxtllu8TOcIIx53BjChc+hSpcQicBI/OTICjw=
+github.com/opencloud-eu/reva/v2 v2.36.1-0.20250814151758-19625996460b/go.mod h1:4zNxGNmc4CJ39YBI2vhGr7zTfUxPAV1mkjsBvaODACw=
 github.com/opentracing/opentracing-go v1.1.0/go.mod h1:UkNAQd3GIcIGf0SeVgPpRdFStlNbqXla1AfSYxPUl2o=
 github.com/opentracing/opentracing-go v1.2.0 h1:uEJPy/1a5RIPAJ0Ov+OIO8OxWu77jEv+1B0VhjKrZUs=
 github.com/opentracing/opentracing-go v1.2.0/go.mod h1:GxEUsuufX4nBwe+T+Wl9TAgYrxe9dPLANfrWvHYVTgc=
@@ -891,8 +891,8 @@ github.com/pelletier/go-toml v1.2.0/go.mod h1:5z9KED0ma1S8pY6P1sdut58dfprrGBbd/9
 github.com/pelletier/go-toml v1.8.1/go.mod h1:T2/BmBdy8dvIRq1a/8aqjN41wvWlN4lrapLU/GW4pbc=
 github.com/phayes/freeport v0.0.0-20220201140144-74d24b5ae9f5 h1:Ii+DKncOVM8Cu1Hc+ETb5K+23HdAMvESYE3ZJ5b5cMI=
 github.com/phayes/freeport v0.0.0-20220201140144-74d24b5ae9f5/go.mod h1:iIss55rKnNBTvrwdmkUpLnDpZoAHvWaiq5+iMmen4AE=
-github.com/philhofer/fwd v1.1.3-0.20240916144458-20a13a1f6b7c h1:dAMKvw0MlJT1GshSTtih8C2gDs04w8dReiOGXrGLNoY=
+github.com/philhofer/fwd v1.2.0 h1:e6DnBTl7vGY+Gz322/ASL4Gyp1FspeMvx1RNDoToZuM=
-github.com/philhofer/fwd v1.1.3-0.20240916144458-20a13a1f6b7c/go.mod h1:RqIHx9QI14HlwKwm98g9Re5prTQ6LdeRQn+gXJFxsJM=
+github.com/philhofer/fwd v1.2.0/go.mod h1:RqIHx9QI14HlwKwm98g9Re5prTQ6LdeRQn+gXJFxsJM=
 github.com/pierrec/lz4 v2.0.5+incompatible/go.mod h1:pdkljMzZIN41W+lC3N2tnIh5sFi+IEE17M5jbnwPHcY=
 github.com/pierrec/lz4/v4 v4.1.15 h1:MO0/ucJhngq7299dKLwIMtgTfbkoSPF6AoMYDd8Q4q0=
 github.com/pierrec/lz4/v4 v4.1.15/go.mod h1:gZWDp/Ze/IJXGXf23ltt2EXimqmTUXEy0GFuRQyBid4=
@@ -1157,12 +1157,12 @@ github.com/yusufpapurcu/wmi v1.2.4/go.mod h1:SBZ9tNy3G9/m5Oi98Zks0QjeHVDvuK0qfxQ
 go.etcd.io/bbolt v1.3.2/go.mod h1:IbVyRI1SCnLcuJnV2u8VeU0CEYM7e686BmAb1XKL+uU=
 go.etcd.io/bbolt v1.4.2 h1:IrUHp260R8c+zYx/Tm8QZr04CX+qWS5PGfPdevhdm1I=
 go.etcd.io/bbolt v1.4.2/go.mod h1:Is8rSHO/b4f3XigBC0lL0+4FwAQv3HXEEIgFMuKHceM=
-go.etcd.io/etcd/api/v3 v3.6.2 h1:25aCkIMjUmiiOtnBIp6PhNj4KdcURuBak0hU2P1fgRc=
+go.etcd.io/etcd/api/v3 v3.6.4 h1:7F6N7toCKcV72QmoUKa23yYLiiljMrT4xCeBL9BmXdo=
-go.etcd.io/etcd/api/v3 v3.6.2/go.mod h1:eFhhvfR8Px1P6SEuLT600v+vrhdDTdcfMzmnxVXXSbk=
+go.etcd.io/etcd/api/v3 v3.6.4/go.mod h1:eFhhvfR8Px1P6SEuLT600v+vrhdDTdcfMzmnxVXXSbk=
-go.etcd.io/etcd/client/pkg/v3 v3.6.2 h1:zw+HRghi/G8fKpgKdOcEKpnBTE4OO39T6MegA0RopVU=
+go.etcd.io/etcd/client/pkg/v3 v3.6.4 h1:9HBYrjppeOfFjBjaMTRxT3R7xT0GLK8EJMVC4xg6ok0=
-go.etcd.io/etcd/client/pkg/v3 v3.6.2/go.mod h1:sbdzr2cl3HzVmxNw//PH7aLGVtY4QySjQFuaCgcRFAI=
+go.etcd.io/etcd/client/pkg/v3 v3.6.4/go.mod h1:sbdzr2cl3HzVmxNw//PH7aLGVtY4QySjQFuaCgcRFAI=
-go.etcd.io/etcd/client/v3 v3.6.2 h1:RgmcLJxkpHqpFvgKNwAQHX3K+wsSARMXKgjmUSpoSKQ=
+go.etcd.io/etcd/client/v3 v3.6.4 h1:YOMrCfMhRzY8NgtzUsHl8hC2EBSnuqbR3dh84Uryl7A=
-go.etcd.io/etcd/client/v3 v3.6.2/go.mod h1:PL7e5QMKzjybn0FosgiWvCUDzvdChpo5UgGR4Sk4Gzc=
+go.etcd.io/etcd/client/v3 v3.6.4/go.mod h1:jaNNHCyg2FdALyKWnd7hxZXZxZANb0+KGY+YQaEMISo=
 go.opencensus.io v0.20.1/go.mod h1:6WKK9ahsWS3RSO+PY9ZHZUfv2irvY6gN279GOPZjmmk=
 go.opencensus.io v0.20.2/go.mod h1:6WKK9ahsWS3RSO+PY9ZHZUfv2irvY6gN279GOPZjmmk=
 go.opencensus.io v0.21.0/go.mod h1:mSImk1erAIZhrmZN+AvHh14ztQfjbGwt4TtuofqLduU=
@@ -1239,8 +1239,8 @@ golang.org/x/crypto v0.14.0/go.mod h1:MVFd36DqK4CsrnJYDkBA3VC4m2GkXAM0PvzMCn4JQf
 golang.org/x/crypto v0.19.0/go.mod h1:Iy9bg/ha4yyC70EfRS8jz+B6ybOBKMaSxLj6P6oBDfU=
 golang.org/x/crypto v0.21.0/go.mod h1:0BP7YvVV9gBbVKyeTG0Gyn+gZm94bibOW5BjDEYAOMs=
 golang.org/x/crypto v0.23.0/go.mod h1:CKFgDieR+mRhux2Lsu27y0fO304Db0wZe70UKqHu0v8=
-golang.org/x/crypto v0.40.0 h1:r4x+VvoG5Fm+eJcxMaY8CQM7Lb0l1lsmjGBQ6s8BfKM=
+golang.org/x/crypto v0.41.0 h1:WKYxWedPGCTVVl5+WHSSrOBT0O8lx32+zxmHxijgXp4=
-golang.org/x/crypto v0.40.0/go.mod h1:Qr1vMER5WyS2dfPHAlsOj01wgLbsyWtFn/aY+5+ZdxY=
+golang.org/x/crypto v0.41.0/go.mod h1:pO5AFd7FA68rFak7rOAGVuygIISepHftHnr8dr6+sUc=
 golang.org/x/exp v0.0.0-20190121172915-509febef88a4/go.mod h1:CJ0aWSM057203Lf6IL+f9T1iT9GByDxfZKAQTCR3kQA=
 golang.org/x/exp v0.0.0-20190306152737-a1d7652674e8/go.mod h1:CJ0aWSM057203Lf6IL+f9T1iT9GByDxfZKAQTCR3kQA=
 golang.org/x/exp v0.0.0-20190510132918-efd6b22b2522/go.mod h1:ZjyILWgesfNpC6sMxTJOJm9Kp84zZh5NQWvqDGG3Qr8=
@@ -1448,8 +1448,8 @@ golang.org/x/sys v0.17.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
 golang.org/x/sys v0.18.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
 golang.org/x/sys v0.20.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
 golang.org/x/sys v0.21.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
-golang.org/x/sys v0.34.0 h1:H5Y5sJ2L2JRdyv7ROF1he/lPdvFsd0mJHFw2ThKHxLA=
+golang.org/x/sys v0.35.0 h1:vz1N37gP5bs89s7He8XuIYXpyY0+QlsKmzipCbUtyxI=
-golang.org/x/sys v0.34.0/go.mod h1:BJP2sWEmIv4KK5OTEluFJCKSidICx8ciO85XgH3Ak8k=
+golang.org/x/sys v0.35.0/go.mod h1:BJP2sWEmIv4KK5OTEluFJCKSidICx8ciO85XgH3Ak8k=
 golang.org/x/telemetry v0.0.0-20240228155512-f48c80bd79b2/go.mod h1:TeRTkGYfJXctD9OcfyVLyj2J3IxLnKwHJR8f4D8a3YE=
 golang.org/x/term v0.0.0-20201117132131-f5c789dd3221/go.mod h1:Nr5EML6q2oocZ2LXRh80K7BxOlk5/8JxuGnuhpl+muw=
 golang.org/x/term v0.0.0-20201126162022-7de9c90e9dd1/go.mod h1:bj7SfCRtBDWHUb9snDiAeCFNEtKQo2Wmx5Cou7ajbmo=
@@ -1461,8 +1461,8 @@ golang.org/x/term v0.13.0/go.mod h1:LTmsnFJwVN6bCy1rVCoS+qHT1HhALEFxKncY3WNNh4U=
 golang.org/x/term v0.17.0/go.mod h1:lLRBjIVuehSbZlaOtGMbcMncT+aqLLLmKrsjNrUguwk=
 golang.org/x/term v0.18.0/go.mod h1:ILwASektA3OnRv7amZ1xhE/KTR+u50pbXfZ03+6Nx58=
 golang.org/x/term v0.20.0/go.mod h1:8UkIAJTvZgivsXaD6/pH6U9ecQzZ45awqEOzuCvwpFY=
-golang.org/x/term v0.33.0 h1:NuFncQrRcaRvVmgRkvM3j/F00gWIAlcmlB8ACEKmGIg=
+golang.org/x/term v0.34.0 h1:O/2T7POpk0ZZ7MAzMeWFSg6S5IpWd/RXDlM9hgM3DR4=
-golang.org/x/term v0.33.0/go.mod h1:s18+ql9tYWp1IfpV9DmCtQDDSRBUjKaw9M1eAv5UeF0=
+golang.org/x/term v0.34.0/go.mod h1:5jC53AEywhIVebHgPVeg0mj8OD3VO9OzclacVrqpaAw=
 golang.org/x/text v0.0.0-20170915032832-14c0d48ead0c/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ=
 golang.org/x/text v0.3.0/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ=
 golang.org/x/text v0.3.1-0.20180807135948-17ff2d5776d2/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ=
@@ -1642,8 +1642,8 @@ google.golang.org/protobuf v1.26.0-rc.1/go.mod h1:jlhhOSvTdKEhbULTjvd4ARK9grFBp0
 google.golang.org/protobuf v1.26.0/go.mod h1:9q0QmTI4eRPtz6boOQmLYwt+qCgq0jsYwAQnmE0givc=
 google.golang.org/protobuf v1.28.0/go.mod h1:HV8QOd/L58Z+nl8r43ehVNZIU/HEI6OcFqwMG9pJV4I=
 google.golang.org/protobuf v1.28.1/go.mod h1:HV8QOd/L58Z+nl8r43ehVNZIU/HEI6OcFqwMG9pJV4I=
-google.golang.org/protobuf v1.36.6 h1:z1NpPI8ku2WgiWnf+t9wTPsn6eP1L7ksHUlkfLvd9xY=
+google.golang.org/protobuf v1.36.7 h1:IgrO7UwFQGJdRNXH/sQux4R1Dj1WAKcLElzeeRaXV2A=
-google.golang.org/protobuf v1.36.6/go.mod h1:jduwjTPXsFjZGTmRluh+L6NjiWu7pchiJ2/5YcXBHnY=
+google.golang.org/protobuf v1.36.7/go.mod h1:jduwjTPXsFjZGTmRluh+L6NjiWu7pchiJ2/5YcXBHnY=
 gopkg.in/alecthomas/kingpin.v2 v2.2.6/go.mod h1:FMv+mEhP44yOT+4EoQTLFTRgOQ1FBLkstjWtayDeSgw=
 gopkg.in/cenkalti/backoff.v1 v1.1.0 h1:Arh75ttbsvlpVA7WtVpH4u9h6Zl46xuptxqLxPiSo4Y=
 gopkg.in/cenkalti/backoff.v1 v1.1.0/go.mod h1:J6Vskwqd+OMVJl8C33mmtxTBs2gyzfv7UDAkHu8BrjI=

vendor/github.com/klauspost/cpuid/v2/README.md

@@ -285,6 +285,7 @@ Exit Code 1
 | AMXCOMPLEX         | Tile computational operations on complex numbers                                                                                                                                   |
 | AMXTILE            | Tile architecture                                                                                                                                                                  |
 | AMXTF32            | Matrix Multiplication of TF32 Tiles into Packed Single Precision Tile                                                                                                              |
+| AMXTRANSPOSE       | Tile multiply where the first operand is transposed                                                                                                                                |
 | APX_F              | Intel APX                                                                                                                                                                          |
 | AVX                | AVX functions                                                                                                                                                                      |
 | AVX10              | If set the Intel AVX10 Converged Vector ISA is supported                                                                                                                           |
@@ -420,6 +421,8 @@ Exit Code 1
 | SHA                | Intel SHA Extensions                                                                                                                                                               |
 | SME                | AMD Secure Memory Encryption supported                                                                                                                                             |
 | SME_COHERENT       | AMD Hardware cache coherency across encryption domains enforced                                                                                                                    |
+| SM3_X86            | SM3 instructions                                                                                                                                                                   |
+| SM4_X86            | SM4 instructions                                                                                                                                                                   |
 | SPEC_CTRL_SSBD     | Speculative Store Bypass Disable                                                                                                                                                   |
 | SRBDS_CTRL         | SRBDS mitigation MSR available                                                                                                                                                     |
 | SSE                | SSE functions                                                                                                                                                                      |

vendor/github.com/klauspost/cpuid/v2/cpuid.go

@@ -85,6 +85,7 @@ const (
 	AMXTILE                              // Tile architecture
 	AMXTF32                              // Tile architecture
 	AMXCOMPLEX                           // Matrix Multiplication of TF32 Tiles into Packed Single Precision Tile
+	AMXTRANSPOSE                         // Tile multiply where the first operand is transposed
 	APX_F                                // Intel APX
 	AVX                                  // AVX functions
 	AVX10                                // If set the Intel AVX10 Converged Vector ISA is supported
@@ -222,6 +223,8 @@ const (
 	SHA                                  // Intel SHA Extensions
 	SME                                  // AMD Secure Memory Encryption supported
 	SME_COHERENT                         // AMD Hardware cache coherency across encryption domains enforced
+	SM3_X86                              // SM3 instructions
+	SM4_X86                              // SM4 instructions
 	SPEC_CTRL_SSBD                       // Speculative Store Bypass Disable
 	SRBDS_CTRL                           // SRBDS mitigation MSR available
 	SRSO_MSR_FIX                         // Indicates that software may use MSR BP_CFG[BpSpecReduce] to mitigate SRSO.
@@ -283,7 +286,7 @@ const (
 	CRC32    // CRC32/CRC32C instructions
 	DCPOP    // Data cache clean to Point of Persistence (DC CVAP)
 	EVTSTRM  // Generic timer
-	FCMA     // Floatin point complex number addition and multiplication
+	FCMA     // Floating point complex number addition and multiplication
 	FHM      // FMLAL and FMLSL instructions
 	FP       // Single-precision and double-precision floating point
 	FPHP     // Half-precision floating point
@@ -878,7 +881,12 @@ func physicalCores() int {
 	v, _ := vendorID()
 	switch v {
 	case Intel:
-		return logicalCores() / threadsPerCore()
+		lc := logicalCores()
+		tpc := threadsPerCore()
+		if lc > 0 && tpc > 0 {
+			return lc / tpc
+		}
+		return 0
 	case AMD, Hygon:
 		lc := logicalCores()
 		tpc := threadsPerCore()
@@ -1279,6 +1287,8 @@ func support() flagSet {
 		// CPUID.(EAX=7, ECX=1).EAX
 		eax1, _, _, edx1 := cpuidex(7, 1)
 		fs.setIf(fs.inSet(AVX) && eax1&(1<<4) != 0, AVXVNNI)
+		fs.setIf(eax1&(1<<1) != 0, SM3_X86)
+		fs.setIf(eax1&(1<<2) != 0, SM4_X86)
 		fs.setIf(eax1&(1<<7) != 0, CMPCCXADD)
 		fs.setIf(eax1&(1<<10) != 0, MOVSB_ZL)
 		fs.setIf(eax1&(1<<11) != 0, STOSB_SHORT)
@@ -1290,6 +1300,7 @@ func support() flagSet {
 		// CPUID.(EAX=7, ECX=1).EDX
 		fs.setIf(edx1&(1<<4) != 0, AVXVNNIINT8)
 		fs.setIf(edx1&(1<<5) != 0, AVXNECONVERT)
+		fs.setIf(edx1&(1<<6) != 0, AMXTRANSPOSE)
 		fs.setIf(edx1&(1<<7) != 0, AMXTF32)
 		fs.setIf(edx1&(1<<8) != 0, AMXCOMPLEX)
 		fs.setIf(edx1&(1<<10) != 0, AVXVNNIINT16)

vendor/github.com/klauspost/cpuid/v2/featureid_string.go

@@ -19,227 +19,230 @@ func _() {
 	_ = x[AMXTILE-9]
 	_ = x[AMXTF32-10]
 	_ = x[AMXCOMPLEX-11]
-	_ = x[APX_F-12]
+	_ = x[AMXTRANSPOSE-12]
-	_ = x[AVX-13]
+	_ = x[APX_F-13]
-	_ = x[AVX10-14]
+	_ = x[AVX-14]
-	_ = x[AVX10_128-15]
+	_ = x[AVX10-15]
-	_ = x[AVX10_256-16]
+	_ = x[AVX10_128-16]
-	_ = x[AVX10_512-17]
+	_ = x[AVX10_256-17]
-	_ = x[AVX2-18]
+	_ = x[AVX10_512-18]
-	_ = x[AVX512BF16-19]
+	_ = x[AVX2-19]
-	_ = x[AVX512BITALG-20]
+	_ = x[AVX512BF16-20]
-	_ = x[AVX512BW-21]
+	_ = x[AVX512BITALG-21]
-	_ = x[AVX512CD-22]
+	_ = x[AVX512BW-22]
-	_ = x[AVX512DQ-23]
+	_ = x[AVX512CD-23]
-	_ = x[AVX512ER-24]
+	_ = x[AVX512DQ-24]
-	_ = x[AVX512F-25]
+	_ = x[AVX512ER-25]
-	_ = x[AVX512FP16-26]
+	_ = x[AVX512F-26]
-	_ = x[AVX512IFMA-27]
+	_ = x[AVX512FP16-27]
-	_ = x[AVX512PF-28]
+	_ = x[AVX512IFMA-28]
-	_ = x[AVX512VBMI-29]
+	_ = x[AVX512PF-29]
-	_ = x[AVX512VBMI2-30]
+	_ = x[AVX512VBMI-30]
-	_ = x[AVX512VL-31]
+	_ = x[AVX512VBMI2-31]
-	_ = x[AVX512VNNI-32]
+	_ = x[AVX512VL-32]
-	_ = x[AVX512VP2INTERSECT-33]
+	_ = x[AVX512VNNI-33]
-	_ = x[AVX512VPOPCNTDQ-34]
+	_ = x[AVX512VP2INTERSECT-34]
-	_ = x[AVXIFMA-35]
+	_ = x[AVX512VPOPCNTDQ-35]
-	_ = x[AVXNECONVERT-36]
+	_ = x[AVXIFMA-36]
-	_ = x[AVXSLOW-37]
+	_ = x[AVXNECONVERT-37]
-	_ = x[AVXVNNI-38]
+	_ = x[AVXSLOW-38]
-	_ = x[AVXVNNIINT8-39]
+	_ = x[AVXVNNI-39]
-	_ = x[AVXVNNIINT16-40]
+	_ = x[AVXVNNIINT8-40]
-	_ = x[BHI_CTRL-41]
+	_ = x[AVXVNNIINT16-41]
-	_ = x[BMI1-42]
+	_ = x[BHI_CTRL-42]
-	_ = x[BMI2-43]
+	_ = x[BMI1-43]
-	_ = x[CETIBT-44]
+	_ = x[BMI2-44]
-	_ = x[CETSS-45]
+	_ = x[CETIBT-45]
-	_ = x[CLDEMOTE-46]
+	_ = x[CETSS-46]
-	_ = x[CLMUL-47]
+	_ = x[CLDEMOTE-47]
-	_ = x[CLZERO-48]
+	_ = x[CLMUL-48]
-	_ = x[CMOV-49]
+	_ = x[CLZERO-49]
-	_ = x[CMPCCXADD-50]
+	_ = x[CMOV-50]
-	_ = x[CMPSB_SCADBS_SHORT-51]
+	_ = x[CMPCCXADD-51]
-	_ = x[CMPXCHG8-52]
+	_ = x[CMPSB_SCADBS_SHORT-52]
-	_ = x[CPBOOST-53]
+	_ = x[CMPXCHG8-53]
-	_ = x[CPPC-54]
+	_ = x[CPBOOST-54]
-	_ = x[CX16-55]
+	_ = x[CPPC-55]
-	_ = x[EFER_LMSLE_UNS-56]
+	_ = x[CX16-56]
-	_ = x[ENQCMD-57]
+	_ = x[EFER_LMSLE_UNS-57]
-	_ = x[ERMS-58]
+	_ = x[ENQCMD-58]
-	_ = x[F16C-59]
+	_ = x[ERMS-59]
-	_ = x[FLUSH_L1D-60]
+	_ = x[F16C-60]
-	_ = x[FMA3-61]
+	_ = x[FLUSH_L1D-61]
-	_ = x[FMA4-62]
+	_ = x[FMA3-62]
-	_ = x[FP128-63]
+	_ = x[FMA4-63]
-	_ = x[FP256-64]
+	_ = x[FP128-64]
-	_ = x[FSRM-65]
+	_ = x[FP256-65]
-	_ = x[FXSR-66]
+	_ = x[FSRM-66]
-	_ = x[FXSROPT-67]
+	_ = x[FXSR-67]
-	_ = x[GFNI-68]
+	_ = x[FXSROPT-68]
-	_ = x[HLE-69]
+	_ = x[GFNI-69]
-	_ = x[HRESET-70]
+	_ = x[HLE-70]
-	_ = x[HTT-71]
+	_ = x[HRESET-71]
-	_ = x[HWA-72]
+	_ = x[HTT-72]
-	_ = x[HYBRID_CPU-73]
+	_ = x[HWA-73]
-	_ = x[HYPERVISOR-74]
+	_ = x[HYBRID_CPU-74]
-	_ = x[IA32_ARCH_CAP-75]
+	_ = x[HYPERVISOR-75]
-	_ = x[IA32_CORE_CAP-76]
+	_ = x[IA32_ARCH_CAP-76]
-	_ = x[IBPB-77]
+	_ = x[IA32_CORE_CAP-77]
-	_ = x[IBPB_BRTYPE-78]
+	_ = x[IBPB-78]
-	_ = x[IBRS-79]
+	_ = x[IBPB_BRTYPE-79]
-	_ = x[IBRS_PREFERRED-80]
+	_ = x[IBRS-80]
-	_ = x[IBRS_PROVIDES_SMP-81]
+	_ = x[IBRS_PREFERRED-81]
-	_ = x[IBS-82]
+	_ = x[IBRS_PROVIDES_SMP-82]
-	_ = x[IBSBRNTRGT-83]
+	_ = x[IBS-83]
-	_ = x[IBSFETCHSAM-84]
+	_ = x[IBSBRNTRGT-84]
-	_ = x[IBSFFV-85]
+	_ = x[IBSFETCHSAM-85]
-	_ = x[IBSOPCNT-86]
+	_ = x[IBSFFV-86]
-	_ = x[IBSOPCNTEXT-87]
+	_ = x[IBSOPCNT-87]
-	_ = x[IBSOPSAM-88]
+	_ = x[IBSOPCNTEXT-88]
-	_ = x[IBSRDWROPCNT-89]
+	_ = x[IBSOPSAM-89]
-	_ = x[IBSRIPINVALIDCHK-90]
+	_ = x[IBSRDWROPCNT-90]
-	_ = x[IBS_FETCH_CTLX-91]
+	_ = x[IBSRIPINVALIDCHK-91]
-	_ = x[IBS_OPDATA4-92]
+	_ = x[IBS_FETCH_CTLX-92]
-	_ = x[IBS_OPFUSE-93]
+	_ = x[IBS_OPDATA4-93]
-	_ = x[IBS_PREVENTHOST-94]
+	_ = x[IBS_OPFUSE-94]
-	_ = x[IBS_ZEN4-95]
+	_ = x[IBS_PREVENTHOST-95]
-	_ = x[IDPRED_CTRL-96]
+	_ = x[IBS_ZEN4-96]
-	_ = x[INT_WBINVD-97]
+	_ = x[IDPRED_CTRL-97]
-	_ = x[INVLPGB-98]
+	_ = x[INT_WBINVD-98]
-	_ = x[KEYLOCKER-99]
+	_ = x[INVLPGB-99]
-	_ = x[KEYLOCKERW-100]
+	_ = x[KEYLOCKER-100]
-	_ = x[LAHF-101]
+	_ = x[KEYLOCKERW-101]
-	_ = x[LAM-102]
+	_ = x[LAHF-102]
-	_ = x[LBRVIRT-103]
+	_ = x[LAM-103]
-	_ = x[LZCNT-104]
+	_ = x[LBRVIRT-104]
-	_ = x[MCAOVERFLOW-105]
+	_ = x[LZCNT-105]
-	_ = x[MCDT_NO-106]
+	_ = x[MCAOVERFLOW-106]
-	_ = x[MCOMMIT-107]
+	_ = x[MCDT_NO-107]
-	_ = x[MD_CLEAR-108]
+	_ = x[MCOMMIT-108]
-	_ = x[MMX-109]
+	_ = x[MD_CLEAR-109]
-	_ = x[MMXEXT-110]
+	_ = x[MMX-110]
-	_ = x[MOVBE-111]
+	_ = x[MMXEXT-111]
-	_ = x[MOVDIR64B-112]
+	_ = x[MOVBE-112]
-	_ = x[MOVDIRI-113]
+	_ = x[MOVDIR64B-113]
-	_ = x[MOVSB_ZL-114]
+	_ = x[MOVDIRI-114]
-	_ = x[MOVU-115]
+	_ = x[MOVSB_ZL-115]
-	_ = x[MPX-116]
+	_ = x[MOVU-116]
-	_ = x[MSRIRC-117]
+	_ = x[MPX-117]
-	_ = x[MSRLIST-118]
+	_ = x[MSRIRC-118]
-	_ = x[MSR_PAGEFLUSH-119]
+	_ = x[MSRLIST-119]
-	_ = x[NRIPS-120]
+	_ = x[MSR_PAGEFLUSH-120]
-	_ = x[NX-121]
+	_ = x[NRIPS-121]
-	_ = x[OSXSAVE-122]
+	_ = x[NX-122]
-	_ = x[PCONFIG-123]
+	_ = x[OSXSAVE-123]
-	_ = x[POPCNT-124]
+	_ = x[PCONFIG-124]
-	_ = x[PPIN-125]
+	_ = x[POPCNT-125]
-	_ = x[PREFETCHI-126]
+	_ = x[PPIN-126]
-	_ = x[PSFD-127]
+	_ = x[PREFETCHI-127]
-	_ = x[RDPRU-128]
+	_ = x[PSFD-128]
-	_ = x[RDRAND-129]
+	_ = x[RDPRU-129]
-	_ = x[RDSEED-130]
+	_ = x[RDRAND-130]
-	_ = x[RDTSCP-131]
+	_ = x[RDSEED-131]
-	_ = x[RRSBA_CTRL-132]
+	_ = x[RDTSCP-132]
-	_ = x[RTM-133]
+	_ = x[RRSBA_CTRL-133]
-	_ = x[RTM_ALWAYS_ABORT-134]
+	_ = x[RTM-134]
-	_ = x[SBPB-135]
+	_ = x[RTM_ALWAYS_ABORT-135]
-	_ = x[SERIALIZE-136]
+	_ = x[SBPB-136]
-	_ = x[SEV-137]
+	_ = x[SERIALIZE-137]
-	_ = x[SEV_64BIT-138]
+	_ = x[SEV-138]
-	_ = x[SEV_ALTERNATIVE-139]
+	_ = x[SEV_64BIT-139]
-	_ = x[SEV_DEBUGSWAP-140]
+	_ = x[SEV_ALTERNATIVE-140]
-	_ = x[SEV_ES-141]
+	_ = x[SEV_DEBUGSWAP-141]
-	_ = x[SEV_RESTRICTED-142]
+	_ = x[SEV_ES-142]
-	_ = x[SEV_SNP-143]
+	_ = x[SEV_RESTRICTED-143]
-	_ = x[SGX-144]
+	_ = x[SEV_SNP-144]
-	_ = x[SGXLC-145]
+	_ = x[SGX-145]
-	_ = x[SHA-146]
+	_ = x[SGXLC-146]
-	_ = x[SME-147]
+	_ = x[SHA-147]
-	_ = x[SME_COHERENT-148]
+	_ = x[SME-148]
-	_ = x[SPEC_CTRL_SSBD-149]
+	_ = x[SME_COHERENT-149]
-	_ = x[SRBDS_CTRL-150]
+	_ = x[SM3_X86-150]
-	_ = x[SRSO_MSR_FIX-151]
+	_ = x[SM4_X86-151]
-	_ = x[SRSO_NO-152]
+	_ = x[SPEC_CTRL_SSBD-152]
-	_ = x[SRSO_USER_KERNEL_NO-153]
+	_ = x[SRBDS_CTRL-153]
-	_ = x[SSE-154]
+	_ = x[SRSO_MSR_FIX-154]
-	_ = x[SSE2-155]
+	_ = x[SRSO_NO-155]
-	_ = x[SSE3-156]
+	_ = x[SRSO_USER_KERNEL_NO-156]
-	_ = x[SSE4-157]
+	_ = x[SSE-157]
-	_ = x[SSE42-158]
+	_ = x[SSE2-158]
-	_ = x[SSE4A-159]
+	_ = x[SSE3-159]
-	_ = x[SSSE3-160]
+	_ = x[SSE4-160]
-	_ = x[STIBP-161]
+	_ = x[SSE42-161]
-	_ = x[STIBP_ALWAYSON-162]
+	_ = x[SSE4A-162]
-	_ = x[STOSB_SHORT-163]
+	_ = x[SSSE3-163]
-	_ = x[SUCCOR-164]
+	_ = x[STIBP-164]
-	_ = x[SVM-165]
+	_ = x[STIBP_ALWAYSON-165]
-	_ = x[SVMDA-166]
+	_ = x[STOSB_SHORT-166]
-	_ = x[SVMFBASID-167]
+	_ = x[SUCCOR-167]
-	_ = x[SVML-168]
+	_ = x[SVM-168]
-	_ = x[SVMNP-169]
+	_ = x[SVMDA-169]
-	_ = x[SVMPF-170]
+	_ = x[SVMFBASID-170]
-	_ = x[SVMPFT-171]
+	_ = x[SVML-171]
-	_ = x[SYSCALL-172]
+	_ = x[SVMNP-172]
-	_ = x[SYSEE-173]
+	_ = x[SVMPF-173]
-	_ = x[TBM-174]
+	_ = x[SVMPFT-174]
-	_ = x[TDX_GUEST-175]
+	_ = x[SYSCALL-175]
-	_ = x[TLB_FLUSH_NESTED-176]
+	_ = x[SYSEE-176]
-	_ = x[TME-177]
+	_ = x[TBM-177]
-	_ = x[TOPEXT-178]
+	_ = x[TDX_GUEST-178]
-	_ = x[TSCRATEMSR-179]
+	_ = x[TLB_FLUSH_NESTED-179]
-	_ = x[TSXLDTRK-180]
+	_ = x[TME-180]
-	_ = x[VAES-181]
+	_ = x[TOPEXT-181]
-	_ = x[VMCBCLEAN-182]
+	_ = x[TSCRATEMSR-182]
-	_ = x[VMPL-183]
+	_ = x[TSXLDTRK-183]
-	_ = x[VMSA_REGPROT-184]
+	_ = x[VAES-184]
-	_ = x[VMX-185]
+	_ = x[VMCBCLEAN-185]
-	_ = x[VPCLMULQDQ-186]
+	_ = x[VMPL-186]
-	_ = x[VTE-187]
+	_ = x[VMSA_REGPROT-187]
-	_ = x[WAITPKG-188]
+	_ = x[VMX-188]
-	_ = x[WBNOINVD-189]
+	_ = x[VPCLMULQDQ-189]
-	_ = x[WRMSRNS-190]
+	_ = x[VTE-190]
-	_ = x[X87-191]
+	_ = x[WAITPKG-191]
-	_ = x[XGETBV1-192]
+	_ = x[WBNOINVD-192]
-	_ = x[XOP-193]
+	_ = x[WRMSRNS-193]
-	_ = x[XSAVE-194]
+	_ = x[X87-194]
-	_ = x[XSAVEC-195]
+	_ = x[XGETBV1-195]
-	_ = x[XSAVEOPT-196]
+	_ = x[XOP-196]
-	_ = x[XSAVES-197]
+	_ = x[XSAVE-197]
-	_ = x[AESARM-198]
+	_ = x[XSAVEC-198]
-	_ = x[ARMCPUID-199]
+	_ = x[XSAVEOPT-199]
-	_ = x[ASIMD-200]
+	_ = x[XSAVES-200]
-	_ = x[ASIMDDP-201]
+	_ = x[AESARM-201]
-	_ = x[ASIMDHP-202]
+	_ = x[ARMCPUID-202]
-	_ = x[ASIMDRDM-203]
+	_ = x[ASIMD-203]
-	_ = x[ATOMICS-204]
+	_ = x[ASIMDDP-204]
-	_ = x[CRC32-205]
+	_ = x[ASIMDHP-205]
-	_ = x[DCPOP-206]
+	_ = x[ASIMDRDM-206]
-	_ = x[EVTSTRM-207]
+	_ = x[ATOMICS-207]
-	_ = x[FCMA-208]
+	_ = x[CRC32-208]
-	_ = x[FHM-209]
+	_ = x[DCPOP-209]
-	_ = x[FP-210]
+	_ = x[EVTSTRM-210]
-	_ = x[FPHP-211]
+	_ = x[FCMA-211]
-	_ = x[GPA-212]
+	_ = x[FHM-212]
-	_ = x[JSCVT-213]
+	_ = x[FP-213]
-	_ = x[LRCPC-214]
+	_ = x[FPHP-214]
-	_ = x[PMULL-215]
+	_ = x[GPA-215]
-	_ = x[RNDR-216]
+	_ = x[JSCVT-216]
-	_ = x[TLB-217]
+	_ = x[LRCPC-217]
-	_ = x[TS-218]
+	_ = x[PMULL-218]
-	_ = x[SHA1-219]
+	_ = x[RNDR-219]
-	_ = x[SHA2-220]
+	_ = x[TLB-220]
-	_ = x[SHA3-221]
+	_ = x[TS-221]
-	_ = x[SHA512-222]
+	_ = x[SHA1-222]
-	_ = x[SM3-223]
+	_ = x[SHA2-223]
-	_ = x[SM4-224]
+	_ = x[SHA3-224]
-	_ = x[SVE-225]
+	_ = x[SHA512-225]
-	_ = x[lastID-226]
+	_ = x[SM3-226]
+	_ = x[SM4-227]
+	_ = x[SVE-228]
+	_ = x[lastID-229]
 	_ = x[firstID-0]
 }
 
-const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXFP8AMXTILEAMXTF32AMXCOMPLEXAPX_FAVXAVX10AVX10_128AVX10_256AVX10_512AVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8AVXVNNIINT16BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBPB_BRTYPEIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBKEYLOCKERKEYLOCKERWLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSBPBSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSRSO_MSR_FIXSRSO_NOSRSO_USER_KERNEL_NOSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFHMFPFPHPGPAJSCVTLRCPCPMULLRNDRTLBTSSHA1SHA2SHA3SHA512SM3SM4SVElastID"
+const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXFP8AMXTILEAMXTF32AMXCOMPLEXAMXTRANSPOSEAPX_FAVXAVX10AVX10_128AVX10_256AVX10_512AVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8AVXVNNIINT16BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBPB_BRTYPEIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBKEYLOCKERKEYLOCKERWLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSBPBSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSM3_X86SM4_X86SPEC_CTRL_SSBDSRBDS_CTRLSRSO_MSR_FIXSRSO_NOSRSO_USER_KERNEL_NOSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFHMFPFPHPGPAJSCVTLRCPCPMULLRNDRTLBTSSHA1SHA2SHA3SHA512SM3SM4SVElastID"
 
-var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 61, 68, 75, 85, 90, 93, 98, 107, 116, 125, 129, 139, 151, 159, 167, 175, 183, 190, 200, 210, 218, 228, 239, 247, 257, 275, 290, 297, 309, 316, 323, 334, 346, 354, 358, 362, 368, 373, 381, 386, 392, 396, 405, 423, 431, 438, 442, 446, 460, 466, 470, 474, 483, 487, 491, 496, 501, 505, 509, 516, 520, 523, 529, 532, 535, 545, 555, 568, 581, 585, 596, 600, 614, 631, 634, 644, 655, 661, 669, 680, 688, 700, 716, 730, 741, 751, 766, 774, 785, 795, 802, 811, 821, 825, 828, 835, 840, 851, 858, 865, 873, 876, 882, 887, 896, 903, 911, 915, 918, 924, 931, 944, 949, 951, 958, 965, 971, 975, 984, 988, 993, 999, 1005, 1011, 1021, 1024, 1040, 1044, 1053, 1056, 1065, 1080, 1093, 1099, 1113, 1120, 1123, 1128, 1131, 1134, 1146, 1160, 1170, 1182, 1189, 1208, 1211, 1215, 1219, 1223, 1228, 1233, 1238, 1243, 1257, 1268, 1274, 1277, 1282, 1291, 1295, 1300, 1305, 1311, 1318, 1323, 1326, 1335, 1351, 1354, 1360, 1370, 1378, 1382, 1391, 1395, 1407, 1410, 1420, 1423, 1430, 1438, 1445, 1448, 1455, 1458, 1463, 1469, 1477, 1483, 1489, 1497, 1502, 1509, 1516, 1524, 1531, 1536, 1541, 1548, 1552, 1555, 1557, 1561, 1564, 1569, 1574, 1579, 1583, 1586, 1588, 1592, 1596, 1600, 1606, 1609, 1612, 1615, 1621}
+var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 61, 68, 75, 85, 97, 102, 105, 110, 119, 128, 137, 141, 151, 163, 171, 179, 187, 195, 202, 212, 222, 230, 240, 251, 259, 269, 287, 302, 309, 321, 328, 335, 346, 358, 366, 370, 374, 380, 385, 393, 398, 404, 408, 417, 435, 443, 450, 454, 458, 472, 478, 482, 486, 495, 499, 503, 508, 513, 517, 521, 528, 532, 535, 541, 544, 547, 557, 567, 580, 593, 597, 608, 612, 626, 643, 646, 656, 667, 673, 681, 692, 700, 712, 728, 742, 753, 763, 778, 786, 797, 807, 814, 823, 833, 837, 840, 847, 852, 863, 870, 877, 885, 888, 894, 899, 908, 915, 923, 927, 930, 936, 943, 956, 961, 963, 970, 977, 983, 987, 996, 1000, 1005, 1011, 1017, 1023, 1033, 1036, 1052, 1056, 1065, 1068, 1077, 1092, 1105, 1111, 1125, 1132, 1135, 1140, 1143, 1146, 1158, 1165, 1172, 1186, 1196, 1208, 1215, 1234, 1237, 1241, 1245, 1249, 1254, 1259, 1264, 1269, 1283, 1294, 1300, 1303, 1308, 1317, 1321, 1326, 1331, 1337, 1344, 1349, 1352, 1361, 1377, 1380, 1386, 1396, 1404, 1408, 1417, 1421, 1433, 1436, 1446, 1449, 1456, 1464, 1471, 1474, 1481, 1484, 1489, 1495, 1503, 1509, 1515, 1523, 1528, 1535, 1542, 1550, 1557, 1562, 1567, 1574, 1578, 1581, 1583, 1587, 1590, 1595, 1600, 1605, 1609, 1612, 1614, 1618, 1622, 1626, 1632, 1635, 1638, 1641, 1647}
 
 func (i FeatureID) String() string {
 	if i < 0 || i >= FeatureID(len(_FeatureID_index)-1) {

vendor/github.com/klauspost/cpuid/v2/os_darwin_arm64.go

@@ -65,9 +65,16 @@ func sysctlGetInt64(unknown int, names ...string) int {
 	return unknown
 }
 
-func setFeature(c *CPUInfo, name string, feature FeatureID) {
+func setFeature(c *CPUInfo, feature FeatureID, aliases ...string) {
-	c.featureSet.setIf(sysctlGetBool(name), feature)
+	for _, alias := range aliases {
+		set := sysctlGetBool(alias)
+		c.featureSet.setIf(set, feature)
+		if set {
+			break
+		}
+	}
 }
+
 func tryToFillCPUInfoFomSysctl(c *CPUInfo) {
 	c.BrandName = sysctlGetString("machdep.cpu.brand_string")
 
@@ -87,41 +94,36 @@ func tryToFillCPUInfoFomSysctl(c *CPUInfo) {
 	c.Cache.L2 = sysctlGetInt64(-1, "hw.l2cachesize")
 	c.Cache.L3 = sysctlGetInt64(-1, "hw.l3cachesize")
 
-	// from https://developer.arm.com/downloads/-/exploration-tools/feature-names-for-a-profile
+	// ARM features:
-	setFeature(c, "hw.optional.arm.FEAT_AES", AESARM)
+	//
-	setFeature(c, "hw.optional.AdvSIMD", ASIMD)
+	// Note: On some Apple Silicon system, some feats have aliases. See:
-	setFeature(c, "hw.optional.arm.FEAT_DotProd", ASIMDDP)
+	// https://developer.apple.com/documentation/kernel/1387446-sysctlbyname/determining_instruction_set_characteristics
-	setFeature(c, "hw.optional.arm.FEAT_RDM", ASIMDRDM)
+	// When so, we look at all aliases and consider a feature available when at least one identifier matches.
-	setFeature(c, "hw.optional.FEAT_CRC32", CRC32)
+	setFeature(c, AESARM, "hw.optional.arm.FEAT_AES")                                   // AES instructions
-	setFeature(c, "hw.optional.arm.FEAT_DPB", DCPOP)
+	setFeature(c, ASIMD, "hw.optional.arm.AdvSIMD", "hw.optional.neon")                 // Advanced SIMD
-	// setFeature(c, "", EVTSTRM)
+	setFeature(c, ASIMDDP, "hw.optional.arm.FEAT_DotProd")                              // SIMD Dot Product
-	setFeature(c, "hw.optional.arm.FEAT_FCMA", FCMA)
+	setFeature(c, ASIMDHP, "hw.optional.arm.AdvSIMD_HPFPCvt", "hw.optional.neon_hpfp")  // Advanced SIMD half-precision floating point
-	setFeature(c, "hw.optional.arm.FEAT_FHM", FHM)
+	setFeature(c, ASIMDRDM, "hw.optional.arm.FEAT_RDM")                                 // Rounding Double Multiply Accumulate/Subtract
-	setFeature(c, "hw.optional.arm.FEAT_FP", FP)
+	setFeature(c, ATOMICS, "hw.optional.arm.FEAT_LSE", "hw.optional.armv8_1_atomics")   // Large System Extensions (LSE)
-	setFeature(c, "hw.optional.arm.FEAT_FP16", FPHP)
+	setFeature(c, CRC32, "hw.optional.arm.FEAT_CRC32", "hw.optional.armv8_crc32")       // CRC32/CRC32C instructions
-	setFeature(c, "hw.optional.arm.FEAT_PAuth", GPA)
+	setFeature(c, DCPOP, "hw.optional.arm.FEAT_DPB")                                    // Data cache clean to Point of Persistence (DC CVAP)
-	setFeature(c, "hw.optional.arm.FEAT_RNG", RNDR)
+	setFeature(c, EVTSTRM, "hw.optional.arm.FEAT_ECV")                                  // Generic timer
-	setFeature(c, "hw.optional.arm.FEAT_JSCVT", JSCVT)
+	setFeature(c, FCMA, "hw.optional.arm.FEAT_FCMA", "hw.optional.armv8_3_compnum")     // Floating point complex number addition and multiplication
-	setFeature(c, "hw.optional.arm.FEAT_LRCPC", LRCPC)
+	setFeature(c, FHM, "hw.optional.armv8_2_fhm", "hw.optional.arm.FEAT_FHM")           // FMLAL and FMLSL instructions
-	setFeature(c, "hw.optional.arm.FEAT_PMULL", PMULL)
+	setFeature(c, FP, "hw.optional.floatingpoint")                                      // Single-precision and double-precision floating point
-	setFeature(c, "hw.optional.arm.FEAT_SHA1", SHA1)
+	setFeature(c, FPHP, "hw.optional.arm.FEAT_FP16", "hw.optional.neon_fp16")           // Half-precision floating point
-	setFeature(c, "hw.optional.arm.FEAT_SHA256", SHA2)
+	setFeature(c, GPA, "hw.optional.arm.FEAT_PAuth")                                    // Generic Pointer Authentication
-	setFeature(c, "hw.optional.arm.FEAT_SHA3", SHA3)
+	setFeature(c, JSCVT, "hw.optional.arm.FEAT_JSCVT")                                  // Javascript-style double->int convert (FJCVTZS)
-	setFeature(c, "hw.optional.arm.FEAT_SHA512", SHA512)
+	setFeature(c, LRCPC, "hw.optional.arm.FEAT_LRCPC")                                  // Weaker release consistency (LDAPR, etc)
-	setFeature(c, "hw.optional.arm.FEAT_TLBIOS", TLB)
+	setFeature(c, PMULL, "hw.optional.arm.FEAT_PMULL")                                  // Polynomial Multiply instructions (PMULL/PMULL2)
-	setFeature(c, "hw.optional.arm.FEAT_TLBIRANGE", TLB)
+	setFeature(c, RNDR, "hw.optional.arm.FEAT_RNG")                                     // Random Number instructions
-	setFeature(c, "hw.optional.arm.FEAT_FlagM", TS)
+	setFeature(c, TLB, "hw.optional.arm.FEAT_TLBIOS", "hw.optional.arm.FEAT_TLBIRANGE") // Outer Shareable and TLB range maintenance instructions
-	setFeature(c, "hw.optional.arm.FEAT_FlagM2", TS)
+	setFeature(c, TS, "hw.optional.arm.FEAT_FlagM", "hw.optional.arm.FEAT_FlagM2")      // Flag manipulation instructions
-	// setFeature(c, "", SM3)
+	setFeature(c, SHA1, "hw.optional.arm.FEAT_SHA1")                                    // SHA-1 instructions (SHA1C, etc)
-	// setFeature(c, "", SM4)
+	setFeature(c, SHA2, "hw.optional.arm.FEAT_SHA256")                                  // SHA-2 instructions (SHA256H, etc)
-	setFeature(c, "hw.optional.arm.FEAT_SVE", SVE)
+	setFeature(c, SHA3, "hw.optional.arm.FEAT_SHA3")                                    // SHA-3 instructions (EOR3, RAXI, XAR, BCAX)
-
+	setFeature(c, SHA512, "hw.optional.arm.FEAT_SHA512")                                // SHA512 instructions
-	// from empirical observation
+	setFeature(c, SM3, "hw.optional.arm.FEAT_SM3")                                      // SM3 instructions
-	setFeature(c, "hw.optional.AdvSIMD_HPFPCvt", ASIMDHP)
+	setFeature(c, SM4, "hw.optional.arm.FEAT_SM4")                                      // SM4 instructions
-	setFeature(c, "hw.optional.armv8_1_atomics", ATOMICS)
+	setFeature(c, SVE, "hw.optional.arm.FEAT_SVE")                                      // Scalable Vector Extension
-	setFeature(c, "hw.optional.floatingpoint", FP)
-	setFeature(c, "hw.optional.armv8_2_sha3", SHA3)
-	setFeature(c, "hw.optional.armv8_2_sha512", SHA512)
-	setFeature(c, "hw.optional.armv8_3_compnum", FCMA)
-	setFeature(c, "hw.optional.armv8_crc32", CRC32)
 }

vendor/github.com/minio/crc64nvme/crc64_arm64.go

@@ -10,6 +10,6 @@ import (
 	"github.com/klauspost/cpuid/v2"
 )
 
-var hasAsm = cpuid.CPU.Supports(cpuid.ASIMD) && cpuid.CPU.Supports(cpuid.PMULL)
+var hasAsm = cpuid.CPU.Supports(cpuid.ASIMD, cpuid.PMULL, cpuid.SHA3)
 
 func updateAsm(crc uint64, p []byte) (checksum uint64)

vendor/github.com/minio/minio-go/v7/api-append-object.go

@@ -127,6 +127,10 @@ func (c *Client) appendObjectDo(ctx context.Context, bucketName, objectName stri
 
 	if opts.checksumType.IsSet() {
 		reqMetadata.addCrc = &opts.checksumType
+		reqMetadata.customHeader.Set(amzChecksumAlgo, opts.checksumType.String())
+		if opts.checksumType.FullObjectRequested() {
+			reqMetadata.customHeader.Set(amzChecksumMode, ChecksumFullObjectMode.String())
+		}
 	}
 
 	// Execute PUT an objectName.
@@ -183,8 +187,8 @@ func (c *Client) AppendObject(ctx context.Context, bucketName, objectName string
 	if err != nil {
 		return UploadInfo{}, err
 	}
-	if oinfo.ChecksumMode != ChecksumFullObjectMode.String() {
+	if oinfo.ChecksumMode != "" && oinfo.ChecksumMode != ChecksumFullObjectMode.String() {
-		return UploadInfo{}, fmt.Errorf("append API is not allowed on objects that are not full_object checksum type: %s", oinfo.ChecksumMode)
+		return UploadInfo{}, fmt.Errorf("Append() is not allowed on objects that are not of FULL_OBJECT checksum type: %s", oinfo.ChecksumMode)
 	}
 	opts.setChecksumParams(oinfo)   // set the appropriate checksum params based on the existing object checksum metadata.
 	opts.setWriteOffset(oinfo.Size) // First append must set the current object size as the offset.

vendor/github.com/minio/minio-go/v7/api-put-object-multipart.go

@@ -82,16 +82,12 @@ func (c *Client) putObjectMultipartNoStream(ctx context.Context, bucketName, obj
 	// avoid sha256 with non-v4 signature request or
 	// HTTPS connection.
 	hashAlgos, hashSums := c.hashMaterials(opts.SendContentMd5, !opts.DisableContentSha256)
-	if len(hashSums) == 0 {
-		addAutoChecksumHeaders(&opts)
-	}
 
 	// Initiate a new multipart upload.
 	uploadID, err := c.newUploadID(ctx, bucketName, objectName, opts)
 	if err != nil {
 		return UploadInfo{}, err
 	}
-	delete(opts.UserMetadata, "X-Amz-Checksum-Algorithm")
 
 	defer func() {
 		if err != nil {
@@ -145,11 +141,15 @@ func (c *Client) putObjectMultipartNoStream(ctx context.Context, bucketName, obj
 		if hashSums["sha256"] != nil {
 			sha256Hex = hex.EncodeToString(hashSums["sha256"])
 		}
-		if len(hashSums) == 0 {
+		if opts.AutoChecksum.IsSet() {
 			crc.Reset()
 			crc.Write(buf[:length])
 			cSum := crc.Sum(nil)
 			customHeader.Set(opts.AutoChecksum.Key(), base64.StdEncoding.EncodeToString(cSum))
+			customHeader.Set(amzChecksumAlgo, opts.AutoChecksum.String())
+			if opts.AutoChecksum.FullObjectRequested() {
+				customHeader.Set(amzChecksumMode, ChecksumFullObjectMode.String())
+			}
 		}
 
 		p := uploadPartParams{bucketName: bucketName, objectName: objectName, uploadID: uploadID, reader: rd, partNumber: partNumber, md5Base64: md5Base64, sha256Hex: sha256Hex, size: int64(length), sse: opts.ServerSideEncryption, streamSha256: !opts.DisableContentSha256, customHeader: customHeader}

vendor/github.com/minio/minio-go/v7/api-put-object-streaming.go

@@ -108,19 +108,14 @@ func (c *Client) putObjectMultipartStreamFromReadAt(ctx context.Context, bucketN
 	if err != nil {
 		return UploadInfo{}, err
 	}
-	if opts.Checksum.IsSet() {
+
-		opts.AutoChecksum = opts.Checksum
-	}
-	withChecksum := c.trailingHeaderSupport
-	if withChecksum {
-		addAutoChecksumHeaders(&opts)
-	}
 	// Initiate a new multipart upload.
 	uploadID, err := c.newUploadID(ctx, bucketName, objectName, opts)
 	if err != nil {
 		return UploadInfo{}, err
 	}
-	delete(opts.UserMetadata, "X-Amz-Checksum-Algorithm")
+
+	withChecksum := c.trailingHeaderSupport
 
 	// Aborts the multipart upload in progress, if the
 	// function returns any error, since we do not resume
@@ -297,15 +292,6 @@ func (c *Client) putObjectMultipartStreamOptionalChecksum(ctx context.Context, b
 		return UploadInfo{}, err
 	}
 
-	if opts.Checksum.IsSet() {
-		opts.AutoChecksum = opts.Checksum
-		opts.SendContentMd5 = false
-	}
-
-	if !opts.SendContentMd5 {
-		addAutoChecksumHeaders(&opts)
-	}
-
 	// Calculate the optimal parts info for a given size.
 	totalPartsCount, partSize, lastPartSize, err := OptimalPartInfo(size, opts.PartSize)
 	if err != nil {
@@ -316,7 +302,6 @@ func (c *Client) putObjectMultipartStreamOptionalChecksum(ctx context.Context, b
 	if err != nil {
 		return UploadInfo{}, err
 	}
-	delete(opts.UserMetadata, "X-Amz-Checksum-Algorithm")
 
 	// Aborts the multipart upload if the function returns
 	// any error, since we do not resume we should purge
@@ -369,12 +354,18 @@ func (c *Client) putObjectMultipartStreamOptionalChecksum(ctx context.Context, b
 			md5Hash.Reset()
 			md5Hash.Write(buf[:length])
 			md5Base64 = base64.StdEncoding.EncodeToString(md5Hash.Sum(nil))
-		} else {
+		}
+
+		if opts.AutoChecksum.IsSet() {
 			// Add CRC32C instead.
 			crc.Reset()
 			crc.Write(buf[:length])
 			cSum := crc.Sum(nil)
-			customHeader.Set(opts.AutoChecksum.KeyCapitalized(), base64.StdEncoding.EncodeToString(cSum))
+			customHeader.Set(opts.AutoChecksum.Key(), base64.StdEncoding.EncodeToString(cSum))
+			customHeader.Set(amzChecksumAlgo, opts.AutoChecksum.String())
+			if opts.AutoChecksum.FullObjectRequested() {
+				customHeader.Set(amzChecksumMode, ChecksumFullObjectMode.String())
+			}
 		}
 
 		// Update progress reader appropriately to the latest offset
@@ -453,13 +444,6 @@ func (c *Client) putObjectMultipartStreamParallel(ctx context.Context, bucketNam
 	if err = s3utils.CheckValidObjectName(objectName); err != nil {
 		return UploadInfo{}, err
 	}
-	if opts.Checksum.IsSet() {
-		opts.SendContentMd5 = false
-		opts.AutoChecksum = opts.Checksum
-	}
-	if !opts.SendContentMd5 {
-		addAutoChecksumHeaders(&opts)
-	}
 
 	// Cancel all when an error occurs.
 	ctx, cancel := context.WithCancel(ctx)
@@ -476,7 +460,6 @@ func (c *Client) putObjectMultipartStreamParallel(ctx context.Context, bucketNam
 	if err != nil {
 		return UploadInfo{}, err
 	}
-	delete(opts.UserMetadata, "X-Amz-Checksum-Algorithm")
 
 	// Aborts the multipart upload if the function returns
 	// any error, since we do not resume we should purge
@@ -541,18 +524,22 @@ func (c *Client) putObjectMultipartStreamParallel(ctx context.Context, bucketNam
 			return UploadInfo{}, rerr
 		}
 
-		// Calculate md5sum.
-		customHeader := make(http.Header)
-		if !opts.SendContentMd5 {
-			// Add Checksum instead.
-			crc.Reset()
-			crc.Write(buf[:length])
-			cSum := crc.Sum(nil)
-			customHeader.Set(opts.AutoChecksum.Key(), base64.StdEncoding.EncodeToString(cSum))
-		}
-
 		wg.Add(1)
 		go func(partNumber int) {
+			// Calculate md5sum.
+			customHeader := make(http.Header)
+			if opts.AutoChecksum.IsSet() {
+				// Add Checksum instead.
+				crc.Reset()
+				crc.Write(buf[:length])
+				cSum := crc.Sum(nil)
+				customHeader.Set(opts.AutoChecksum.Key(), base64.StdEncoding.EncodeToString(cSum))
+				customHeader.Set(amzChecksumAlgo, opts.AutoChecksum.String())
+				if opts.AutoChecksum.FullObjectRequested() {
+					customHeader.Set(amzChecksumMode, ChecksumFullObjectMode.String())
+				}
+			}
+
 			// Avoid declaring variables in the for loop
 			var md5Base64 string
 
@@ -664,9 +651,6 @@ func (c *Client) putObject(ctx context.Context, bucketName, objectName string, r
 	if opts.SendContentMd5 && s3utils.IsGoogleEndpoint(*c.endpointURL) && size < 0 {
 		return UploadInfo{}, errInvalidArgument("MD5Sum cannot be calculated with size '-1'")
 	}
-	if opts.Checksum.IsSet() {
-		opts.SendContentMd5 = false
-	}
 
 	var readSeeker io.Seeker
 	if size > 0 {
@@ -759,7 +743,7 @@ func (c *Client) putObjectDo(ctx context.Context, bucketName, objectName string,
 			}
 		}
 		if addCrc {
-			opts.AutoChecksum.SetDefault(ChecksumCRC32C)
+			opts.AutoChecksum.SetDefault(ChecksumFullObjectCRC32C)
 			reqMetadata.addCrc = &opts.AutoChecksum
 		}
 	}

vendor/github.com/minio/minio-go/v7/api-put-object.go

@@ -26,6 +26,7 @@ import (
 	"io"
 	"net/http"
 	"sort"
+	"strings"
 	"time"
 
 	"github.com/minio/minio-go/v7/pkg/encrypt"
@@ -267,7 +268,16 @@ func (opts PutObjectOptions) validate(c *Client) (err error) {
 	if opts.LegalHold != "" && !opts.LegalHold.IsValid() {
 		return errInvalidArgument(opts.LegalHold.String() + " unsupported legal-hold status")
 	}
-	if opts.Checksum.IsSet() {
+
+	checkCrc := false
+	for k := range opts.UserMetadata {
+		if strings.HasPrefix(k, "x-amz-checksum-") {
+			checkCrc = true
+			break
+		}
+	}
+
+	if opts.Checksum.IsSet() || checkCrc {
 		switch {
 		case !c.trailingHeaderSupport:
 			return errInvalidArgument("Checksum requires Client with TrailingHeaders enabled")
@@ -307,10 +317,10 @@ func (a completedParts) Less(i, j int) bool { return a[i].PartNumber < a[j].Part
 //     be reused for best outcomes for PutObject(), pass the size always.
 //
 // NOTE: Upon errors during upload multipart operation is entirely aborted.
-func (c *Client) PutObject(ctx context.Context, bucketName, objectName string, reader io.Reader, objectSize int64,
+func (c *Client) PutObject(ctx context.Context, bucketName, objectName string, reader io.Reader, size int64,
 	opts PutObjectOptions,
 ) (info UploadInfo, err error) {
-	if objectSize < 0 && opts.DisableMultipart {
+	if size < 0 && opts.DisableMultipart {
 		return UploadInfo{}, errors.New("object size must be provided with disable multipart upload")
 	}
 
@@ -319,15 +329,20 @@ func (c *Client) PutObject(ctx context.Context, bucketName, objectName string, r
 		return UploadInfo{}, err
 	}
 
-	return c.putObjectCommon(ctx, bucketName, objectName, reader, objectSize, opts)
-}
-
-func (c *Client) putObjectCommon(ctx context.Context, bucketName, objectName string, reader io.Reader, size int64, opts PutObjectOptions) (info UploadInfo, err error) {
 	// Check for largest object size allowed.
 	if size > int64(maxMultipartPutObjectSize) {
 		return UploadInfo{}, errEntityTooLarge(size, maxMultipartPutObjectSize, bucketName, objectName)
 	}
-	opts.AutoChecksum.SetDefault(ChecksumCRC32C)
+
+	if opts.Checksum.IsSet() {
+		opts.AutoChecksum = opts.Checksum
+		opts.SendContentMd5 = false
+	}
+
+	if c.trailingHeaderSupport {
+		opts.AutoChecksum.SetDefault(ChecksumCRC32C)
+		addAutoChecksumHeaders(&opts)
+	}
 
 	// NOTE: Streaming signature is not supported by GCS.
 	if s3utils.IsGoogleEndpoint(*c.endpointURL) {
@@ -385,20 +400,11 @@ func (c *Client) putObjectMultipartStreamNoLength(ctx context.Context, bucketNam
 		return UploadInfo{}, err
 	}
 
-	if opts.Checksum.IsSet() {
-		opts.SendContentMd5 = false
-		opts.AutoChecksum = opts.Checksum
-	}
-	if !opts.SendContentMd5 {
-		addAutoChecksumHeaders(&opts)
-	}
-
 	// Initiate a new multipart upload.
 	uploadID, err := c.newUploadID(ctx, bucketName, objectName, opts)
 	if err != nil {
 		return UploadInfo{}, err
 	}
-	delete(opts.UserMetadata, "X-Amz-Checksum-Algorithm")
 
 	defer func() {
 		if err != nil {
@@ -437,11 +443,17 @@ func (c *Client) putObjectMultipartStreamNoLength(ctx context.Context, bucketNam
 			hash.Write(buf[:length])
 			md5Base64 = base64.StdEncoding.EncodeToString(hash.Sum(nil))
 			hash.Close()
-		} else {
+		}
+
+		if opts.AutoChecksum.IsSet() {
 			crc.Reset()
 			crc.Write(buf[:length])
 			cSum := crc.Sum(nil)
 			customHeader.Set(opts.AutoChecksum.Key(), base64.StdEncoding.EncodeToString(cSum))
+			customHeader.Set(amzChecksumAlgo, opts.AutoChecksum.String())
+			if opts.AutoChecksum.FullObjectRequested() {
+				customHeader.Set(amzChecksumMode, ChecksumFullObjectMode.String())
+			}
 		}
 
 		// Update progress reader appropriately to the latest offset

vendor/github.com/minio/minio-go/v7/api.go

@@ -43,12 +43,11 @@ import (
 	md5simd "github.com/minio/md5-simd"
 	"github.com/minio/minio-go/v7/pkg/credentials"
 	"github.com/minio/minio-go/v7/pkg/kvcache"
+	"github.com/minio/minio-go/v7/pkg/peeker"
 	"github.com/minio/minio-go/v7/pkg/s3utils"
 	"github.com/minio/minio-go/v7/pkg/signer"
 	"github.com/minio/minio-go/v7/pkg/singleflight"
 	"golang.org/x/net/publicsuffix"
-
-	internalutils "github.com/minio/minio-go/v7/pkg/utils"
 )
 
 // Client implements Amazon S3 compatible methods.
@@ -163,7 +162,7 @@ type Options struct {
 // Global constants.
 const (
 	libraryName    = "minio-go"
-	libraryVersion = "v7.0.94"
+	libraryVersion = "v7.0.95"
 )
 
 // User Agent should always following the below style.
@@ -625,7 +624,7 @@ func (c *Client) do(req *http.Request) (resp *http.Response, err error) {
 //   - Return the error XML bytes if an error is found
 //   - Make sure to always restablish the whole http response stream before returning
 func tryParseErrRespFromBody(resp *http.Response) ([]byte, error) {
-	peeker := internalutils.NewPeekReadCloser(resp.Body, 5*humanize.MiByte)
+	peeker := peeker.NewPeekReadCloser(resp.Body, 5*humanize.MiByte)
 	defer func() {
 		peeker.ReplayFromStart()
 		resp.Body = peeker

vendor/github.com/minio/minio-go/v7/checksum.go

@@ -29,6 +29,7 @@ import (
 	"math/bits"
 	"net/http"
 	"sort"
+	"strings"
 
 	"github.com/minio/crc64nvme"
 )
@@ -432,9 +433,19 @@ func addAutoChecksumHeaders(opts *PutObjectOptions) {
 	if opts.UserMetadata == nil {
 		opts.UserMetadata = make(map[string]string, 1)
 	}
-	opts.UserMetadata["X-Amz-Checksum-Algorithm"] = opts.AutoChecksum.String()
+
-	if opts.AutoChecksum.FullObjectRequested() {
+	addChecksum := true
-		opts.UserMetadata[amzChecksumMode] = ChecksumFullObjectMode.String()
+	for k := range opts.UserMetadata {
+		if strings.HasPrefix(strings.ToLower(k), "x-amz-checksum-") {
+			addChecksum = false
+		}
+	}
+
+	if addChecksum && opts.AutoChecksum.IsSet() {
+		opts.UserMetadata[amzChecksumAlgo] = opts.AutoChecksum.String()
+		if opts.AutoChecksum.FullObjectRequested() {
+			opts.UserMetadata[amzChecksumMode] = ChecksumFullObjectMode.String()
+		}
 	}
 }
 
@@ -446,14 +457,17 @@ func applyAutoChecksum(opts *PutObjectOptions, allParts []ObjectPart) {
 		// Add composite hash of hashes.
 		crc, err := opts.AutoChecksum.CompositeChecksum(allParts)
 		if err == nil {
-			opts.UserMetadata = map[string]string{opts.AutoChecksum.Key(): crc.Encoded()}
+			opts.UserMetadata = map[string]string{
+				opts.AutoChecksum.Key(): crc.Encoded(),
+				amzChecksumMode:         ChecksumCompositeMode.String(),
+			}
 		}
 	} else if opts.AutoChecksum.CanMergeCRC() {
 		crc, err := opts.AutoChecksum.FullObjectChecksum(allParts)
 		if err == nil {
 			opts.UserMetadata = map[string]string{
-				opts.AutoChecksum.KeyCapitalized(): crc.Encoded(),
+				opts.AutoChecksum.Key(): crc.Encoded(),
-				amzChecksumMode:                    ChecksumFullObjectMode.String(),
+				amzChecksumMode:         ChecksumFullObjectMode.String(),
 			}
 		}
 	}

vendor/github.com/minio/minio-go/v7/functional_tests.go

@@ -1970,7 +1970,7 @@ func testPutObjectWithChecksums() {
 	// initialize logging params
 	startTime := time.Now()
 	testName := getFuncName()
-	function := "PutObject(bucketName, objectName, reader,size, opts)"
+	function := "PutObject(bucketName, objectName, reader, size, opts)"
 	args := map[string]interface{}{
 		"bucketName": "",
 		"objectName": "",
@@ -1982,7 +1982,7 @@ func testPutObjectWithChecksums() {
 		return
 	}
 
-	c, err := NewClient(ClientConfig{})
+	c, err := NewClient(ClientConfig{TrailingHeaders: true})
 	if err != nil {
 		logError(testName, function, args, startTime, "", "MinIO client object creation failed", err)
 		return
@@ -2037,6 +2037,10 @@ func testPutObjectWithChecksums() {
 		h := test.cs.Hasher()
 		h.Reset()
 
+		if test.cs.IsSet() {
+			meta["x-amz-checksum-algorithm"] = test.cs.String()
+		}
+
 		// Test with a bad CRC - we haven't called h.Write(b), so this is a checksum of empty data
 		meta[test.cs.Key()] = base64.StdEncoding.EncodeToString(h.Sum(nil))
 		args["metadata"] = meta
@@ -2323,7 +2327,7 @@ func testPutObjectWithTrailingChecksums() {
 }
 
 // Test PutObject with custom checksums.
-func testPutMultipartObjectWithChecksums(trailing bool) {
+func testPutMultipartObjectWithChecksums() {
 	// initialize logging params
 	startTime := time.Now()
 	testName := getFuncName()
@@ -2331,7 +2335,7 @@ func testPutMultipartObjectWithChecksums(trailing bool) {
 	args := map[string]interface{}{
 		"bucketName": "",
 		"objectName": "",
-		"opts":       fmt.Sprintf("minio.PutObjectOptions{UserMetadata: metadata, Trailing: %v}", trailing),
+		"opts":       "minio.PutObjectOptions{UserMetadata: metadata, Trailing: true}",
 	}
 
 	if !isFullMode() {
@@ -2339,7 +2343,7 @@ func testPutMultipartObjectWithChecksums(trailing bool) {
 		return
 	}
 
-	c, err := NewClient(ClientConfig{TrailingHeaders: trailing})
+	c, err := NewClient(ClientConfig{TrailingHeaders: true})
 	if err != nil {
 		logError(testName, function, args, startTime, "", "MinIO client object creation failed", err)
 		return
@@ -2433,12 +2437,8 @@ func testPutMultipartObjectWithChecksums(trailing bool) {
 		h.Reset()
 		want := hashMultiPart(b, partSize, test.cs)
 
-		var cs minio.ChecksumType
+		rd := bytes.NewReader(b)
-		rd := io.Reader(io.NopCloser(bytes.NewReader(b)))
+		cs := test.cs
-		if trailing {
-			cs = test.cs
-			rd = bytes.NewReader(b)
-		}
 
 		// Set correct CRC.
 		args["section"] = "PutObject"
@@ -2447,7 +2447,6 @@ func testPutMultipartObjectWithChecksums(trailing bool) {
 			DisableMultipart:     false,
 			UserMetadata:         nil,
 			PartSize:             partSize,
-			AutoChecksum:         test.cs,
 			Checksum:             cs,
 		})
 		if err != nil {
@@ -2589,11 +2588,10 @@ func testTrailingChecksums() {
 		return
 	}
 
-	hashMultiPart := func(b []byte, partSize int, hasher hash.Hash) string {
+	hashMultiPart := func(b []byte, partSize int, hasher hash.Hash) (oparts []minio.ObjectPart) {
 		r := bytes.NewReader(b)
 		tmp := make([]byte, partSize)
 		parts := 0
-		var all []byte
 		for {
 			n, err := io.ReadFull(r, tmp)
 			if err != nil && err != io.ErrUnexpectedEOF {
@@ -2605,14 +2603,16 @@ func testTrailingChecksums() {
 			parts++
 			hasher.Reset()
 			hasher.Write(tmp[:n])
-			all = append(all, hasher.Sum(nil)...)
+			oparts = append(oparts, minio.ObjectPart{
+				PartNumber:     parts,
+				Size:           int64(n),
+				ChecksumCRC32C: base64.StdEncoding.EncodeToString(hasher.Sum(nil)),
+			})
 			if err != nil {
 				break
 			}
 		}
-		hasher.Reset()
+		return oparts
-		hasher.Write(all)
-		return fmt.Sprintf("%s-%d", base64.StdEncoding.EncodeToString(hasher.Sum(nil)), parts)
 	}
 	defer cleanupBucket(bucketName, c)
 	tests := []struct {
@@ -2636,6 +2636,7 @@ func testTrailingChecksums() {
 				DisableMultipart:     false,
 				UserMetadata:         nil,
 				PartSize:             5 << 20,
+				Checksum:             minio.ChecksumFullObjectCRC32C,
 			},
 		},
 		{
@@ -2647,6 +2648,7 @@ func testTrailingChecksums() {
 				DisableMultipart:     false,
 				UserMetadata:         nil,
 				PartSize:             6_645_654, // Rather arbitrary size
+				Checksum:             minio.ChecksumFullObjectCRC32C,
 			},
 		},
 		{
@@ -2658,6 +2660,7 @@ func testTrailingChecksums() {
 				DisableMultipart:     false,
 				UserMetadata:         nil,
 				PartSize:             5 << 20,
+				Checksum:             minio.ChecksumFullObjectCRC32C,
 			},
 		},
 		{
@@ -2669,6 +2672,7 @@ func testTrailingChecksums() {
 				DisableMultipart:     false,
 				UserMetadata:         nil,
 				PartSize:             6_645_654, // Rather arbitrary size
+				Checksum:             minio.ChecksumFullObjectCRC32C,
 			},
 		},
 	}
@@ -2696,7 +2700,14 @@ func testTrailingChecksums() {
 		reader.Close()
 		h := test.hasher
 		h.Reset()
-		test.ChecksumCRC32C = hashMultiPart(b, int(test.PO.PartSize), test.hasher)
+
+		parts := hashMultiPart(b, int(test.PO.PartSize), test.hasher)
+		cksum, err := minio.ChecksumFullObjectCRC32C.FullObjectChecksum(parts)
+		if err != nil {
+			logError(testName, function, args, startTime, "", "checksum calculation failed", err)
+			return
+		}
+		test.ChecksumCRC32C = cksum.Encoded()
 
 		// Set correct CRC.
 		resp, err := c.PutObject(context.Background(), bucketName, objectName, bytes.NewReader(b), int64(bufSize), test.PO)
@@ -4172,7 +4183,7 @@ func testFPutObjectMultipart() {
 		"opts":       "",
 	}
 
-	c, err := NewClient(ClientConfig{})
+	c, err := NewClient(ClientConfig{TrailingHeaders: true})
 	if err != nil {
 		logError(testName, function, args, startTime, "", "MinIO client object creation failed", err)
 		return
@@ -5586,6 +5597,161 @@ func testPresignedPostPolicyWrongFile() {
 	logSuccess(testName, function, args, startTime)
 }
 
+// testPresignedPostPolicyEmptyFileName tests that an empty file name in the presigned post policy
+func testPresignedPostPolicyEmptyFileName() {
+	// initialize logging params
+	startTime := time.Now()
+	testName := getFuncName()
+	function := "PresignedPostPolicy(policy)"
+	args := map[string]interface{}{
+		"policy": "",
+	}
+
+	c, err := NewClient(ClientConfig{})
+	if err != nil {
+		logError(testName, function, args, startTime, "", "MinIO client object creation failed", err)
+		return
+	}
+
+	// Generate a new random bucket name.
+	bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-")
+
+	// Make a new bucket in 'us-east-1' (source bucket).
+	err = c.MakeBucket(context.Background(), bucketName, minio.MakeBucketOptions{Region: "us-east-1"})
+	if err != nil {
+		logError(testName, function, args, startTime, "", "MakeBucket failed", err)
+		return
+	}
+
+	defer cleanupBucket(bucketName, c)
+
+	// Generate 33K of data.
+	reader := getDataReader("datafile-33-kB")
+	defer reader.Close()
+
+	objectName := randString(60, rand.NewSource(time.Now().UnixNano()), "")
+	// Azure requires the key to not start with a number
+	metadataKey := randString(60, rand.NewSource(time.Now().UnixNano()), "user")
+	metadataValue := randString(60, rand.NewSource(time.Now().UnixNano()), "")
+
+	buf, err := io.ReadAll(reader)
+	if err != nil {
+		logError(testName, function, args, startTime, "", "ReadAll failed", err)
+		return
+	}
+
+	policy := minio.NewPostPolicy()
+	policy.SetBucket(bucketName)
+	policy.SetKey(objectName)
+	policy.SetExpires(time.Now().UTC().AddDate(0, 0, 10)) // expires in 10 days
+	policy.SetContentType("binary/octet-stream")
+	policy.SetContentLengthRange(10, 1024*1024)
+	policy.SetUserMetadata(metadataKey, metadataValue)
+	policy.SetContentEncoding("gzip")
+
+	// Add CRC32C
+	checksum := minio.ChecksumCRC32C.ChecksumBytes(buf)
+	err = policy.SetChecksum(checksum)
+	if err != nil {
+		logError(testName, function, args, startTime, "", "SetChecksum failed", err)
+		return
+	}
+
+	args["policy"] = policy.String()
+
+	presignedPostPolicyURL, formData, err := c.PresignedPostPolicy(context.Background(), policy)
+	if err != nil {
+		logError(testName, function, args, startTime, "", "PresignedPostPolicy failed", err)
+		return
+	}
+
+	var formBuf bytes.Buffer
+	writer := multipart.NewWriter(&formBuf)
+	for k, v := range formData {
+		writer.WriteField(k, v)
+	}
+
+	// Get a 33KB file to upload and test if set post policy works
+	filePath := getMintDataDirFilePath("datafile-33-kB")
+	if filePath == "" {
+		// Make a temp file with 33 KB data.
+		file, err := os.CreateTemp(os.TempDir(), "PresignedPostPolicyTest")
+		if err != nil {
+			logError(testName, function, args, startTime, "", "TempFile creation failed", err)
+			return
+		}
+		if _, err = io.Copy(file, getDataReader("datafile-33-kB")); err != nil {
+			logError(testName, function, args, startTime, "", "Copy failed", err)
+			return
+		}
+		if err = file.Close(); err != nil {
+			logError(testName, function, args, startTime, "", "File Close failed", err)
+			return
+		}
+		filePath = file.Name()
+	}
+
+	// add file to post request
+	f, err := os.Open(filePath)
+	defer f.Close()
+	if err != nil {
+		logError(testName, function, args, startTime, "", "File open failed", err)
+		return
+	}
+	w, err := writer.CreateFormFile("", filePath)
+	if err != nil {
+		logError(testName, function, args, startTime, "", "CreateFormFile failed", err)
+		return
+	}
+
+	_, err = io.Copy(w, f)
+	if err != nil {
+		logError(testName, function, args, startTime, "", "Copy failed", err)
+		return
+	}
+	writer.Close()
+
+	httpClient := &http.Client{
+		// Setting a sensible time out of 30secs to wait for response
+		// headers. Request is pro-actively canceled after 30secs
+		// with no response.
+		Timeout:   30 * time.Second,
+		Transport: createHTTPTransport(),
+	}
+	args["url"] = presignedPostPolicyURL.String()
+
+	req, err := http.NewRequest(http.MethodPost, presignedPostPolicyURL.String(), bytes.NewReader(formBuf.Bytes()))
+	if err != nil {
+		logError(testName, function, args, startTime, "", "Http request failed", err)
+		return
+	}
+
+	req.Header.Set("Content-Type", writer.FormDataContentType())
+
+	// make post request with correct form data
+	res, err := httpClient.Do(req)
+	if err != nil {
+		logError(testName, function, args, startTime, "", "Http request failed", err)
+		return
+	}
+	defer res.Body.Close()
+	if res.StatusCode != http.StatusBadRequest {
+		logError(testName, function, args, startTime, "", "Http request failed", errors.New(res.Status))
+		return
+	}
+
+	body, err := io.ReadAll(res.Body)
+	if err != nil {
+		logError(testName, function, args, startTime, "", "ReadAll failed", err)
+		return
+	}
+	if !strings.Contains(string(body), "MalformedPOSTRequest") {
+		logError(testName, function, args, startTime, "", "Invalid error from server", errors.New(string(body)))
+	}
+
+	logSuccess(testName, function, args, startTime)
+}
+
 // Tests copy object
 func testCopyObject() {
 	// initialize logging params
@@ -11560,8 +11726,11 @@ func testPutObjectMetadataNonUSASCIIV2() {
 	}
 
 	for k, v := range metadata {
+		if strings.HasPrefix(strings.ToLower(k), "x-amz-checksum-") {
+			continue
+		}
 		if st.Metadata.Get(http.CanonicalHeaderKey("X-Amz-Meta-"+k)) != v {
-			logError(testName, function, args, startTime, "", "Expected upload object metadata "+k+": "+v+" but got "+st.Metadata.Get("X-Amz-Meta-"+k), err)
+			logError(testName, function, args, startTime, "", "Expected upload object metadata "+k+": "+v+" but got "+st.Metadata.Get(http.CanonicalHeaderKey("X-Amz-Meta-"+k)), err)
 			return
 		}
 	}
@@ -14069,8 +14238,7 @@ func main() {
 		testUserMetadataCopyingV2()
 		testPutObjectWithChecksums()
 		testPutObjectWithTrailingChecksums()
-		testPutMultipartObjectWithChecksums(false)
+		testPutMultipartObjectWithChecksums()
-		testPutMultipartObjectWithChecksums(true)
 		testPutObject0ByteV2()
 		testPutObjectMetadataNonUSASCIIV2()
 		testPutObjectNoLengthV2()
@@ -14098,6 +14266,7 @@ func main() {
 		testGetObjectReadAtWhenEOFWasReached()
 		testPresignedPostPolicy()
 		testPresignedPostPolicyWrongFile()
+		testPresignedPostPolicyEmptyFileName()
 		testCopyObject()
 		testComposeObjectErrorCases()
 		testCompose10KSources()

vendor/github.com/minio/minio-go/v7/hook-reader.go

@@ -84,7 +84,7 @@ func (hr *hookReader) Read(b []byte) (n int, err error) {
 // reports the data read from the source to the hook.
 func newHook(source, hook io.Reader) io.Reader {
 	if hook == nil {
-		return source
+		return &hookReader{source: source}
 	}
 	return &hookReader{
 		source: source,

vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_tls_identity.go

@@ -125,6 +125,7 @@ func (i *STSCertificateIdentity) RetrieveWithCredContext(cc *CredContext) (Value
 	queryValues := url.Values{}
 	queryValues.Set("Action", "AssumeRoleWithCertificate")
 	queryValues.Set("Version", STSVersion)
+	queryValues.Set("DurationSeconds", strconv.FormatUint(uint64(livetime.Seconds()), 10))
 	if i.TokenRevokeType != "" {
 		queryValues.Set("TokenRevokeType", i.TokenRevokeType)
 	}
@@ -134,10 +135,6 @@ func (i *STSCertificateIdentity) RetrieveWithCredContext(cc *CredContext) (Value
 	if err != nil {
 		return Value{}, err
 	}
-	if req.Form == nil {
-		req.Form = url.Values{}
-	}
-	req.Form.Add("DurationSeconds", strconv.FormatUint(uint64(livetime.Seconds()), 10))
 
 	client := i.Client
 	if client == nil {

vendor/github.com/minio/minio-go/v7/pkg/peeker/peek-reader-closer.go

@@ -15,7 +15,7 @@
  * limitations under the License.
  */
 
-package utils
+package peeker
 
 import (
 	"bytes"

vendor/github.com/minio/minio-go/v7/post-policy.go

@@ -417,7 +417,7 @@ func (p PostPolicy) String() string {
 
 // marshalJSON - Provides Marshaled JSON in bytes.
 func (p PostPolicy) marshalJSON() []byte {
-	expirationStr := `"expiration":"` + p.expiration.Format(expirationDateFormat) + `"`
+	expirationStr := `"expiration":"` + p.expiration.UTC().Format(expirationDateFormat) + `"`
 	var conditionsStr string
 	conditions := []string{}
 	for _, po := range p.conditions {

vendor/github.com/nats-io/nats.go/.gitignore

@@ -42,4 +42,4 @@ _testmain.go
 .idea
 
 # VS Code
-.vscode 
+.vscode

vendor/github.com/nats-io/nats.go/README.md

@@ -23,7 +23,7 @@ A [Go](http://golang.org) client for the [NATS messaging system](https://nats.io
 go get github.com/nats-io/nats.go@latest
 
 # To get a specific version:
-go get github.com/nats-io/nats.go@v1.43.0
+go get github.com/nats-io/nats.go@v1.44.0
 
 # Note that the latest major version for NATS Server is v2:
 go get github.com/nats-io/nats-server/v2@latest

vendor/github.com/nats-io/nats.go/jetstream/README.md

@@ -6,33 +6,30 @@ This doc covers the basic usage of the `jetstream` package in `nats.go` client.
 - [Overview](#overview)
 - [Basic usage](#basic-usage)
 - [Streams](#streams)
-- [Stream management (CRUD)](#stream-management-crud)
+  - [Stream management (CRUD)](#stream-management-crud)
-- [Listing streams and stream names](#listing-streams-and-stream-names)
+  - [Listing streams and stream names](#listing-streams-and-stream-names)
-- [Stream-specific operations](#stream-specific-operations)
+  - [Stream-specific operations](#stream-specific-operations)
 - [Consumers](#consumers)
-- [Consumers management](#consumers-management)
+  - [Consumers management](#consumers-management)
-- [Listing consumers and consumer
+  - [Listing consumers and consumer names](#listing-consumers-and-consumer-names)
-    names](#listing-consumers-and-consumer-names)
+  - [Ordered consumers](#ordered-consumers)
-- [Ordered consumers](#ordered-consumers)
+  - [Receiving messages from pull consumers](#receiving-messages-from-pull-consumers)
-- [Receiving messages from the
+    - [Single fetch](#single-fetch)
-    consumer](#receiving-messages-from-the-consumer)
+    - [Continuous polling](#continuous-polling)
-  - [Single fetch](#single-fetch)
+      - [Using `Consume()` receive messages in a callback](#using-consume-receive-messages-in-a-callback)
-  - [Continuous polling](#continuous-polling)
+      - [Using `Messages()` to iterate over incoming messages](#using-messages-to-iterate-over-incoming-messages)
-  - [Using `Consume()` receive messages in a
+    - [Receiving messages from push consumers](#receiving-messages-from-push-consumers)
-        callback](#using-consume-receive-messages-in-a-callback)
-  - [Using `Messages()` to iterate over incoming
-        messages](#using-messages-to-iterate-over-incoming-messages)
 - [Publishing on stream](#publishing-on-stream)
-- [Synchronous publish](#synchronous-publish)
+  - [Synchronous publish](#synchronous-publish)
-- [Async publish](#async-publish)
+  - [Async publish](#async-publish)
 - [KeyValue Store](#keyvalue-store)
-- [Basic usage of KV bucket](#basic-usage-of-kv-bucket)
+  - [Basic usage of KV bucket](#basic-usage-of-kv-bucket)
-- [Watching for changes on a bucket](#watching-for-changes-on-a-bucket)
+  - [Watching for changes on a bucket](#watching-for-changes-on-a-bucket)
-- [Additional operations on a bucket](#additional-operations-on-a-bucket)
+  - [Additional operations on a bucket](#additional-operations-on-a-bucket)
 - [Object Store](#object-store)
-- [Basic usage of Object Store](#basic-usage-of-object-store)
+  - [Basic usage of Object Store](#basic-usage-of-object-store)
-- [Watching for changes on a store](#watching-for-changes-on-a-store)
+  - [Watching for changes on a store](#watching-for-changes-on-a-store)
-- [Additional operations on a store](#additional-operations-on-a-store)
+  - [Additional operations on a store](#additional-operations-on-a-store)
 - [Examples](#examples)
 
 ## Overview
@@ -254,14 +251,34 @@ fmt.Println(cachedInfo.Config.Name)
 
 ## Consumers
 
-Only pull consumers are supported in `jetstream` package. However, unlike the
+Both pull and push consumers are supported in `jetstream` package. For most use
-JetStream API in `nats` package, pull consumers allow for continuous message
+cases, we recommend using pull consumers as they allow for more fine-grained
-retrieval (similarly to how `nats.Subscribe()` works). Because of that, push
+control over the message processing and can often prevent issues such as e.g.
-consumers can be easily replaced by pull consumers for most of the use cases.
+slow consumers. However, unlike the JetStream API in `nats` package, pull
+consumers allow for continuous message retrieval (similarly to how
+`nats.Subscribe()` works). Because of that, push consumers can be easily
+replaced by pull consumers for most of the use cases. Push consumers are
+supported mainly for the purpose of ease of migration from `nats` package. The
+interfaces for consuming messages via push and pull consumers are similar, with
+the main difference being that push consumers do not support fetching individual
+batches of messages.
 
 ### Consumers management
 
-CRUD operations on consumers can be achieved on 2 levels:
+Both pull and push consumers can be managed using `jetstream` package. The
+following example demonstrates how to create, update, fetch and delete a pull
+consumer. Push consumers can be managed in a similar way, with method names
+containing `Push` (e.g. `CreatePushConsumer`, `UpdatePushConsumer`,
+`DeletePushConsumer`).
+
+> __NOTE__: It is important to use `CreateConsumer` and `CreatePushConsumer`
+methods to create the respective consumer types as they return the correct
+interface (different for push and pull consumers). `DeliverSubject` is mandatory
+when creating a push consumer and cannot be provided when creating a pull
+consumer. Similarly, an attempt to get a push consumer using `Consumer` method
+will result in an error (and vice versa).
+
+CRUD operations on pull consumers can be achieved on 2 levels:
 
 - on `JetStream` interface
 
@@ -370,6 +387,8 @@ message ordering. It is also resilient to consumer deletion.
 Ordered consumers present the same set of message consumption methods as
 standard pull consumers.
 
+> __NOTE__: Ordered consumers are not supported for push consumers.
+
 ```go
 js, _ := jetstream.New(nc)
 
@@ -380,7 +399,7 @@ cons, _ := js.OrderedConsumer(ctx, "ORDERS", jetstream.OrderedConsumerConfig{
 })
 ```
 
-### Receiving messages from the consumer
+### Receiving messages from pull consumers
 
 The `Consumer` interface covers allows fetching messages on demand, with
 pre-defined batch size on bytes limit, or continuous push-like receiving of
@@ -469,10 +488,12 @@ cons, _ := js.CreateOrUpdateConsumer("ORDERS", jetstream.ConsumerConfig{
     AckPolicy: jetstream.AckExplicitPolicy,
     // receive messages from ORDERS.A subject only
     FilterSubject: "ORDERS.A"
-}))
+})
 
 consContext, _ := c.Consume(func(msg jetstream.Msg) {
     fmt.Printf("Received a JetStream message: %s\n", string(msg.Data()))
+    // messages are not acknowledged automatically
+    msg.Ack()
 })
 defer consContext.Stop()
 ```
@@ -497,7 +518,7 @@ type PullThresholdMessages int
   buffer
 - `PullHeartbeat(time.Duration)` - idle heartbeat duration for a single pull
 request. An error will be triggered if at least 2 heartbeats are missed
-- `WithConsumeErrHandler(func (ConsumeContext, error))` - when used, sets a
+- `ConsumeErrHandler(func (ConsumeContext, error))` - when used, sets a
   custom error handler on `Consume()`, allowing e.g. tracking missing
   heartbeats.
 - `PullMaxMessagesWithBytesLimit` - up to the provided number of messages will
@@ -591,6 +612,40 @@ for {
 }
 ```
 
+#### Receiving messages from push consumers
+
+The `PushConsumer` interface currently only allows message processing in a
+callback using `Consume()`.
+
+As heartbeat for push consumers is not managed when using `Consume()`, it is
+important to set `IdleHeartbeat` on the consumer level. Similarly, `FlowControl`
+can be set to prevent the consumer from receiving more messages than it can
+handle.
+
+```go
+cons, _ := js.CreateOrUpdatePushConsumer("ORDERS", jetstream.ConsumerConfig{
+    DeliverSubject: nats.NewInbox()
+    AckPolicy: jetstream.AckExplicitPolicy,
+    // receive messages from ORDERS.A subject only
+    FilterSubject: "ORDERS.A",
+    // unlike pull consumers, idle heartbeat is configured on the consumer level
+    IdleHeartbeat: 30 * time.Second
+})
+
+consContext, _ := c.Consume(func(msg jetstream.Msg) {
+    fmt.Printf("Received a JetStream message: %s\n", string(msg.Data()))
+    // messages are not acknowledged automatically
+    msg.Ack()
+})
+defer consContext.Stop()
+```
+
+`Consume()` on `PushConsumer` can be supplied with `ConsumeErrHandler` option
+to set a custom error handler allowing e.g. tracking missing heartbeats.
+
+> __NOTE__: `Stop()` should always be called on `ConsumeContext` to avoid
+> leaking goroutines.
+
 ## Publishing on stream
 
 `JetStream` interface allows publishing messages on stream in 2 ways:

vendor/github.com/nats-io/nats.go/jetstream/api.go

@@ -127,8 +127,8 @@ func (js *jetStream) apiRequest(ctx context.Context, subj string, data ...[]byte
 	if len(data) > 0 {
 		req = data[0]
 	}
-	if js.opts.clientTrace != nil {
+	if js.opts.ClientTrace != nil {
-		ctrace := js.opts.clientTrace
+		ctrace := js.opts.ClientTrace
 		if ctrace.RequestSent != nil {
 			ctrace.RequestSent(subj, req)
 		}
@@ -137,8 +137,8 @@ func (js *jetStream) apiRequest(ctx context.Context, subj string, data ...[]byte
 	if err != nil {
 		return nil, err
 	}
-	if js.opts.clientTrace != nil {
+	if js.opts.ClientTrace != nil {
-		ctrace := js.opts.clientTrace
+		ctrace := js.opts.ClientTrace
 		if ctrace.ResponseReceived != nil {
 			ctrace.ResponseReceived(subj, resp.Data, resp.Header)
 		}

vendor/github.com/nats-io/nats.go/jetstream/consumer.go

@@ -147,6 +147,21 @@ type (
 		CachedInfo() *ConsumerInfo
 	}
 
+	PushConsumer interface {
+		// Consume will continuously receive messages and handle them
+		// with the provided callback function. Consume can be configured using
+		// PushConsumeOpt options:
+		//
+		// - Error handling and monitoring can be configured using ConsumeErrHandler.
+		Consume(handler MessageHandler, opts ...PushConsumeOpt) (ConsumeContext, error)
+
+		// Info fetches current ConsumerInfo from the server.
+		Info(context.Context) (*ConsumerInfo, error)
+
+		// CachedInfo returns ConsumerInfo currently cached on this consumer.
+		CachedInfo() *ConsumerInfo
+	}
+
 	createConsumerRequest struct {
 		Stream string          `json:"stream_name"`
 		Config *ConsumerConfig `json:"config"`
@@ -187,7 +202,74 @@ func (p *pullConsumer) CachedInfo() *ConsumerInfo {
 	return p.info
 }
 
-func upsertConsumer(ctx context.Context, js *jetStream, stream string, cfg ConsumerConfig, action string) (Consumer, error) {
+// Info fetches current ConsumerInfo from the server.
+func (p *pushConsumer) Info(ctx context.Context) (*ConsumerInfo, error) {
+	ctx, cancel := p.js.wrapContextWithoutDeadline(ctx)
+	if cancel != nil {
+		defer cancel()
+	}
+	infoSubject := fmt.Sprintf(apiConsumerInfoT, p.stream, p.name)
+	var resp consumerInfoResponse
+
+	if _, err := p.js.apiRequestJSON(ctx, infoSubject, &resp); err != nil {
+		return nil, err
+	}
+	if resp.Error != nil {
+		if resp.Error.ErrorCode == JSErrCodeConsumerNotFound {
+			return nil, ErrConsumerNotFound
+		}
+		return nil, resp.Error
+	}
+	if resp.Error == nil && resp.ConsumerInfo == nil {
+		return nil, ErrConsumerNotFound
+	}
+
+	p.info = resp.ConsumerInfo
+	return resp.ConsumerInfo, nil
+}
+
+// CachedInfo returns ConsumerInfo currently cached on this consumer.
+// This method does not perform any network requests. The cached
+// ConsumerInfo is updated on every call to Info and Update.
+func (p *pushConsumer) CachedInfo() *ConsumerInfo {
+	return p.info
+}
+
+func upsertPullConsumer(ctx context.Context, js *jetStream, stream string, cfg ConsumerConfig, action string) (Consumer, error) {
+	resp, err := upsertConsumer(ctx, js, stream, cfg, action)
+	if err != nil {
+		return nil, err
+	}
+
+	return &pullConsumer{
+		js:      js,
+		stream:  stream,
+		name:    resp.Name,
+		durable: cfg.Durable != "",
+		info:    resp.ConsumerInfo,
+		subs:    syncx.Map[string, *pullSubscription]{},
+	}, nil
+}
+
+func upsertPushConsumer(ctx context.Context, js *jetStream, stream string, cfg ConsumerConfig, action string) (PushConsumer, error) {
+	if cfg.DeliverSubject == "" {
+		return nil, ErrNotPushConsumer
+	}
+
+	resp, err := upsertConsumer(ctx, js, stream, cfg, action)
+	if err != nil {
+		return nil, err
+	}
+
+	return &pushConsumer{
+		js:     js,
+		stream: stream,
+		name:   resp.Name,
+		info:   resp.ConsumerInfo,
+	}, nil
+}
+
+func upsertConsumer(ctx context.Context, js *jetStream, stream string, cfg ConsumerConfig, action string) (*consumerInfoResponse, error) {
 	ctx, cancel := js.wrapContextWithoutDeadline(ctx)
 	if cancel != nil {
 		defer cancel()
@@ -240,14 +322,7 @@ func upsertConsumer(ctx context.Context, js *jetStream, stream string, cfg Consu
 		return nil, ErrConsumerMultipleFilterSubjectsNotSupported
 	}
 
-	return &pullConsumer{
+	return &resp, nil
-		js:      js,
-		stream:  stream,
-		name:    resp.Name,
-		durable: cfg.Durable != "",
-		info:    resp.ConsumerInfo,
-		subs:    syncx.Map[string, *pullSubscription]{},
-	}, nil
 }
 
 const (
@@ -268,6 +343,48 @@ func generateConsName() string {
 }
 
 func getConsumer(ctx context.Context, js *jetStream, stream, name string) (Consumer, error) {
+	info, err := fetchConsumerInfo(ctx, js, stream, name)
+	if err != nil {
+		return nil, err
+	}
+
+	if info.Config.DeliverSubject != "" {
+		return nil, ErrNotPullConsumer
+	}
+
+	cons := &pullConsumer{
+		js:      js,
+		stream:  stream,
+		name:    name,
+		durable: info.Config.Durable != "",
+		info:    info,
+		subs:    syncx.Map[string, *pullSubscription]{},
+	}
+
+	return cons, nil
+}
+
+func getPushConsumer(ctx context.Context, js *jetStream, stream, name string) (PushConsumer, error) {
+	info, err := fetchConsumerInfo(ctx, js, stream, name)
+	if err != nil {
+		return nil, err
+	}
+
+	if info.Config.DeliverSubject == "" {
+		return nil, ErrNotPushConsumer
+	}
+
+	cons := &pushConsumer{
+		js:     js,
+		stream: stream,
+		name:   name,
+		info:   info,
+	}
+
+	return cons, nil
+}
+
+func fetchConsumerInfo(ctx context.Context, js *jetStream, stream, name string) (*ConsumerInfo, error) {
 	ctx, cancel := js.wrapContextWithoutDeadline(ctx)
 	if cancel != nil {
 		defer cancel()
@@ -292,16 +409,7 @@ func getConsumer(ctx context.Context, js *jetStream, stream, name string) (Consu
 		return nil, ErrConsumerNotFound
 	}
 
-	cons := &pullConsumer{
+	return resp.ConsumerInfo, nil
-		js:      js,
-		stream:  stream,
-		name:    name,
-		durable: resp.Config.Durable != "",
-		info:    resp.ConsumerInfo,
-		subs:    syncx.Map[string, *pullSubscription]{},
-	}
-
-	return cons, nil
 }
 
 func deleteConsumer(ctx context.Context, js *jetStream, stream, consumer string) error {

vendor/github.com/nats-io/nats.go/jetstream/consumer_config.go

@@ -98,7 +98,8 @@ type (
 		PinnedTS time.Time `json:"pinned_ts,omitempty"`
 	}
 
-	// ConsumerConfig is the configuration of a JetStream consumer.
+	// ConsumerConfig represents the configuration of a JetStream consumer,
+	// encompassing both push and pull consumer settings
 	ConsumerConfig struct {
 		// Name is an optional name for the consumer. If not set, one is
 		// generated automatically.
@@ -253,6 +254,26 @@ type (
 
 		// PriorityGroups is a list of priority groups this consumer supports.
 		PriorityGroups []string `json:"priority_groups,omitempty"`
+
+		// Fields specific for push consumers:
+
+		// DeliverSubject is the subject to deliver messages to for push consumers
+		DeliverSubject string `json:"deliver_subject,omitempty"`
+
+		// DeliverGroup is the group name for push consumers
+		DeliverGroup string `json:"deliver_group,omitempty"`
+
+		// FlowControl is a flag to enable flow control for the consumer.
+		// When set, server will regularly send an empty message with Status
+		// header 100 and a reply subject, consumers must reply to these
+		// messages to control the rate of message delivery
+		FlowControl bool `json:"flow_control,omitempty"`
+
+		// IdleHeartbeat enables push consumer idle heartbeat messages.
+		// If the Consumer is idle for more than the set value, an empty message
+		// with Status header 100 will be sent indicating the consumer is still
+		// alive.
+		IdleHeartbeat time.Duration `json:"idle_heartbeat,omitempty"`
 	}
 
 	// OrderedConsumerConfig is the configuration of an ordered JetStream

vendor/github.com/nats-io/nats.go/jetstream/errors.go

@@ -161,6 +161,18 @@ var (
 	// does not exist.
 	ErrConsumerNameAlreadyInUse JetStreamError = &jsError{message: "consumer name already in use"}
 
+	// ErrNotPullConsumer is returned when attempting to fetch or create pull
+	// consumer and the returned consumer is a push consumer.
+	ErrNotPullConsumer JetStreamError = &jsError{message: "consumer is not a pull consumer"}
+
+	// ErrNotPushConsumer is returned when attempting to fetch or create push
+	// consumer and the returned consumer is a pull consumer.
+	ErrNotPushConsumer JetStreamError = &jsError{message: "consumer is not a push consumer"}
+
+	// ErrConsumerAlreadyConsuming is returned when attempting to consume from
+	// the same push consumer more than once.
+	ErrConsumerAlreadyConsuming JetStreamError = &jsError{message: "consumer is already consuming"}
+
 	// ErrInvalidJSAck is returned when JetStream ack from message publish is
 	// invalid.
 	ErrInvalidJSAck JetStreamError = &jsError{message: "invalid jetstream publish response"}
@@ -259,6 +271,14 @@ var (
 	// closed iterator.
 	ErrMsgIteratorClosed JetStreamError = &jsError{message: "messages iterator closed"}
 
+	// ErrConnectionClosed is returned when JetStream operations fail due to
+	// underlying connection being closed.
+	ErrConnectionClosed JetStreamError = &jsError{message: "connection closed"}
+
+	// ErrServerShutdown is returned when pull request fails due to server
+	// shutdown.
+	ErrServerShutdown JetStreamError = &jsError{message: "server shutdown"}
+
 	// ErrOrderedConsumerReset is returned when resetting ordered consumer fails
 	// due to too many attempts.
 	ErrOrderedConsumerReset JetStreamError = &jsError{message: "recreating ordered consumer"}

vendor/github.com/nats-io/nats.go/jetstream/jetstream.go

@@ -19,6 +19,7 @@ import (
 	"errors"
 	"fmt"
 	"regexp"
+	"slices"
 	"strings"
 	"time"
 
@@ -210,6 +211,31 @@ type (
 
 		// ResumeConsumer resumes a paused consumer.
 		ResumeConsumer(ctx context.Context, stream string, consumer string) (*ConsumerPauseResponse, error)
+
+		// CreateOrUpdatePushConsumer creates a push consumer on a given stream with
+		// given config. If consumer already exists, it will be updated (if
+		// possible). Consumer interface is returned, allowing to consume messages.
+		CreateOrUpdatePushConsumer(ctx context.Context, stream string, cfg ConsumerConfig) (PushConsumer, error)
+
+		// CreatePushConsumer creates a push consumer on a given stream with given
+		// config. If consumer already exists and the provided configuration
+		// differs from its configuration, ErrConsumerExists is returned. If the
+		// provided configuration is the same as the existing consumer, the
+		// existing consumer is returned. Consumer interface is returned,
+		// allowing to consume messages.
+		CreatePushConsumer(ctx context.Context, stream string, cfg ConsumerConfig) (PushConsumer, error)
+
+		// UpdatePushConsumer updates an existing push consumer. If consumer does not
+		// exist, ErrConsumerDoesNotExist is returned. Consumer interface is
+		// returned, allowing to consume messages.
+		UpdatePushConsumer(ctx context.Context, stream string, cfg ConsumerConfig) (PushConsumer, error)
+
+		// PushConsumer returns an interface to an existing push consumer, allowing processing
+		// of messages. If consumer does not exist, ErrConsumerNotFound is
+		// returned.
+		//
+		// It returns ErrNotPushConsumer if the consumer is not a push consumer (deliver subject is not set).
+		PushConsumer(ctx context.Context, stream string, consumer string) (PushConsumer, error)
 	}
 
 	// StreamListOpt is a functional option for [StreamManager.ListStreams] and
@@ -315,6 +341,9 @@ type (
 		// a deadline set.
 		DefaultTimeout time.Duration
 
+		// ClientTrace enables request/response API calls tracing.
+		ClientTrace *ClientTrace
+
 		publisherOpts asyncPublisherOpts
 
 		// this is the actual prefix used in the API requests
@@ -322,7 +351,6 @@ type (
 		apiPrefix      string
 		replyPrefix    string
 		replyPrefixLen int
-		clientTrace    *ClientTrace
 	}
 
 	// ClientTrace can be used to trace API interactions for [JetStream].
@@ -528,7 +556,13 @@ func (js *jetStream) Conn() *nats.Conn {
 }
 
 func (js *jetStream) Options() JetStreamOptions {
-	return js.opts
+	opts := js.opts
+	// Return a copy of ClientTrace to prevent modification
+	if opts.ClientTrace != nil {
+		clientTraceCopy := *opts.ClientTrace
+		opts.ClientTrace = &clientTraceCopy
+	}
+	return opts
 }
 
 // CreateStream creates a new stream with given config and returns an
@@ -592,10 +626,18 @@ func (js *jetStream) CreateStream(ctx context.Context, cfg StreamConfig) (Stream
 		if len(cfg.Sources) != len(resp.Config.Sources) {
 			return nil, ErrStreamSourceNotSupported
 		}
-		for i := range cfg.Sources {
+
-			if len(cfg.Sources[i].SubjectTransforms) != 0 && len(resp.Sources[i].SubjectTransforms) == 0 {
+		// the sources list in the response is not ordered
-				return nil, ErrStreamSourceMultipleFilterSubjectsNotSupported
+		cfgNumTransforms := make([]int, len(cfg.Sources))
-			}
+		respNumTransforms := make([]int, len(resp.Config.Sources))
+		for i, cfgSource := range cfg.Sources {
+			cfgNumTransforms[i] = len(cfgSource.SubjectTransforms)
+			respNumTransforms[i] = len(resp.Config.Sources[i].SubjectTransforms)
+		}
+		slices.Sort(cfgNumTransforms)
+		slices.Sort(respNumTransforms)
+		if !slices.Equal(cfgNumTransforms, respNumTransforms) {
+			return nil, ErrStreamSubjectTransformNotSupported
 		}
 	}
 
@@ -672,10 +714,18 @@ func (js *jetStream) UpdateStream(ctx context.Context, cfg StreamConfig) (Stream
 		if len(cfg.Sources) != len(resp.Config.Sources) {
 			return nil, ErrStreamSourceNotSupported
 		}
-		for i := range cfg.Sources {
+
-			if len(cfg.Sources[i].SubjectTransforms) != 0 && len(resp.Sources[i].SubjectTransforms) == 0 {
+		// the sources list in the response is not ordered
-				return nil, ErrStreamSourceMultipleFilterSubjectsNotSupported
+		cfgNumTransforms := make([]int, len(cfg.Sources))
-			}
+		respNumTransforms := make([]int, len(resp.Config.Sources))
+		for i, cfgSource := range cfg.Sources {
+			cfgNumTransforms[i] = len(cfgSource.SubjectTransforms)
+			respNumTransforms[i] = len(resp.Config.Sources[i].SubjectTransforms)
+		}
+		slices.Sort(cfgNumTransforms)
+		slices.Sort(respNumTransforms)
+		if !slices.Equal(cfgNumTransforms, respNumTransforms) {
+			return nil, ErrStreamSubjectTransformNotSupported
 		}
 	}
 
@@ -762,7 +812,7 @@ func (js *jetStream) CreateOrUpdateConsumer(ctx context.Context, stream string,
 	if err := validateStreamName(stream); err != nil {
 		return nil, err
 	}
-	return upsertConsumer(ctx, js, stream, cfg, consumerActionCreateOrUpdate)
+	return upsertPullConsumer(ctx, js, stream, cfg, consumerActionCreateOrUpdate)
 }
 
 // CreateConsumer creates a consumer on a given stream with given
@@ -775,7 +825,7 @@ func (js *jetStream) CreateConsumer(ctx context.Context, stream string, cfg Cons
 	if err := validateStreamName(stream); err != nil {
 		return nil, err
 	}
-	return upsertConsumer(ctx, js, stream, cfg, consumerActionCreate)
+	return upsertPullConsumer(ctx, js, stream, cfg, consumerActionCreate)
 }
 
 // UpdateConsumer updates an existing consumer. If consumer does not
@@ -785,7 +835,7 @@ func (js *jetStream) UpdateConsumer(ctx context.Context, stream string, cfg Cons
 	if err := validateStreamName(stream); err != nil {
 		return nil, err
 	}
-	return upsertConsumer(ctx, js, stream, cfg, consumerActionUpdate)
+	return upsertPullConsumer(ctx, js, stream, cfg, consumerActionUpdate)
 }
 
 // OrderedConsumer returns an OrderedConsumer instance. OrderedConsumer
@@ -832,6 +882,49 @@ func (js *jetStream) DeleteConsumer(ctx context.Context, stream string, name str
 	return deleteConsumer(ctx, js, stream, name)
 }
 
+// CreateOrUpdatePushConsumer creates a push consumer on a given stream with
+// given config. If consumer already exists, it will be updated (if
+// possible). Consumer interface is returned, allowing to consume messages.
+func (js *jetStream) CreateOrUpdatePushConsumer(ctx context.Context, stream string, cfg ConsumerConfig) (PushConsumer, error) {
+	if err := validateStreamName(stream); err != nil {
+		return nil, err
+	}
+	return upsertPushConsumer(ctx, js, stream, cfg, consumerActionCreateOrUpdate)
+}
+
+// CreatePushConsumer creates a push consumer on a given stream with given
+// config. If consumer already exists and the provided configuration
+// differs from its configuration, ErrConsumerExists is returned. If the
+// provided configuration is the same as the existing consumer, the
+// existing consumer is returned. Consumer interface is returned,
+// allowing to consume messages.
+func (js *jetStream) CreatePushConsumer(ctx context.Context, stream string, cfg ConsumerConfig) (PushConsumer, error) {
+	if err := validateStreamName(stream); err != nil {
+		return nil, err
+	}
+	return upsertPushConsumer(ctx, js, stream, cfg, consumerActionCreate)
+}
+
+// UpdatePushConsumer updates an existing push consumer. If consumer does not
+// exist, ErrConsumerDoesNotExist is returned. Consumer interface is
+// returned, allowing to consume messages.
+func (js *jetStream) UpdatePushConsumer(ctx context.Context, stream string, cfg ConsumerConfig) (PushConsumer, error) {
+	if err := validateStreamName(stream); err != nil {
+		return nil, err
+	}
+	return upsertPushConsumer(ctx, js, stream, cfg, consumerActionUpdate)
+}
+
+// PushConsumer returns an interface to an existing consumer, allowing processing
+// of messages. If consumer does not exist, ErrConsumerNotFound is
+// returned.
+func (js *jetStream) PushConsumer(ctx context.Context, stream string, name string) (PushConsumer, error) {
+	if err := validateStreamName(stream); err != nil {
+		return nil, err
+	}
+	return getPushConsumer(ctx, js, stream, name)
+}
+
 func (js *jetStream) PauseConsumer(ctx context.Context, stream string, consumer string, pauseUntil time.Time) (*ConsumerPauseResponse, error) {
 	if err := validateStreamName(stream); err != nil {
 		return nil, err

vendor/github.com/nats-io/nats.go/jetstream/jetstream_options.go

@@ -31,7 +31,7 @@ func (fn pullOptFunc) configureMessages(opts *consumeOpts) error {
 // WithClientTrace enables request/response API calls tracing.
 func WithClientTrace(ct *ClientTrace) JetStreamOpt {
 	return func(opts *JetStreamOptions) error {
-		opts.clientTrace = ct
+		opts.ClientTrace = ct
 		return nil
 	}
 }
@@ -419,11 +419,16 @@ func (nMsgs StopAfter) configureMessages(opts *consumeOpts) error {
 // encountered while consuming messages It will be invoked for both terminal
 // (Consumer Deleted, invalid request body) and non-terminal (e.g. missing
 // heartbeats) errors.
-func ConsumeErrHandler(cb ConsumeErrHandlerFunc) PullConsumeOpt {
+type ConsumeErrHandler ConsumeErrHandlerFunc
-	return pullOptFunc(func(cfg *consumeOpts) error {
+
-		cfg.ErrHandler = cb
+func (c ConsumeErrHandler) configureConsume(opts *consumeOpts) error {
-		return nil
+	opts.ErrHandler = c
-	})
+	return nil
+}
+
+func (c ConsumeErrHandler) configurePushConsume(opts *pushConsumeOpts) error {
+	opts.ErrHandler = c
+	return nil
 }
 
 // WithMessagesErrOnMissingHeartbeat sets whether a missing heartbeat error

vendor/github.com/nats-io/nats.go/jetstream/kv.go

@@ -834,10 +834,10 @@ func (js *jetStream) legacyJetStream() (nats.JetStreamContext, error) {
 	if js.opts.apiPrefix != "" {
 		opts = append(opts, nats.APIPrefix(js.opts.apiPrefix))
 	}
-	if js.opts.clientTrace != nil {
+	if js.opts.ClientTrace != nil {
 		opts = append(opts, nats.ClientTrace{
-			RequestSent:      js.opts.clientTrace.RequestSent,
+			RequestSent:      js.opts.ClientTrace.RequestSent,
-			ResponseReceived: js.opts.clientTrace.ResponseReceived,
+			ResponseReceived: js.opts.ClientTrace.ResponseReceived,
 		})
 	}
 	return js.conn.JetStream(opts...)
@@ -1044,7 +1044,11 @@ func (kv *kvs) updateRevision(ctx context.Context, key string, value []byte, rev
 	if kv.useJSPfx {
 		b.WriteString(kv.js.opts.apiPrefix)
 	}
-	b.WriteString(kv.pre)
+	if kv.putPre != "" {
+		b.WriteString(kv.putPre)
+	} else {
+		b.WriteString(kv.pre)
+	}
 	b.WriteString(key)
 
 	m := nats.Msg{Subject: b.String(), Header: nats.Header{}, Data: value}
@@ -1231,11 +1235,9 @@ func (kv *kvs) WatchFiltered(ctx context.Context, keys []string, opts ...WatchOp
 		// Check if done and initial values.
 		if !w.initDone {
 			w.received++
-			// We set this on the first trip through..
+			// Use the stable initPending value set at consumer creation.
-			if w.initPending == 0 {
+			// We're done if we've received all expected messages OR there are no more pending.
-				w.initPending = delta
+			if w.received >= w.initPending || delta == 0 {
-			}
-			if w.received > w.initPending || delta == 0 {
 				w.initDone = true
 				w.updates <- nil
 			}
@@ -1281,9 +1283,13 @@ func (kv *kvs) WatchFiltered(ctx context.Context, keys []string, opts ...WatchOp
 	// Skip if UpdatesOnly() is set, since there will never be updates initially.
 	if !o.updatesOnly {
 		initialPending, err := sub.InitialConsumerPending()
-		if err == nil && initialPending == 0 {
+		if err == nil {
-			w.initDone = true
+			if initialPending == 0 {
-			w.updates <- nil
+				w.initDone = true
+				w.updates <- nil
+			} else {
+				w.initPending = initialPending
+			}
 		}
 	} else {
 		// if UpdatesOnly was used, mark initialization as complete

vendor/github.com/nats-io/nats.go/jetstream/message.go

@@ -141,13 +141,21 @@ type (
 )
 
 const (
-	controlMsg       = "100"
+	statusControlMsg    = "100"
-	badRequest       = "400"
+	statusBadRequest    = "400"
-	noMessages       = "404"
+	statusNoMsgs        = "404"
-	reqTimeout       = "408"
+	statusTimeout       = "408"
-	maxBytesExceeded = "409"
+	statusConflict      = "409"
-	noResponders     = "503"
+	statusNoResponders  = "503"
-	pinIdMismatch    = "423"
+	statusPinIdMismatch = "423"
+
+	fcRequestDescr     = "flowcontrol request"
+	idleHeartbeatDescr = "idle heartbeat"
+	consumerDeleted    = "consumer deleted"
+	leadershipChange   = "leadership change"
+	maxBytesExceeded   = "message size exceeds maxbytes"
+	batchCompleted     = "batch completed"
+	serverShutdown     = "server shutdown"
 )
 
 // Headers used when publishing messages.
@@ -411,32 +419,35 @@ func checkMsg(msg *nats.Msg) (bool, error) {
 	}
 
 	switch val {
-	case badRequest:
+	case statusBadRequest:
 		return false, ErrBadRequest
-	case noResponders:
+	case statusNoResponders:
 		return false, nats.ErrNoResponders
-	case noMessages:
+	case statusNoMsgs:
 		// 404 indicates that there are no messages.
 		return false, ErrNoMessages
-	case reqTimeout:
+	case statusTimeout:
 		return false, nats.ErrTimeout
-	case controlMsg:
+	case statusControlMsg:
 		return false, nil
-	case pinIdMismatch:
+	case statusPinIdMismatch:
 		return false, ErrPinIDMismatch
-	case maxBytesExceeded:
+	case statusConflict:
-		if strings.Contains(strings.ToLower(descr), "message size exceeds maxbytes") {
+		if strings.Contains(strings.ToLower(descr), maxBytesExceeded) {
 			return false, ErrMaxBytesExceeded
 		}
-		if strings.Contains(strings.ToLower(descr), "batch completed") {
+		if strings.Contains(strings.ToLower(descr), batchCompleted) {
 			return false, ErrBatchCompleted
 		}
-		if strings.Contains(strings.ToLower(descr), "consumer deleted") {
+		if strings.Contains(strings.ToLower(descr), consumerDeleted) {
 			return false, ErrConsumerDeleted
 		}
-		if strings.Contains(strings.ToLower(descr), "leadership change") {
+		if strings.Contains(strings.ToLower(descr), leadershipChange) {
 			return false, ErrConsumerLeadershipChanged
 		}
+		if strings.Contains(strings.ToLower(descr), serverShutdown) {
+			return false, ErrServerShutdown
+		}
 	}
 	return false, fmt.Errorf("nats: %s", msg.Header.Get("Description"))
 }

vendor/github.com/nats-io/nats.go/jetstream/ordered.go

@@ -39,7 +39,7 @@ type (
 		consumerType      consumerType
 		doReset           chan struct{}
 		resetInProgress   atomic.Uint32
-		userErrHandler    ConsumeErrHandlerFunc
+		userErrHandler    ConsumeErrHandler
 		stopAfter         int
 		stopAfterMsgsLeft chan int
 		withStopAfter     bool
@@ -80,6 +80,8 @@ var (
 //
 // See [Consumer.Consume] for more details.
 func (c *orderedConsumer) Consume(handler MessageHandler, opts ...PullConsumeOpt) (ConsumeContext, error) {
+	c.Lock()
+	defer c.Unlock()
 	if (c.consumerType == consumerTypeNotSet || c.consumerType == consumerTypeConsume) && c.currentConsumer == nil {
 		err := c.reset()
 		if err != nil {
@@ -201,10 +203,20 @@ func (c *orderedConsumer) Consume(handler MessageHandler, opts ...PullConsumeOpt
 func (c *orderedConsumer) errHandler(serial int) func(cc ConsumeContext, err error) {
 	return func(cc ConsumeContext, err error) {
 		c.Lock()
-		defer c.Unlock()
+
 		if c.userErrHandler != nil && !errors.Is(err, errOrderedSequenceMismatch) && !errors.Is(err, errConnected) {
 			c.userErrHandler(cc, err)
 		}
+		if errors.Is(err, ErrConnectionClosed) {
+			if c.subscription != nil {
+				c.Unlock()
+				c.subscription.Stop()
+				return
+			}
+			c.Unlock()
+			return
+		}
+
 		if errors.Is(err, ErrNoHeartbeat) ||
 			errors.Is(err, errOrderedSequenceMismatch) ||
 			errors.Is(err, ErrConsumerDeleted) ||
@@ -216,6 +228,7 @@ func (c *orderedConsumer) errHandler(serial int) func(cc ConsumeContext, err err
 				c.doReset <- struct{}{}
 			}
 		}
+		c.Unlock()
 	}
 }
 
@@ -359,29 +372,23 @@ func (s *orderedSubscription) Drain() {
 // fully stopped/drained. When the channel is closed, no more messages
 // will be received and processing is complete.
 func (s *orderedSubscription) Closed() <-chan struct{} {
-	s.consumer.Lock()
-	defer s.consumer.Unlock()
 	closedCh := make(chan struct{})
 
 	go func() {
-		for {
+		// First wait for s.done to be closed
-			s.consumer.Lock()
+		<-s.done
-			if s.consumer.currentSub == nil {
-				return
-			}
 
+		// Then ensure underlying consumer is also closed (it may still be draining)
+		s.consumer.Lock()
+		if s.consumer.currentSub != nil {
 			closed := s.consumer.currentSub.Closed()
 			s.consumer.Unlock()
-
-			// wait until the underlying pull consumer is closed
 			<-closed
-			// if the subscription is closed and ordered consumer is closed as well,
+		} else {
-			// send a signal that the Consume() is fully stopped
+			s.consumer.Unlock()
-			if s.closed.Load() == 1 {
-				close(closedCh)
-				return
-			}
 		}
+
+		close(closedCh)
 	}()
 	return closedCh
 }

vendor/github.com/nats-io/nats.go/jetstream/publish.go

@@ -478,7 +478,7 @@ func (js *jetStream) handleAsyncReply(m *nats.Msg) {
 	}
 
 	// Process no responders etc.
-	if len(m.Data) == 0 && m.Header.Get(statusHdr) == noResponders {
+	if len(m.Data) == 0 && m.Header.Get(statusHdr) == statusNoResponders {
 		if paf.retries < paf.maxRetries {
 			paf.retries++
 			time.AfterFunc(paf.retryWait, func() {

vendor/github.com/nats-io/nats.go/jetstream/pull.go

@@ -112,7 +112,7 @@ type (
 		MinAckPending           int64
 		Group                   string
 		Heartbeat               time.Duration
-		ErrHandler              ConsumeErrHandlerFunc
+		ErrHandler              ConsumeErrHandler
 		ReportMissingHeartbeats bool
 		ThresholdMessages       int
 		ThresholdBytes          int
@@ -222,7 +222,7 @@ func (p *pullConsumer) Consume(handler MessageHandler, opts ...PullConsumeOpt) (
 		fetchNext:   make(chan *pullRequest, 1),
 		consumeOpts: consumeOpts,
 	}
-	sub.connStatusChanged = p.js.conn.StatusChanged(nats.CONNECTED, nats.RECONNECTING)
+	sub.connStatusChanged = p.js.conn.StatusChanged(nats.CONNECTED, nats.RECONNECTING, nats.CLOSED)
 
 	sub.hbMonitor = sub.scheduleHeartbeatCheck(consumeOpts.Heartbeat)
 
@@ -332,13 +332,13 @@ func (p *pullConsumer) Consume(handler MessageHandler, opts ...PullConsumeOpt) (
 				if !ok {
 					continue
 				}
-				if status == nats.RECONNECTING {
+				switch status {
+				case nats.RECONNECTING:
 					if sub.hbMonitor != nil {
 						sub.hbMonitor.Stop()
 					}
 					isConnected = false
-				}
+				case nats.CONNECTED:
-				if status == nats.CONNECTED {
 					sub.Lock()
 					if !isConnected {
 						isConnected = true
@@ -362,6 +362,9 @@ func (p *pullConsumer) Consume(handler MessageHandler, opts ...PullConsumeOpt) (
 						sub.resetPendingMsgs()
 					}
 					sub.Unlock()
+
+				case nats.CLOSED:
+					sub.errs <- ErrConnectionClosed
 				}
 			case err := <-sub.errs:
 				sub.Lock()
@@ -389,6 +392,9 @@ func (p *pullConsumer) Consume(handler MessageHandler, opts ...PullConsumeOpt) (
 					sub.resetPendingMsgs()
 				}
 				sub.Unlock()
+				if errors.Is(err, ErrConnectionClosed) {
+					sub.Stop()
+				}
 			case <-sub.done:
 				return
 			}
@@ -569,6 +575,10 @@ func (s *pullSubscription) Next() (Msg, error) {
 	drainMode := s.draining.Load() == 1
 	closed := s.closed.Load() == 1
 	if closed && !drainMode {
+		// Check if iterator was closed due to connection closure
+		if s.consumer.js.conn.IsClosed() {
+			return nil, fmt.Errorf("%w: %w", ErrMsgIteratorClosed, ErrConnectionClosed)
+		}
 		return nil, ErrMsgIteratorClosed
 	}
 	hbMonitor := s.scheduleHeartbeatCheck(s.consumeOpts.Heartbeat)
@@ -592,6 +602,10 @@ func (s *pullSubscription) Next() (Msg, error) {
 				// if msgs channel is closed, it means that subscription was either drained or stopped
 				s.consumer.subs.Delete(s.id)
 				s.draining.CompareAndSwap(1, 0)
+				// Check if iterator was closed due to connection closure
+				if s.consumer.js.conn.IsClosed() {
+					return nil, fmt.Errorf("%w: %w", ErrMsgIteratorClosed, ErrConnectionClosed)
+				}
 				return nil, ErrMsgIteratorClosed
 			}
 			if hbMonitor != nil {
@@ -687,15 +701,15 @@ func (s *pullSubscription) handleStatusMsg(msg *nats.Msg, msgErr error) error {
 }
 
 func (hb *hbMonitor) Stop() {
-	hb.Mutex.Lock()
+	hb.Lock()
 	hb.timer.Stop()
-	hb.Mutex.Unlock()
+	hb.Unlock()
 }
 
 func (hb *hbMonitor) Reset(dur time.Duration) {
-	hb.Mutex.Lock()
+	hb.Lock()
 	hb.timer.Reset(dur)
-	hb.Mutex.Unlock()
+	hb.Unlock()
 }
 
 // Stop unsubscribes from the stream and cancels subscription. Calling
@@ -1109,7 +1123,7 @@ func (consumeOpts *consumeOpts) setDefaults(ordered bool) error {
 		}
 	}
 	if consumeOpts.Heartbeat > consumeOpts.Expires/2 {
-		return errors.New("the value of Heartbeat must be less than 50%% of expiry")
+		return fmt.Errorf("%w: the value of Heartbeat must be less than 50%% of expiry", ErrInvalidOption)
 	}
 	return nil
 }

vendor/github.com/nats-io/nats.go/jetstream/push.go

@@ -0,0 +1,264 @@
+package jetstream
+
+import (
+	"errors"
+	"strings"
+	"sync"
+	"sync/atomic"
+	"time"
+
+	"github.com/nats-io/nats.go"
+	"github.com/nats-io/nuid"
+)
+
+type (
+	pushConsumer struct {
+		sync.Mutex
+		js      *jetStream
+		stream  string
+		name    string
+		info    *ConsumerInfo
+		started atomic.Bool
+	}
+
+	pushSubscription struct {
+		sync.Mutex
+		id                string
+		errs              chan error
+		subscription      *nats.Subscription
+		connStatusChanged chan nats.Status
+		closedCh          chan struct{}
+		done              chan struct{}
+		closed            atomic.Bool
+		consumeOpts       *pushConsumeOpts
+		hbMonitor         *hbMonitor
+		idleHeartbeat     time.Duration
+	}
+
+	pushConsumeOpts struct {
+		ErrHandler ConsumeErrHandler
+	}
+
+	PushConsumeOpt interface {
+		configurePushConsume(*pushConsumeOpts) error
+	}
+)
+
+func (p *pushConsumer) Consume(handler MessageHandler, opts ...PushConsumeOpt) (ConsumeContext, error) {
+	if handler == nil {
+		return nil, ErrHandlerRequired
+	}
+	consumeOpts := &pushConsumeOpts{}
+	for _, opt := range opts {
+		if err := opt.configurePushConsume(consumeOpts); err != nil {
+			return nil, err
+		}
+	}
+
+	p.Lock()
+	defer p.Unlock()
+
+	if p.info == nil {
+		return nil, ErrConsumerNotFound
+	}
+
+	if p.started.Load() {
+		return nil, ErrConsumerAlreadyConsuming
+	}
+
+	consumeID := nuid.Next()
+	sub := &pushSubscription{
+		id:                consumeID,
+		errs:              make(chan error, 1),
+		done:              make(chan struct{}, 1),
+		consumeOpts:       consumeOpts,
+		connStatusChanged: p.js.conn.StatusChanged(nats.CONNECTED, nats.RECONNECTING),
+		idleHeartbeat:     p.info.Config.IdleHeartbeat,
+	}
+
+	sub.hbMonitor = sub.scheduleHeartbeatCheck(sub.idleHeartbeat)
+	internalHandler := func(msg *nats.Msg) {
+		if sub.hbMonitor != nil {
+			sub.hbMonitor.Stop()
+		}
+		defer func() {
+			if sub.hbMonitor != nil {
+				sub.hbMonitor.Reset(2 * sub.idleHeartbeat)
+			}
+		}()
+		status, descr := msg.Header.Get("Status"), msg.Header.Get("Description")
+		if status == "" {
+			jsMsg := p.js.toJSMsg(msg)
+			handler(jsMsg)
+			return
+		}
+		sub.Lock()
+		if err, terminate := sub.handleStatusMsg(msg, status, descr); err != nil {
+			if sub.consumeOpts.ErrHandler != nil {
+				sub.consumeOpts.ErrHandler(sub, err)
+			}
+			if terminate {
+				sub.Stop()
+			}
+		}
+		sub.Unlock()
+	}
+
+	var err error
+	sub.subscription, err = p.js.conn.Subscribe(p.info.Config.DeliverSubject, internalHandler)
+	if err != nil {
+		return nil, err
+	}
+
+	sub.subscription.SetClosedHandler(func(sid string) func(string) {
+		return func(subject string) {
+			p.started.Store(false)
+			sub.Lock()
+			defer sub.Unlock()
+			if sub.closedCh != nil {
+				close(sub.closedCh)
+				sub.closedCh = nil
+			}
+		}
+	}(sub.id))
+
+	go func() {
+		isConnected := true
+		for {
+			if sub.closed.Load() {
+				return
+			}
+			select {
+			case status, ok := <-sub.connStatusChanged:
+				if !ok {
+					continue
+				}
+				if status == nats.RECONNECTING {
+					if sub.hbMonitor != nil {
+						sub.hbMonitor.Stop()
+					}
+					isConnected = false
+				}
+				if status == nats.CONNECTED {
+					sub.Lock()
+					if !isConnected {
+						isConnected = true
+
+						if sub.hbMonitor != nil {
+							sub.hbMonitor.Reset(2 * sub.idleHeartbeat)
+						}
+					}
+					sub.Unlock()
+				}
+			case err := <-sub.errs:
+				sub.Lock()
+				if sub.consumeOpts.ErrHandler != nil {
+					sub.consumeOpts.ErrHandler(sub, err)
+				}
+				if errors.Is(err, ErrNoHeartbeat) {
+					if sub.hbMonitor != nil {
+						sub.hbMonitor.Reset(2 * sub.idleHeartbeat)
+					}
+				}
+				sub.Unlock()
+			case <-sub.done:
+				return
+			}
+		}
+	}()
+
+	p.started.Store(true)
+
+	return sub, nil
+
+}
+
+func (s *pushSubscription) handleStatusMsg(msg *nats.Msg, status, description string) (error, bool) {
+	switch status {
+	case statusControlMsg:
+		switch strings.ToLower(description) {
+		case idleHeartbeatDescr:
+			return nil, false
+		case fcRequestDescr:
+			if err := msg.Respond(nil); err != nil {
+				if s.consumeOpts.ErrHandler != nil {
+					s.consumeOpts.ErrHandler(s, err)
+				}
+			}
+			return nil, false
+		}
+	case statusConflict:
+		if description == consumerDeleted {
+			return ErrConsumerDeleted, true
+		}
+		if description == leadershipChange {
+			if s.consumeOpts.ErrHandler != nil {
+				s.consumeOpts.ErrHandler(s, ErrConsumerLeadershipChanged)
+				return ErrConsumerLeadershipChanged, false
+			}
+		}
+	}
+	return nil, false
+}
+
+// Stop unsubscribes from the stream and cancels subscription.
+// No more messages will be received after calling this method.
+// All messages that are already in the buffer are discarded.
+func (s *pushSubscription) Stop() {
+	if !s.closed.CompareAndSwap(false, true) {
+		return
+	}
+	s.Lock()
+	defer s.Unlock()
+	close(s.done)
+	s.subscription.Unsubscribe()
+	if s.hbMonitor != nil {
+		s.hbMonitor.Stop()
+	}
+}
+
+// Drain unsubscribes from the stream and cancels subscription.
+// All messages that are already in the buffer will be processed in callback function.
+func (s *pushSubscription) Drain() {
+	if !s.closed.CompareAndSwap(false, true) {
+		return
+	}
+	s.Lock()
+	defer s.Unlock()
+	close(s.done)
+	s.subscription.Drain()
+	if s.hbMonitor != nil {
+		s.hbMonitor.Stop()
+	}
+}
+
+// Closed returns a channel that is closed when consuming is
+// fully stopped/drained. When the channel is closed, no more messages
+// will be received and processing is complete.
+func (s *pushSubscription) Closed() <-chan struct{} {
+	s.Lock()
+	defer s.Unlock()
+	ch := s.closedCh
+	if ch == nil {
+		ch = make(chan struct{})
+		s.closedCh = ch
+	}
+	if !s.subscription.IsValid() {
+		close(s.closedCh)
+		s.closedCh = nil
+	}
+	return ch
+}
+
+func (s *pushSubscription) scheduleHeartbeatCheck(dur time.Duration) *hbMonitor {
+	if dur == 0 {
+		return nil
+	}
+	return &hbMonitor{
+		timer: time.AfterFunc(2*dur, func() {
+			s.Lock()
+			defer s.Unlock()
+			s.errs <- ErrNoHeartbeat
+		}),
+	}
+}

vendor/github.com/nats-io/nats.go/jetstream/stream.go

@@ -67,13 +67,13 @@ type (
 	// [Consumer] interface, allowing to operate on a consumer (e.g. consume
 	// messages).
 	ConsumerManager interface {
-		// CreateOrUpdateConsumer creates a consumer on a given stream with
+		// CreateOrUpdateConsumer creates a pull consumer on a given stream with
 		// given config. If consumer already exists, it will be updated (if
 		// possible). Consumer interface is returned, allowing to operate on a
 		// consumer (e.g. fetch messages).
 		CreateOrUpdateConsumer(ctx context.Context, cfg ConsumerConfig) (Consumer, error)
 
-		// CreateConsumer creates a consumer on a given stream with given
+		// CreateConsumer creates a pull consumer on a given stream with given
 		// config. If consumer already exists and the provided configuration
 		// differs from its configuration, ErrConsumerExists is returned. If the
 		// provided configuration is the same as the existing consumer, the
@@ -81,7 +81,7 @@ type (
 		// allowing to operate on a consumer (e.g. fetch messages).
 		CreateConsumer(ctx context.Context, cfg ConsumerConfig) (Consumer, error)
 
-		// UpdateConsumer updates an existing consumer. If consumer does not
+		// UpdateConsumer updates an existing pull consumer. If consumer does not
 		// exist, ErrConsumerDoesNotExist is returned. Consumer interface is
 		// returned, allowing to operate on a consumer (e.g. fetch messages).
 		UpdateConsumer(ctx context.Context, cfg ConsumerConfig) (Consumer, error)
@@ -95,6 +95,8 @@ type (
 		// Consumer returns an interface to an existing consumer, allowing processing
 		// of messages. If consumer does not exist, ErrConsumerNotFound is
 		// returned.
+		//
+		// It returns ErrNotPullConsumer if the consumer is not a pull consumer (deliver subject is not set).
 		Consumer(ctx context.Context, consumer string) (Consumer, error)
 
 		// DeleteConsumer removes a consumer with given name from a stream.
@@ -118,6 +120,31 @@ type (
 		// UnpinConsumer unpins the currently pinned client for a consumer for the given group name.
 		// If consumer does not exist, ErrConsumerNotFound is returned.
 		UnpinConsumer(ctx context.Context, consumer string, group string) error
+
+		// CreateOrUpdatePushConsumer creates a push consumer on a given stream with
+		// given config. If consumer already exists, it will be updated (if
+		// possible). Consumer interface is returned, allowing to consume messages.
+		CreateOrUpdatePushConsumer(ctx context.Context, cfg ConsumerConfig) (PushConsumer, error)
+
+		// CreatePushConsumer creates a push consumer on a given stream with given
+		// config. If consumer already exists and the provided configuration
+		// differs from its configuration, ErrConsumerExists is returned. If the
+		// provided configuration is the same as the existing consumer, the
+		// existing consumer is returned. Consumer interface is returned,
+		// allowing to consume messages.
+		CreatePushConsumer(ctx context.Context, cfg ConsumerConfig) (PushConsumer, error)
+
+		// UpdatePushConsumer updates an existing push consumer. If consumer does not
+		// exist, ErrConsumerDoesNotExist is returned. Consumer interface is
+		// returned, allowing to consume messages.
+		UpdatePushConsumer(ctx context.Context, cfg ConsumerConfig) (PushConsumer, error)
+
+		// PushConsumer returns an interface to an existing push consumer, allowing processing
+		// of messages. If consumer does not exist, ErrConsumerNotFound is
+		// returned.
+		//
+		// It returns ErrNotPushConsumer if the consumer is not a push consumer (deliver subject is not set).
+		PushConsumer(ctx context.Context, consumer string) (PushConsumer, error)
 	}
 
 	RawStreamMsg struct {
@@ -138,7 +165,7 @@ type (
 	StreamInfoOpt func(*streamInfoRequest) error
 
 	streamInfoRequest struct {
-		apiPaged
+		apiPagedRequest
 		DeletedDetails bool   `json:"deleted_details,omitempty"`
 		SubjectFilter  string `json:"subjects_filter,omitempty"`
 	}
@@ -273,7 +300,7 @@ type (
 // possible). Consumer interface is returned, allowing to operate on a
 // consumer (e.g. fetch messages).
 func (s *stream) CreateOrUpdateConsumer(ctx context.Context, cfg ConsumerConfig) (Consumer, error) {
-	return upsertConsumer(ctx, s.js, s.name, cfg, consumerActionCreateOrUpdate)
+	return upsertPullConsumer(ctx, s.js, s.name, cfg, consumerActionCreateOrUpdate)
 }
 
 // CreateConsumer creates a consumer on a given stream with given
@@ -283,14 +310,38 @@ func (s *stream) CreateOrUpdateConsumer(ctx context.Context, cfg ConsumerConfig)
 // existing consumer is returned. Consumer interface is returned,
 // allowing to operate on a consumer (e.g. fetch messages).
 func (s *stream) CreateConsumer(ctx context.Context, cfg ConsumerConfig) (Consumer, error) {
-	return upsertConsumer(ctx, s.js, s.name, cfg, consumerActionCreate)
+	return upsertPullConsumer(ctx, s.js, s.name, cfg, consumerActionCreate)
 }
 
 // UpdateConsumer updates an existing consumer. If consumer does not
 // exist, ErrConsumerDoesNotExist is returned. Consumer interface is
 // returned, allowing to operate on a consumer (e.g. fetch messages).
 func (s *stream) UpdateConsumer(ctx context.Context, cfg ConsumerConfig) (Consumer, error) {
-	return upsertConsumer(ctx, s.js, s.name, cfg, consumerActionUpdate)
+	return upsertPullConsumer(ctx, s.js, s.name, cfg, consumerActionUpdate)
+}
+
+// CreateOrUpdatePushConsumer creates a consumer on a given stream with
+// given config. If consumer already exists, it will be updated (if
+// possible). Consumer interface is returned, allowing to consume messages.
+func (s *stream) CreateOrUpdatePushConsumer(ctx context.Context, cfg ConsumerConfig) (PushConsumer, error) {
+	return upsertPushConsumer(ctx, s.js, s.name, cfg, consumerActionCreateOrUpdate)
+}
+
+// CreatePushConsumer creates a consumer on a given stream with given
+// config. If consumer already exists and the provided configuration
+// differs from its configuration, ErrConsumerExists is returned. If the
+// provided configuration is the same as the existing consumer, the
+// existing consumer is returned. Consumer interface is returned,
+// allowing to consume messages.
+func (s *stream) CreatePushConsumer(ctx context.Context, cfg ConsumerConfig) (PushConsumer, error) {
+	return upsertPushConsumer(ctx, s.js, s.name, cfg, consumerActionCreate)
+}
+
+// UpdatePushConsumer updates an existing consumer. If consumer does not
+// exist, ErrConsumerDoesNotExist is returned. Consumer interface is
+// returned, allowing to consume messages.
+func (s *stream) UpdatePushConsumer(ctx context.Context, cfg ConsumerConfig) (PushConsumer, error) {
+	return upsertPushConsumer(ctx, s.js, s.name, cfg, consumerActionUpdate)
 }
 
 // OrderedConsumer returns an OrderedConsumer instance. OrderedConsumer
@@ -322,6 +373,10 @@ func (s *stream) Consumer(ctx context.Context, name string) (Consumer, error) {
 	return getConsumer(ctx, s.js, s.name, name)
 }
 
+func (s *stream) PushConsumer(ctx context.Context, name string) (PushConsumer, error) {
+	return getPushConsumer(ctx, s.js, s.name, name)
+}
+
 // DeleteConsumer removes a consumer with given name from a stream.
 // If consumer does not exist, ErrConsumerNotFound is returned.
 func (s *stream) DeleteConsumer(ctx context.Context, name string) error {
@@ -532,7 +587,7 @@ func convertDirectGetMsgResponseToMsg(r *nats.Msg) (*RawStreamMsg, error) {
 		val := r.Header.Get(statusHdr)
 		if val != "" {
 			switch val {
-			case noMessages:
+			case statusNoMsgs:
 				return nil, ErrMsgNotFound
 			default:
 				desc := r.Header.Get("Description")

vendor/github.com/nats-io/nats.go/jsm.go

@@ -1778,6 +1778,11 @@ func getJSContextOpts(defs *jsOpts, opts ...JSOpt) (*jsOpts, context.CancelFunc,
 	if o.pre == _EMPTY_ {
 		o.pre = defs.pre
 	}
-
+	if o.ctx != nil {
+		// if context does not have a deadline, use timeout from js context
+		if _, hasDeadline := o.ctx.Deadline(); !hasDeadline {
+			o.ctx, cancel = context.WithTimeout(o.ctx, defs.wait)
+		}
+	}
 	return &o, cancel, nil
 }

vendor/github.com/nats-io/nats.go/kv.go

@@ -115,12 +115,22 @@ type KeyWatcher interface {
 	Updates() <-chan KeyValueEntry
 	// Stop will stop this watcher.
 	Stop() error
+	// Error returns a channel that will receive any error that occurs during
+	// watching. In particular, this will receive an error if the watcher times
+	// out while expecting more initial keys. The channel is closed when the
+	// watch operation completes or when Stop() is called.
+	Error() <-chan error
 }
 
 // KeyLister is used to retrieve a list of key value store keys
 type KeyLister interface {
 	Keys() <-chan string
 	Stop() error
+	// Error returns a channel that will receive any error that occurs during
+	// key listing. In particular, this will receive an error if the underlying
+	// watcher times out while expecting more keys. The channel is closed when
+	// the listing operation completes or when Stop() is called.
+	Error() <-chan error
 }
 
 type WatchOpt interface {
@@ -331,6 +341,7 @@ var (
 	ErrKeyDeleted             = errors.New("nats: key was deleted")
 	ErrHistoryToLarge         = errors.New("nats: history limited to a max of 64")
 	ErrNoKeysFound            = errors.New("nats: no keys found")
+	ErrKeyWatcherTimeout      = errors.New("nats: key watcher timed out waiting for initial keys")
 )
 
 var (
@@ -911,6 +922,10 @@ func (kl *keyLister) Stop() error {
 	return kl.watcher.Stop()
 }
 
+func (kl *keyLister) Error() <-chan error {
+	return kl.watcher.Error()
+}
+
 // History will return all values for the key.
 func (kv *kvs) History(key string, opts ...WatchOpt) ([]KeyValueEntry, error) {
 	opts = append(opts, IncludeHistory())
@@ -943,6 +958,7 @@ type watcher struct {
 	received      uint64
 	ctx           context.Context
 	initDoneTimer *time.Timer
+	errCh         chan error
 }
 
 // Context returns the context for the watcher if set.
@@ -969,6 +985,16 @@ func (w *watcher) Stop() error {
 	return w.sub.Unsubscribe()
 }
 
+// Error returns a channel that will receive any error that occurs during watching.
+func (w *watcher) Error() <-chan error {
+	if w == nil {
+		closedCh := make(chan error)
+		close(closedCh)
+		return closedCh
+	}
+	return w.errCh
+}
+
 // WatchAll watches all keys.
 func (kv *kvs) WatchAll(opts ...WatchOpt) (KeyWatcher, error) {
 	return kv.Watch(AllKeys, opts...)
@@ -1006,7 +1032,11 @@ func (kv *kvs) WatchFiltered(keys []string, opts ...WatchOpt) (KeyWatcher, error
 	}
 
 	// We will block below on placing items on the chan. That is by design.
-	w := &watcher{updates: make(chan KeyValueEntry, 256), ctx: o.ctx}
+	w := &watcher{
+		updates: make(chan KeyValueEntry, 256),
+		ctx:     o.ctx,
+		errCh:   make(chan error, 1),
+	}
 
 	update := func(m *Msg) {
 		tokens, err := parser.GetMetadataFields(m.Reply)
@@ -1046,11 +1076,9 @@ func (kv *kvs) WatchFiltered(keys []string, opts ...WatchOpt) (KeyWatcher, error
 		// Skip if UpdatesOnly() is set, since there will never be updates initially.
 		if !w.initDone {
 			w.received++
-			// We set this on the first trip through..
+			// Use the stable initPending value set at consumer creation.
-			if w.initPending == 0 {
+			// We're done if we've received all expected messages OR there are no more pending
-				w.initPending = delta
+			if w.received >= w.initPending || delta == 0 {
-			}
-			if w.received > w.initPending || delta == 0 {
 				// Avoid possible race setting up timer.
 				if w.initDoneTimer != nil {
 					w.initDoneTimer.Stop()
@@ -1098,19 +1126,26 @@ func (kv *kvs) WatchFiltered(keys []string, opts ...WatchOpt) (KeyWatcher, error
 	// of the consumer, send the marker.
 	// Skip if UpdatesOnly() is set, since there will never be updates initially.
 	if !o.updatesOnly {
-		if sub.jsi != nil && sub.jsi.pending == 0 {
+		if sub.jsi != nil {
-			w.initDone = true
+			if sub.jsi.pending == 0 {
-			w.updates <- nil
+				w.initDone = true
-		} else {
+				w.updates <- nil
-			// Set a timer to send the marker if we do not get any messages.
+			} else {
-			w.initDoneTimer = time.AfterFunc(kv.js.opts.wait, func() {
+				w.initPending = sub.jsi.pending
-				w.mu.Lock()
+				// Set a timer to send the marker if we do not get any messages.
-				defer w.mu.Unlock()
+				w.initDoneTimer = time.AfterFunc(kv.js.opts.wait, func() {
-				if !w.initDone {
+					w.mu.Lock()
-					w.initDone = true
+					defer w.mu.Unlock()
-					w.updates <- nil
+					if !w.initDone {
-				}
+						w.initDone = true
-			})
+						select {
+						case w.errCh <- ErrKeyWatcherTimeout:
+						default:
+						}
+						w.updates <- nil
+					}
+				})
+			}
 		}
 	} else {
 		// if UpdatesOnly was used, mark initialization as complete
@@ -1124,6 +1159,7 @@ func (kv *kvs) WatchFiltered(keys []string, opts ...WatchOpt) (KeyWatcher, error
 			w.initDoneTimer.Stop()
 		}
 		close(w.updates)
+		close(w.errCh)
 	}
 
 	sub.mu.Unlock()

vendor/github.com/nats-io/nats.go/nats.go

@@ -47,7 +47,7 @@ import (
 
 // Default Constants
 const (
-	Version                   = "1.43.0"
+	Version                   = "1.44.0"
 	DefaultURL                = "nats://127.0.0.1:4222"
 	DefaultPort               = 4222
 	DefaultMaxReconnect       = 60
@@ -1247,6 +1247,35 @@ func UserCredentials(userOrChainedFile string, seedFiles ...string) Option {
 	return UserJWT(userCB, sigCB)
 }
 
+// UserCredentialBytes is a convenience function that takes the JWT and seed
+// values as byte slices. This allows passing credentials directly from memory
+// or environment variables without needing to write them to disk.
+func UserCredentialBytes(userOrChainedFileBytes []byte, seedFiles ...[]byte) Option {
+	userCB := func() (string, error) {
+		return nkeys.ParseDecoratedJWT(userOrChainedFileBytes)
+	}
+
+	var seedBytes []byte
+	if len(seedFiles) > 0 {
+		seedBytes = seedFiles[0]
+	} else {
+		seedBytes = userOrChainedFileBytes
+	}
+
+	sigCB := func(nonce []byte) ([]byte, error) {
+		kp, err := nkeys.ParseDecoratedNKey(seedBytes)
+		if err != nil {
+			return nil, fmt.Errorf("unable to extract key pair from bytes: %w", err)
+		}
+		defer kp.Wipe()
+
+		sig, _ := kp.Sign(nonce)
+		return sig, nil
+	}
+
+	return UserJWT(userCB, sigCB)
+}
+
 // UserJWTAndSeed is a convenience function that takes the JWT and seed
 // values as strings.
 func UserJWTAndSeed(jwt string, seed string) Option {
@@ -5158,8 +5187,8 @@ func (s *Subscription) ClearMaxPending() error {
 
 // Pending Limits
 const (
-	// DefaultSubPendingMsgsLimit will be 512k msgs.
+	// DefaultSubPendingMsgsLimit will be 500k msgs.
-	DefaultSubPendingMsgsLimit = 512 * 1024
+	DefaultSubPendingMsgsLimit = 500_000
 	// DefaultSubPendingBytesLimit is 64MB
 	DefaultSubPendingBytesLimit = 64 * 1024 * 1024
 )
@@ -5509,6 +5538,14 @@ func (nc *Conn) close(status Status, doCBs bool, err error) {
 			close(s.mch)
 		}
 		s.mch = nil
+
+		// Call closed handler for non-AsyncSubscription types (AsyncSubscription handlers
+		// are called by waitForMsgs when it exits)
+		var done func(string)
+		if s.typ != AsyncSubscription && s.pDone != nil {
+			done = s.pDone
+		}
+
 		// Mark as invalid, for signaling to waitForMsgs
 		s.closed = true
 		// Mark connection closed in subscription
@@ -5519,6 +5556,11 @@ func (nc *Conn) close(status Status, doCBs bool, err error) {
 		}
 
 		s.mu.Unlock()
+
+		// Call the closed handler outside the lock to avoid potential deadlocks
+		if done != nil {
+			done(s.Subject)
+		}
 	}
 	nc.subs = nil
 	nc.subsMu.Unlock()
@@ -6107,18 +6149,12 @@ func sigHandler(nonce []byte, seedFile string) ([]byte, error) {
 type timeoutWriter struct {
 	timeout time.Duration
 	conn    net.Conn
-	err     error
 }
 
 // Write implements the io.Writer interface.
 func (tw *timeoutWriter) Write(p []byte) (int, error) {
-	if tw.err != nil {
-		return 0, tw.err
-	}
-
-	var n int
 	tw.conn.SetWriteDeadline(time.Now().Add(tw.timeout))
-	n, tw.err = tw.conn.Write(p)
+	n, err := tw.conn.Write(p)
 	tw.conn.SetWriteDeadline(time.Time{})
-	return n, tw.err
+	return n, err
 }

vendor/github.com/opencloud-eu/reva/v2/internal/grpc/interceptors/eventsmiddleware/conversion.go

@@ -19,6 +19,7 @@
 package eventsmiddleware
 
 import (
+	"strings"
 	"time"
 
 	group "github.com/cs3org/go-cs3apis/cs3/identity/group/v1beta1"
@@ -28,6 +29,7 @@ import (
 	link "github.com/cs3org/go-cs3apis/cs3/sharing/link/v1beta1"
 	provider "github.com/cs3org/go-cs3apis/cs3/storage/provider/v1beta1"
 	"github.com/opencloud-eu/reva/v2/pkg/events"
+	"github.com/opencloud-eu/reva/v2/pkg/rhttp/router"
 	"github.com/opencloud-eu/reva/v2/pkg/storagespace"
 	"github.com/opencloud-eu/reva/v2/pkg/utils"
 )
@@ -293,11 +295,45 @@ func ItemMoved(r *provider.MoveResponse, req *provider.MoveRequest, spaceOwner *
 	}
 }
 
+// TrashbinPurged converts the response to an event
+func TrashbinPurged(r *provider.PurgeRecycleResponse, req *provider.PurgeRecycleRequest, executant *user.User) events.TrashbinPurged {
+	return events.TrashbinPurged{
+		Executant: executant.GetId(),
+		Ref: &provider.Reference{
+			ResourceId: &provider.ResourceId{
+				StorageId: req.Ref.GetResourceId().GetStorageId(),
+				SpaceId:   req.Ref.GetResourceId().GetSpaceId(),
+				OpaqueId:  req.Ref.GetResourceId().GetSpaceId(),
+			},
+		},
+		Timestamp:         utils.TSNow(),
+		ImpersonatingUser: extractImpersonator(executant),
+	}
+}
+
 // ItemPurged converts the response to an event
 func ItemPurged(r *provider.PurgeRecycleResponse, req *provider.PurgeRecycleRequest, executant *user.User) events.ItemPurged {
+	root, relativePath := router.ShiftPath(req.Key)
+	if relativePath == "/" && !strings.HasSuffix(req.Key, "/") {
+		relativePath = ""
+	}
+	if root == "" {
+		// if there is no key this is about purging the whole trashbin
+		root = req.Ref.GetResourceId().GetSpaceId()
+	}
+
+	ref := &provider.Reference{
+		ResourceId: &provider.ResourceId{
+			StorageId: req.Ref.GetResourceId().GetStorageId(),
+			SpaceId:   req.Ref.GetResourceId().GetSpaceId(),
+			OpaqueId:  root,
+		},
+		Path: relativePath,
+	}
+
 	return events.ItemPurged{
 		Executant:         executant.GetId(),
-		Ref:               req.Ref,
+		Ref:               ref,
 		Timestamp:         utils.TSNow(),
 		ImpersonatingUser: extractImpersonator(executant),
 	}

vendor/github.com/opencloud-eu/reva/v2/internal/grpc/interceptors/eventsmiddleware/events.go

@@ -149,7 +149,13 @@ func NewUnary(m map[string]interface{}) (grpc.UnaryServerInterceptor, int, error
 			}
 		case *provider.PurgeRecycleResponse:
 			if isSuccess(v) {
-				ev = ItemPurged(v, req.(*provider.PurgeRecycleRequest), executant)
+				id := req.(*provider.PurgeRecycleRequest).GetRef().GetResourceId()
+				if id != nil && id.OpaqueId == id.SpaceId && req.(*provider.PurgeRecycleRequest).Key == "" {
+					// this is a purge of the whole trashbin, NOT the whole space
+					ev = TrashbinPurged(v, req.(*provider.PurgeRecycleRequest), executant)
+				} else {
+					ev = ItemPurged(v, req.(*provider.PurgeRecycleRequest), executant)
+				}
 			}
 		case *provider.RestoreRecycleItemResponse:
 			if isSuccess(v) {

vendor/github.com/opencloud-eu/reva/v2/pkg/events/files.go

@@ -162,6 +162,22 @@ func (ItemMoved) Unmarshal(v []byte) (interface{}, error) {
 	return e, err
 }
 
+// TrashbinPurged is emitted when the whole trashbin is purged
+type TrashbinPurged struct {
+	Executant         *user.UserId
+	Ref               *provider.Reference
+	Owner             *user.UserId
+	Timestamp         *types.Timestamp
+	ImpersonatingUser *user.User
+}
+
+// Unmarshal to fulfill umarshaller interface
+func (TrashbinPurged) Unmarshal(v []byte) (interface{}, error) {
+	e := TrashbinPurged{}
+	err := json.Unmarshal(v, &e)
+	return e, err
+}
+
 // ItemPurged is emitted when a file or folder is removed from trashbin
 type ItemPurged struct {
 	Executant         *user.UserId

vendor/go.etcd.io/etcd/api/v3/version/version.go

@@ -26,7 +26,7 @@ import (
 var (
 	// MinClusterVersion is the min cluster version this etcd binary is compatible with.
 	MinClusterVersion = "3.0.0"
-	Version           = "3.6.2"
+	Version           = "3.6.4"
 	APIVersion        = "unknown"
 
 	// Git SHA Value will be set during build

vendor/golang.org/x/sys/unix/mkerrors.sh

@@ -349,6 +349,9 @@ struct ltchars {
 #define _HIDIOCGRAWPHYS		HIDIOCGRAWPHYS(_HIDIOCGRAWPHYS_LEN)
 #define _HIDIOCGRAWUNIQ		HIDIOCGRAWUNIQ(_HIDIOCGRAWUNIQ_LEN)
 
+// Renamed in v6.16, commit c6d732c38f93 ("net: ethtool: remove duplicate defines for family info")
+#define ETHTOOL_FAMILY_NAME	ETHTOOL_GENL_NAME
+#define ETHTOOL_FAMILY_VERSION	ETHTOOL_GENL_VERSION
 '
 
 includes_NetBSD='

vendor/golang.org/x/sys/unix/syscall_darwin.go

@@ -602,14 +602,9 @@ func Connectx(fd int, srcIf uint32, srcAddr, dstAddr Sockaddr, associd SaeAssocI
 	return
 }
 
-// sys	connectx(fd int, endpoints *SaEndpoints, associd SaeAssocID, flags uint32, iov []Iovec, n *uintptr, connid *SaeConnID) (err error)
 const minIovec = 8
 
 func Readv(fd int, iovs [][]byte) (n int, err error) {
-	if !darwinKernelVersionMin(11, 0, 0) {
-		return 0, ENOSYS
-	}
-
 	iovecs := make([]Iovec, 0, minIovec)
 	iovecs = appendBytes(iovecs, iovs)
 	n, err = readv(fd, iovecs)
@@ -618,9 +613,6 @@ func Readv(fd int, iovs [][]byte) (n int, err error) {
 }
 
 func Preadv(fd int, iovs [][]byte, offset int64) (n int, err error) {
-	if !darwinKernelVersionMin(11, 0, 0) {
-		return 0, ENOSYS
-	}
 	iovecs := make([]Iovec, 0, minIovec)
 	iovecs = appendBytes(iovecs, iovs)
 	n, err = preadv(fd, iovecs, offset)
@@ -629,10 +621,6 @@ func Preadv(fd int, iovs [][]byte, offset int64) (n int, err error) {
 }
 
 func Writev(fd int, iovs [][]byte) (n int, err error) {
-	if !darwinKernelVersionMin(11, 0, 0) {
-		return 0, ENOSYS
-	}
-
 	iovecs := make([]Iovec, 0, minIovec)
 	iovecs = appendBytes(iovecs, iovs)
 	if raceenabled {
@@ -644,10 +632,6 @@ func Writev(fd int, iovs [][]byte) (n int, err error) {
 }
 
 func Pwritev(fd int, iovs [][]byte, offset int64) (n int, err error) {
-	if !darwinKernelVersionMin(11, 0, 0) {
-		return 0, ENOSYS
-	}
-
 	iovecs := make([]Iovec, 0, minIovec)
 	iovecs = appendBytes(iovecs, iovs)
 	if raceenabled {
@@ -707,45 +691,7 @@ func readvRacedetect(iovecs []Iovec, n int, err error) {
 	}
 }
 
-func darwinMajorMinPatch() (maj, min, patch int, err error) {
+//sys	connectx(fd int, endpoints *SaEndpoints, associd SaeAssocID, flags uint32, iov []Iovec, n *uintptr, connid *SaeConnID) (err error)
-	var un Utsname
-	err = Uname(&un)
-	if err != nil {
-		return
-	}
-
-	var mmp [3]int
-	c := 0
-Loop:
-	for _, b := range un.Release[:] {
-		switch {
-		case b >= '0' && b <= '9':
-			mmp[c] = 10*mmp[c] + int(b-'0')
-		case b == '.':
-			c++
-			if c > 2 {
-				return 0, 0, 0, ENOTSUP
-			}
-		case b == 0:
-			break Loop
-		default:
-			return 0, 0, 0, ENOTSUP
-		}
-	}
-	if c != 2 {
-		return 0, 0, 0, ENOTSUP
-	}
-	return mmp[0], mmp[1], mmp[2], nil
-}
-
-func darwinKernelVersionMin(maj, min, patch int) bool {
-	actualMaj, actualMin, actualPatch, err := darwinMajorMinPatch()
-	if err != nil {
-		return false
-	}
-	return actualMaj > maj || actualMaj == maj && (actualMin > min || actualMin == min && actualPatch >= patch)
-}
-
 //sys	sendfile(infd int, outfd int, offset int64, len *int64, hdtr unsafe.Pointer, flags int) (err error)
 
 //sys	shmat(id int, addr uintptr, flag int) (ret uintptr, err error)

vendor/golang.org/x/sys/unix/zerrors_linux.go

@@ -328,6 +328,8 @@ const (
 	AUDIT_KERNEL                                = 0x7d0
 	AUDIT_KERNEL_OTHER                          = 0x524
 	AUDIT_KERN_MODULE                           = 0x532
+	AUDIT_LANDLOCK_ACCESS                       = 0x58f
+	AUDIT_LANDLOCK_DOMAIN                       = 0x590
 	AUDIT_LAST_FEATURE                          = 0x1
 	AUDIT_LAST_KERN_ANOM_MSG                    = 0x707
 	AUDIT_LAST_USER_MSG                         = 0x4af
@@ -492,6 +494,7 @@ const (
 	BPF_F_BEFORE                                = 0x8
 	BPF_F_ID                                    = 0x20
 	BPF_F_NETFILTER_IP_DEFRAG                   = 0x1
+	BPF_F_PREORDER                              = 0x40
 	BPF_F_QUERY_EFFECTIVE                       = 0x1
 	BPF_F_REDIRECT_FLAGS                        = 0x19
 	BPF_F_REPLACE                               = 0x4
@@ -528,6 +531,7 @@ const (
 	BPF_LDX                                     = 0x1
 	BPF_LEN                                     = 0x80
 	BPF_LL_OFF                                  = -0x200000
+	BPF_LOAD_ACQ                                = 0x100
 	BPF_LSH                                     = 0x60
 	BPF_MAJOR_VERSION                           = 0x1
 	BPF_MAXINSNS                                = 0x1000
@@ -555,6 +559,7 @@ const (
 	BPF_RET                                     = 0x6
 	BPF_RSH                                     = 0x70
 	BPF_ST                                      = 0x2
+	BPF_STORE_REL                               = 0x110
 	BPF_STX                                     = 0x3
 	BPF_SUB                                     = 0x10
 	BPF_TAG_SIZE                                = 0x8
@@ -844,9 +849,9 @@ const (
 	DM_UUID_FLAG                                = 0x4000
 	DM_UUID_LEN                                 = 0x81
 	DM_VERSION                                  = 0xc138fd00
-	DM_VERSION_EXTRA                            = "-ioctl (2025-01-17)"
+	DM_VERSION_EXTRA                            = "-ioctl (2025-04-28)"
 	DM_VERSION_MAJOR                            = 0x4
-	DM_VERSION_MINOR                            = 0x31
+	DM_VERSION_MINOR                            = 0x32
 	DM_VERSION_PATCHLEVEL                       = 0x0
 	DT_BLK                                      = 0x6
 	DT_CHR                                      = 0x2
@@ -937,9 +942,6 @@ const (
 	EPOLL_CTL_MOD                               = 0x3
 	EPOLL_IOC_TYPE                              = 0x8a
 	EROFS_SUPER_MAGIC_V1                        = 0xe0f5e1e2
-	ESP_V4_FLOW                                 = 0xa
-	ESP_V6_FLOW                                 = 0xc
-	ETHER_FLOW                                  = 0x12
 	ETHTOOL_BUSINFO_LEN                         = 0x20
 	ETHTOOL_EROMVERS_LEN                        = 0x20
 	ETHTOOL_FAMILY_NAME                         = "ethtool"
@@ -1213,6 +1215,7 @@ const (
 	FAN_EVENT_INFO_TYPE_DFID_NAME               = 0x2
 	FAN_EVENT_INFO_TYPE_ERROR                   = 0x5
 	FAN_EVENT_INFO_TYPE_FID                     = 0x1
+	FAN_EVENT_INFO_TYPE_MNT                     = 0x7
 	FAN_EVENT_INFO_TYPE_NEW_DFID_NAME           = 0xc
 	FAN_EVENT_INFO_TYPE_OLD_DFID_NAME           = 0xa
 	FAN_EVENT_INFO_TYPE_PIDFD                   = 0x4
@@ -1231,9 +1234,12 @@ const (
 	FAN_MARK_IGNORED_SURV_MODIFY                = 0x40
 	FAN_MARK_IGNORE_SURV                        = 0x440
 	FAN_MARK_INODE                              = 0x0
+	FAN_MARK_MNTNS                              = 0x110
 	FAN_MARK_MOUNT                              = 0x10
 	FAN_MARK_ONLYDIR                            = 0x8
 	FAN_MARK_REMOVE                             = 0x2
+	FAN_MNT_ATTACH                              = 0x1000000
+	FAN_MNT_DETACH                              = 0x2000000
 	FAN_MODIFY                                  = 0x2
 	FAN_MOVE                                    = 0xc0
 	FAN_MOVED_FROM                              = 0x40
@@ -1255,6 +1261,7 @@ const (
 	FAN_REPORT_DIR_FID                          = 0x400
 	FAN_REPORT_FD_ERROR                         = 0x2000
 	FAN_REPORT_FID                              = 0x200
+	FAN_REPORT_MNT                              = 0x4000
 	FAN_REPORT_NAME                             = 0x800
 	FAN_REPORT_PIDFD                            = 0x80
 	FAN_REPORT_TARGET_FID                       = 0x1000
@@ -1274,6 +1281,7 @@ const (
 	FIB_RULE_PERMANENT                          = 0x1
 	FIB_RULE_UNRESOLVED                         = 0x4
 	FIDEDUPERANGE                               = 0xc0189436
+	FSCRYPT_ADD_KEY_FLAG_HW_WRAPPED             = 0x1
 	FSCRYPT_KEY_DESCRIPTOR_SIZE                 = 0x8
 	FSCRYPT_KEY_DESC_PREFIX                     = "fscrypt:"
 	FSCRYPT_KEY_DESC_PREFIX_SIZE                = 0x8
@@ -1582,7 +1590,6 @@ const (
 	IPV6_DONTFRAG                               = 0x3e
 	IPV6_DROP_MEMBERSHIP                        = 0x15
 	IPV6_DSTOPTS                                = 0x3b
-	IPV6_FLOW                                   = 0x11
 	IPV6_FREEBIND                               = 0x4e
 	IPV6_HDRINCL                                = 0x24
 	IPV6_HOPLIMIT                               = 0x34
@@ -1633,7 +1640,6 @@ const (
 	IPV6_TRANSPARENT                            = 0x4b
 	IPV6_UNICAST_HOPS                           = 0x10
 	IPV6_UNICAST_IF                             = 0x4c
-	IPV6_USER_FLOW                              = 0xe
 	IPV6_V6ONLY                                 = 0x1a
 	IPV6_VERSION                                = 0x60
 	IPV6_VERSION_MASK                           = 0xf0
@@ -1695,7 +1701,6 @@ const (
 	IP_TTL                                      = 0x2
 	IP_UNBLOCK_SOURCE                           = 0x25
 	IP_UNICAST_IF                               = 0x32
-	IP_USER_FLOW                                = 0xd
 	IP_XFRM_POLICY                              = 0x11
 	ISOFS_SUPER_MAGIC                           = 0x9660
 	ISTRIP                                      = 0x20
@@ -1817,7 +1822,11 @@ const (
 	LANDLOCK_ACCESS_FS_WRITE_FILE               = 0x2
 	LANDLOCK_ACCESS_NET_BIND_TCP                = 0x1
 	LANDLOCK_ACCESS_NET_CONNECT_TCP             = 0x2
+	LANDLOCK_CREATE_RULESET_ERRATA              = 0x2
 	LANDLOCK_CREATE_RULESET_VERSION             = 0x1
+	LANDLOCK_RESTRICT_SELF_LOG_NEW_EXEC_ON      = 0x2
+	LANDLOCK_RESTRICT_SELF_LOG_SAME_EXEC_OFF    = 0x1
+	LANDLOCK_RESTRICT_SELF_LOG_SUBDOMAINS_OFF   = 0x4
 	LANDLOCK_SCOPE_ABSTRACT_UNIX_SOCKET         = 0x1
 	LANDLOCK_SCOPE_SIGNAL                       = 0x2
 	LINUX_REBOOT_CMD_CAD_OFF                    = 0x0
@@ -2493,6 +2502,10 @@ const (
 	PR_FP_EXC_UND                               = 0x40000
 	PR_FP_MODE_FR                               = 0x1
 	PR_FP_MODE_FRE                              = 0x2
+	PR_FUTEX_HASH                               = 0x4e
+	PR_FUTEX_HASH_GET_IMMUTABLE                 = 0x3
+	PR_FUTEX_HASH_GET_SLOTS                     = 0x2
+	PR_FUTEX_HASH_SET_SLOTS                     = 0x1
 	PR_GET_AUXV                                 = 0x41555856
 	PR_GET_CHILD_SUBREAPER                      = 0x25
 	PR_GET_DUMPABLE                             = 0x3
@@ -2652,6 +2665,10 @@ const (
 	PR_TAGGED_ADDR_ENABLE                       = 0x1
 	PR_TASK_PERF_EVENTS_DISABLE                 = 0x1f
 	PR_TASK_PERF_EVENTS_ENABLE                  = 0x20
+	PR_TIMER_CREATE_RESTORE_IDS                 = 0x4d
+	PR_TIMER_CREATE_RESTORE_IDS_GET             = 0x2
+	PR_TIMER_CREATE_RESTORE_IDS_OFF             = 0x0
+	PR_TIMER_CREATE_RESTORE_IDS_ON              = 0x1
 	PR_TIMING_STATISTICAL                       = 0x0
 	PR_TIMING_TIMESTAMP                         = 0x1
 	PR_TSC_ENABLE                               = 0x1
@@ -2732,6 +2749,7 @@ const (
 	PTRACE_SETREGSET                            = 0x4205
 	PTRACE_SETSIGINFO                           = 0x4203
 	PTRACE_SETSIGMASK                           = 0x420b
+	PTRACE_SET_SYSCALL_INFO                     = 0x4212
 	PTRACE_SET_SYSCALL_USER_DISPATCH_CONFIG     = 0x4210
 	PTRACE_SINGLESTEP                           = 0x9
 	PTRACE_SYSCALL                              = 0x18
@@ -2982,6 +3000,7 @@ const (
 	RTPROT_NTK                                  = 0xf
 	RTPROT_OPENR                                = 0x63
 	RTPROT_OSPF                                 = 0xbc
+	RTPROT_OVN                                  = 0x54
 	RTPROT_RA                                   = 0x9
 	RTPROT_REDIRECT                             = 0x1
 	RTPROT_RIP                                  = 0xbd
@@ -3336,7 +3355,7 @@ const (
 	TASKSTATS_GENL_NAME                         = "TASKSTATS"
 	TASKSTATS_GENL_VERSION                      = 0x1
 	TASKSTATS_TYPE_MAX                          = 0x6
-	TASKSTATS_VERSION                           = 0xf
+	TASKSTATS_VERSION                           = 0x10
 	TCIFLUSH                                    = 0x0
 	TCIOFF                                      = 0x2
 	TCIOFLUSH                                   = 0x2
@@ -3406,8 +3425,6 @@ const (
 	TCP_TX_DELAY                                = 0x25
 	TCP_ULP                                     = 0x1f
 	TCP_USER_TIMEOUT                            = 0x12
-	TCP_V4_FLOW                                 = 0x1
-	TCP_V6_FLOW                                 = 0x5
 	TCP_WINDOW_CLAMP                            = 0xa
 	TCP_ZEROCOPY_RECEIVE                        = 0x23
 	TFD_TIMER_ABSTIME                           = 0x1
@@ -3530,8 +3547,6 @@ const (
 	UDP_NO_CHECK6_RX                            = 0x66
 	UDP_NO_CHECK6_TX                            = 0x65
 	UDP_SEGMENT                                 = 0x67
-	UDP_V4_FLOW                                 = 0x2
-	UDP_V6_FLOW                                 = 0x6
 	UMOUNT_NOFOLLOW                             = 0x8
 	USBDEVICE_SUPER_MAGIC                       = 0x9fa2
 	UTIME_NOW                                   = 0x3fffffff
@@ -3574,7 +3589,7 @@ const (
 	WDIOS_TEMPPANIC                             = 0x4
 	WDIOS_UNKNOWN                               = -0x1
 	WEXITED                                     = 0x4
-	WGALLOWEDIP_A_MAX                           = 0x3
+	WGALLOWEDIP_A_MAX                           = 0x4
 	WGDEVICE_A_MAX                              = 0x8
 	WGPEER_A_MAX                                = 0xa
 	WG_CMD_MAX                                  = 0x1
@@ -3688,6 +3703,7 @@ const (
 	XDP_SHARED_UMEM                             = 0x1
 	XDP_STATISTICS                              = 0x7
 	XDP_TXMD_FLAGS_CHECKSUM                     = 0x2
+	XDP_TXMD_FLAGS_LAUNCH_TIME                  = 0x4
 	XDP_TXMD_FLAGS_TIMESTAMP                    = 0x1
 	XDP_TX_METADATA                             = 0x2
 	XDP_TX_RING                                 = 0x3

vendor/golang.org/x/sys/unix/zerrors_linux_386.go

@@ -68,6 +68,7 @@ const (
 	CS8                              = 0x30
 	CSIZE                            = 0x30
 	CSTOPB                           = 0x40
+	DM_MPATH_PROBE_PATHS             = 0xfd12
 	ECCGETLAYOUT                     = 0x81484d11
 	ECCGETSTATS                      = 0x80104d12
 	ECHOCTL                          = 0x200
@@ -360,6 +361,7 @@ const (
 	SO_OOBINLINE                     = 0xa
 	SO_PASSCRED                      = 0x10
 	SO_PASSPIDFD                     = 0x4c
+	SO_PASSRIGHTS                    = 0x53
 	SO_PASSSEC                       = 0x22
 	SO_PEEK_OFF                      = 0x2a
 	SO_PEERCRED                      = 0x11

vendor/golang.org/x/sys/unix/zerrors_linux_amd64.go

@@ -68,6 +68,7 @@ const (
 	CS8                              = 0x30
 	CSIZE                            = 0x30
 	CSTOPB                           = 0x40
+	DM_MPATH_PROBE_PATHS             = 0xfd12
 	ECCGETLAYOUT                     = 0x81484d11
 	ECCGETSTATS                      = 0x80104d12
 	ECHOCTL                          = 0x200
@@ -361,6 +362,7 @@ const (
 	SO_OOBINLINE                     = 0xa
 	SO_PASSCRED                      = 0x10
 	SO_PASSPIDFD                     = 0x4c
+	SO_PASSRIGHTS                    = 0x53
 	SO_PASSSEC                       = 0x22
 	SO_PEEK_OFF                      = 0x2a
 	SO_PEERCRED                      = 0x11

vendor/golang.org/x/sys/unix/zerrors_linux_arm.go

@@ -68,6 +68,7 @@ const (
 	CS8                              = 0x30
 	CSIZE                            = 0x30
 	CSTOPB                           = 0x40
+	DM_MPATH_PROBE_PATHS             = 0xfd12
 	ECCGETLAYOUT                     = 0x81484d11
 	ECCGETSTATS                      = 0x80104d12
 	ECHOCTL                          = 0x200
@@ -366,6 +367,7 @@ const (
 	SO_OOBINLINE                     = 0xa
 	SO_PASSCRED                      = 0x10
 	SO_PASSPIDFD                     = 0x4c
+	SO_PASSRIGHTS                    = 0x53
 	SO_PASSSEC                       = 0x22
 	SO_PEEK_OFF                      = 0x2a
 	SO_PEERCRED                      = 0x11

vendor/golang.org/x/sys/unix/zerrors_linux_arm64.go

@@ -68,6 +68,7 @@ const (
 	CS8                              = 0x30
 	CSIZE                            = 0x30
 	CSTOPB                           = 0x40
+	DM_MPATH_PROBE_PATHS             = 0xfd12
 	ECCGETLAYOUT                     = 0x81484d11
 	ECCGETSTATS                      = 0x80104d12
 	ECHOCTL                          = 0x200
@@ -359,6 +360,7 @@ const (
 	SO_OOBINLINE                     = 0xa
 	SO_PASSCRED                      = 0x10
 	SO_PASSPIDFD                     = 0x4c
+	SO_PASSRIGHTS                    = 0x53
 	SO_PASSSEC                       = 0x22
 	SO_PEEK_OFF                      = 0x2a
 	SO_PEERCRED                      = 0x11

vendor/golang.org/x/sys/unix/zerrors_linux_loong64.go

@@ -68,6 +68,7 @@ const (
 	CS8                              = 0x30
 	CSIZE                            = 0x30
 	CSTOPB                           = 0x40
+	DM_MPATH_PROBE_PATHS             = 0xfd12
 	ECCGETLAYOUT                     = 0x81484d11
 	ECCGETSTATS                      = 0x80104d12
 	ECHOCTL                          = 0x200
@@ -353,6 +354,7 @@ const (
 	SO_OOBINLINE                     = 0xa
 	SO_PASSCRED                      = 0x10
 	SO_PASSPIDFD                     = 0x4c
+	SO_PASSRIGHTS                    = 0x53
 	SO_PASSSEC                       = 0x22
 	SO_PEEK_OFF                      = 0x2a
 	SO_PEERCRED                      = 0x11

vendor/golang.org/x/sys/unix/zerrors_linux_mips.go

@@ -68,6 +68,7 @@ const (
 	CS8                              = 0x30
 	CSIZE                            = 0x30
 	CSTOPB                           = 0x40
+	DM_MPATH_PROBE_PATHS             = 0x2000fd12
 	ECCGETLAYOUT                     = 0x41484d11
 	ECCGETSTATS                      = 0x40104d12
 	ECHOCTL                          = 0x200
@@ -359,6 +360,7 @@ const (
 	SO_OOBINLINE                     = 0x100
 	SO_PASSCRED                      = 0x11
 	SO_PASSPIDFD                     = 0x4c
+	SO_PASSRIGHTS                    = 0x53
 	SO_PASSSEC                       = 0x22
 	SO_PEEK_OFF                      = 0x2a
 	SO_PEERCRED                      = 0x12

vendor/golang.org/x/sys/unix/zerrors_linux_mips64.go

@@ -68,6 +68,7 @@ const (
 	CS8                              = 0x30
 	CSIZE                            = 0x30
 	CSTOPB                           = 0x40
+	DM_MPATH_PROBE_PATHS             = 0x2000fd12
 	ECCGETLAYOUT                     = 0x41484d11
 	ECCGETSTATS                      = 0x40104d12
 	ECHOCTL                          = 0x200
@@ -359,6 +360,7 @@ const (
 	SO_OOBINLINE                     = 0x100
 	SO_PASSCRED                      = 0x11
 	SO_PASSPIDFD                     = 0x4c
+	SO_PASSRIGHTS                    = 0x53
 	SO_PASSSEC                       = 0x22
 	SO_PEEK_OFF                      = 0x2a
 	SO_PEERCRED                      = 0x12

vendor/golang.org/x/sys/unix/zerrors_linux_mips64le.go

@@ -68,6 +68,7 @@ const (
 	CS8                              = 0x30
 	CSIZE                            = 0x30
 	CSTOPB                           = 0x40
+	DM_MPATH_PROBE_PATHS             = 0x2000fd12
 	ECCGETLAYOUT                     = 0x41484d11
 	ECCGETSTATS                      = 0x40104d12
 	ECHOCTL                          = 0x200
@@ -359,6 +360,7 @@ const (
 	SO_OOBINLINE                     = 0x100
 	SO_PASSCRED                      = 0x11
 	SO_PASSPIDFD                     = 0x4c
+	SO_PASSRIGHTS                    = 0x53
 	SO_PASSSEC                       = 0x22
 	SO_PEEK_OFF                      = 0x2a
 	SO_PEERCRED                      = 0x12

vendor/golang.org/x/sys/unix/zerrors_linux_mipsle.go

@@ -68,6 +68,7 @@ const (
 	CS8                              = 0x30
 	CSIZE                            = 0x30
 	CSTOPB                           = 0x40
+	DM_MPATH_PROBE_PATHS             = 0x2000fd12
 	ECCGETLAYOUT                     = 0x41484d11
 	ECCGETSTATS                      = 0x40104d12
 	ECHOCTL                          = 0x200
@@ -359,6 +360,7 @@ const (
 	SO_OOBINLINE                     = 0x100
 	SO_PASSCRED                      = 0x11
 	SO_PASSPIDFD                     = 0x4c
+	SO_PASSRIGHTS                    = 0x53
 	SO_PASSSEC                       = 0x22
 	SO_PEEK_OFF                      = 0x2a
 	SO_PEERCRED                      = 0x12

vendor/golang.org/x/sys/unix/zerrors_linux_ppc.go

@@ -68,6 +68,7 @@ const (
 	CS8                              = 0x300
 	CSIZE                            = 0x300
 	CSTOPB                           = 0x400
+	DM_MPATH_PROBE_PATHS             = 0x2000fd12
 	ECCGETLAYOUT                     = 0x41484d11
 	ECCGETSTATS                      = 0x40104d12
 	ECHOCTL                          = 0x40
@@ -414,6 +415,7 @@ const (
 	SO_OOBINLINE                     = 0xa
 	SO_PASSCRED                      = 0x14
 	SO_PASSPIDFD                     = 0x4c
+	SO_PASSRIGHTS                    = 0x53
 	SO_PASSSEC                       = 0x22
 	SO_PEEK_OFF                      = 0x2a
 	SO_PEERCRED                      = 0x15

vendor/golang.org/x/sys/unix/zerrors_linux_ppc64.go

@@ -68,6 +68,7 @@ const (
 	CS8                              = 0x300
 	CSIZE                            = 0x300
 	CSTOPB                           = 0x400
+	DM_MPATH_PROBE_PATHS             = 0x2000fd12
 	ECCGETLAYOUT                     = 0x41484d11
 	ECCGETSTATS                      = 0x40104d12
 	ECHOCTL                          = 0x40
@@ -418,6 +419,7 @@ const (
 	SO_OOBINLINE                     = 0xa
 	SO_PASSCRED                      = 0x14
 	SO_PASSPIDFD                     = 0x4c
+	SO_PASSRIGHTS                    = 0x53
 	SO_PASSSEC                       = 0x22
 	SO_PEEK_OFF                      = 0x2a
 	SO_PEERCRED                      = 0x15

vendor/golang.org/x/sys/unix/zerrors_linux_ppc64le.go

@@ -68,6 +68,7 @@ const (
 	CS8                              = 0x300
 	CSIZE                            = 0x300
 	CSTOPB                           = 0x400
+	DM_MPATH_PROBE_PATHS             = 0x2000fd12
 	ECCGETLAYOUT                     = 0x41484d11
 	ECCGETSTATS                      = 0x40104d12
 	ECHOCTL                          = 0x40
@@ -418,6 +419,7 @@ const (
 	SO_OOBINLINE                     = 0xa
 	SO_PASSCRED                      = 0x14
 	SO_PASSPIDFD                     = 0x4c
+	SO_PASSRIGHTS                    = 0x53
 	SO_PASSSEC                       = 0x22
 	SO_PEEK_OFF                      = 0x2a
 	SO_PEERCRED                      = 0x15

vendor/golang.org/x/sys/unix/zerrors_linux_riscv64.go

@@ -68,6 +68,7 @@ const (
 	CS8                              = 0x30
 	CSIZE                            = 0x30
 	CSTOPB                           = 0x40
+	DM_MPATH_PROBE_PATHS             = 0xfd12
 	ECCGETLAYOUT                     = 0x81484d11
 	ECCGETSTATS                      = 0x80104d12
 	ECHOCTL                          = 0x200
@@ -350,6 +351,7 @@ const (
 	SO_OOBINLINE                     = 0xa
 	SO_PASSCRED                      = 0x10
 	SO_PASSPIDFD                     = 0x4c
+	SO_PASSRIGHTS                    = 0x53
 	SO_PASSSEC                       = 0x22
 	SO_PEEK_OFF                      = 0x2a
 	SO_PEERCRED                      = 0x11

vendor/golang.org/x/sys/unix/zerrors_linux_s390x.go

@@ -68,6 +68,7 @@ const (
 	CS8                              = 0x30
 	CSIZE                            = 0x30
 	CSTOPB                           = 0x40
+	DM_MPATH_PROBE_PATHS             = 0xfd12
 	ECCGETLAYOUT                     = 0x81484d11
 	ECCGETSTATS                      = 0x80104d12
 	ECHOCTL                          = 0x200
@@ -422,6 +423,7 @@ const (
 	SO_OOBINLINE                     = 0xa
 	SO_PASSCRED                      = 0x10
 	SO_PASSPIDFD                     = 0x4c
+	SO_PASSRIGHTS                    = 0x53
 	SO_PASSSEC                       = 0x22
 	SO_PEEK_OFF                      = 0x2a
 	SO_PEERCRED                      = 0x11

vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go

@@ -71,6 +71,7 @@ const (
 	CS8                              = 0x30
 	CSIZE                            = 0x30
 	CSTOPB                           = 0x40
+	DM_MPATH_PROBE_PATHS             = 0x2000fd12
 	ECCGETLAYOUT                     = 0x41484d11
 	ECCGETSTATS                      = 0x40104d12
 	ECHOCTL                          = 0x200
@@ -461,6 +462,7 @@ const (
 	SO_OOBINLINE                     = 0x100
 	SO_PASSCRED                      = 0x2
 	SO_PASSPIDFD                     = 0x55
+	SO_PASSRIGHTS                    = 0x5c
 	SO_PASSSEC                       = 0x1f
 	SO_PEEK_OFF                      = 0x26
 	SO_PEERCRED                      = 0x40

vendor/golang.org/x/sys/unix/zsysnum_linux_386.go

@@ -462,4 +462,5 @@ const (
 	SYS_GETXATTRAT                   = 464
 	SYS_LISTXATTRAT                  = 465
 	SYS_REMOVEXATTRAT                = 466
+	SYS_OPEN_TREE_ATTR               = 467
 )

vendor/golang.org/x/sys/unix/zsysnum_linux_amd64.go

@@ -385,4 +385,5 @@ const (
 	SYS_GETXATTRAT              = 464
 	SYS_LISTXATTRAT             = 465
 	SYS_REMOVEXATTRAT           = 466
+	SYS_OPEN_TREE_ATTR          = 467
 )

vendor/golang.org/x/sys/unix/zsysnum_linux_arm.go

@@ -426,4 +426,5 @@ const (
 	SYS_GETXATTRAT                   = 464
 	SYS_LISTXATTRAT                  = 465
 	SYS_REMOVEXATTRAT                = 466
+	SYS_OPEN_TREE_ATTR               = 467
 )

vendor/golang.org/x/sys/unix/zsysnum_linux_arm64.go

@@ -329,4 +329,5 @@ const (
 	SYS_GETXATTRAT              = 464
 	SYS_LISTXATTRAT             = 465
 	SYS_REMOVEXATTRAT           = 466
+	SYS_OPEN_TREE_ATTR          = 467
 )

vendor/golang.org/x/sys/unix/zsysnum_linux_loong64.go

@@ -325,4 +325,5 @@ const (
 	SYS_GETXATTRAT              = 464
 	SYS_LISTXATTRAT             = 465
 	SYS_REMOVEXATTRAT           = 466
+	SYS_OPEN_TREE_ATTR          = 467
 )

vendor/golang.org/x/sys/unix/zsysnum_linux_mips.go

@@ -446,4 +446,5 @@ const (
 	SYS_GETXATTRAT                   = 4464
 	SYS_LISTXATTRAT                  = 4465
 	SYS_REMOVEXATTRAT                = 4466
+	SYS_OPEN_TREE_ATTR               = 4467
 )

vendor/golang.org/x/sys/unix/zsysnum_linux_mips64.go

@@ -376,4 +376,5 @@ const (
 	SYS_GETXATTRAT              = 5464
 	SYS_LISTXATTRAT             = 5465
 	SYS_REMOVEXATTRAT           = 5466
+	SYS_OPEN_TREE_ATTR          = 5467
 )

vendor/golang.org/x/sys/unix/zsysnum_linux_mips64le.go

@@ -376,4 +376,5 @@ const (
 	SYS_GETXATTRAT              = 5464
 	SYS_LISTXATTRAT             = 5465
 	SYS_REMOVEXATTRAT           = 5466
+	SYS_OPEN_TREE_ATTR          = 5467
 )

vendor/golang.org/x/sys/unix/zsysnum_linux_mipsle.go

@@ -446,4 +446,5 @@ const (
 	SYS_GETXATTRAT                   = 4464
 	SYS_LISTXATTRAT                  = 4465
 	SYS_REMOVEXATTRAT                = 4466
+	SYS_OPEN_TREE_ATTR               = 4467
 )

vendor/golang.org/x/sys/unix/zsysnum_linux_ppc.go

@@ -453,4 +453,5 @@ const (
 	SYS_GETXATTRAT                   = 464
 	SYS_LISTXATTRAT                  = 465
 	SYS_REMOVEXATTRAT                = 466
+	SYS_OPEN_TREE_ATTR               = 467
 )

vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64.go

@@ -425,4 +425,5 @@ const (
 	SYS_GETXATTRAT              = 464
 	SYS_LISTXATTRAT             = 465
 	SYS_REMOVEXATTRAT           = 466
+	SYS_OPEN_TREE_ATTR          = 467
 )

vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64le.go

@@ -425,4 +425,5 @@ const (
 	SYS_GETXATTRAT              = 464
 	SYS_LISTXATTRAT             = 465
 	SYS_REMOVEXATTRAT           = 466
+	SYS_OPEN_TREE_ATTR          = 467
 )

vendor/golang.org/x/sys/unix/zsysnum_linux_riscv64.go

@@ -330,4 +330,5 @@ const (
 	SYS_GETXATTRAT              = 464
 	SYS_LISTXATTRAT             = 465
 	SYS_REMOVEXATTRAT           = 466
+	SYS_OPEN_TREE_ATTR          = 467
 )

vendor/golang.org/x/sys/unix/zsysnum_linux_s390x.go

@@ -391,4 +391,5 @@ const (
 	SYS_GETXATTRAT              = 464
 	SYS_LISTXATTRAT             = 465
 	SYS_REMOVEXATTRAT           = 466
+	SYS_OPEN_TREE_ATTR          = 467
 )

vendor/golang.org/x/sys/unix/zsysnum_linux_sparc64.go

@@ -404,4 +404,5 @@ const (
 	SYS_GETXATTRAT              = 464
 	SYS_LISTXATTRAT             = 465
 	SYS_REMOVEXATTRAT           = 466
+	SYS_OPEN_TREE_ATTR          = 467
 )

vendor/golang.org/x/sys/unix/ztypes_linux.go

@@ -115,7 +115,9 @@ type Statx_t struct {
 	Atomic_write_unit_max     uint32
 	Atomic_write_segments_max uint32
 	Dio_read_offset_align     uint32
-	_                         [9]uint64
+	Atomic_write_unit_max_opt uint32
+	_                         [1]uint32
+	_                         [8]uint64
 }
 
 type Fsid struct {
@@ -199,7 +201,8 @@ type FscryptAddKeyArg struct {
 	Key_spec FscryptKeySpecifier
 	Raw_size uint32
 	Key_id   uint32
-	_        [8]uint32
+	Flags    uint32
+	_        [7]uint32
 }
 
 type FscryptRemoveKeyArg struct {
@@ -2317,6 +2320,11 @@ const (
 	NFT_CT_AVGPKT                     = 0x10
 	NFT_CT_ZONE                       = 0x11
 	NFT_CT_EVENTMASK                  = 0x12
+	NFT_CT_SRC_IP                     = 0x13
+	NFT_CT_DST_IP                     = 0x14
+	NFT_CT_SRC_IP6                    = 0x15
+	NFT_CT_DST_IP6                    = 0x16
+	NFT_CT_ID                         = 0x17
 	NFTA_CT_UNSPEC                    = 0x0
 	NFTA_CT_DREG                      = 0x1
 	NFTA_CT_KEY                       = 0x2
@@ -2597,8 +2605,8 @@ const (
 	SOF_TIMESTAMPING_BIND_PHC     = 0x8000
 	SOF_TIMESTAMPING_OPT_ID_TCP   = 0x10000
 
-	SOF_TIMESTAMPING_LAST = 0x20000
+	SOF_TIMESTAMPING_LAST = 0x40000
-	SOF_TIMESTAMPING_MASK = 0x3ffff
+	SOF_TIMESTAMPING_MASK = 0x7ffff
 
 	SCM_TSTAMP_SND   = 0x0
 	SCM_TSTAMP_SCHED = 0x1
@@ -4044,7 +4052,7 @@ const (
 	ETHTOOL_A_TSINFO_PHC_INDEX                = 0x5
 	ETHTOOL_A_TSINFO_STATS                    = 0x6
 	ETHTOOL_A_TSINFO_HWTSTAMP_PROVIDER        = 0x7
-	ETHTOOL_A_TSINFO_MAX                      = 0x7
+	ETHTOOL_A_TSINFO_MAX                      = 0x9
 	ETHTOOL_A_CABLE_TEST_UNSPEC               = 0x0
 	ETHTOOL_A_CABLE_TEST_HEADER               = 0x1
 	ETHTOOL_A_CABLE_TEST_MAX                  = 0x1
@@ -4130,6 +4138,19 @@ const (
 	ETHTOOL_A_TUNNEL_INFO_MAX                 = 0x2
 )
 
+const (
+	TCP_V4_FLOW    = 0x1
+	UDP_V4_FLOW    = 0x2
+	TCP_V6_FLOW    = 0x5
+	UDP_V6_FLOW    = 0x6
+	ESP_V4_FLOW    = 0xa
+	ESP_V6_FLOW    = 0xc
+	IP_USER_FLOW   = 0xd
+	IPV6_USER_FLOW = 0xe
+	IPV6_FLOW      = 0x11
+	ETHER_FLOW     = 0x12
+)
+
 const SPEED_UNKNOWN = -0x1
 
 type EthtoolDrvinfo struct {
@@ -4780,7 +4801,7 @@ const (
 	NL80211_ATTR_MAC_HINT                                   = 0xc8
 	NL80211_ATTR_MAC_MASK                                   = 0xd7
 	NL80211_ATTR_MAX_AP_ASSOC_STA                           = 0xca
-	NL80211_ATTR_MAX                                        = 0x150
+	NL80211_ATTR_MAX                                        = 0x151
 	NL80211_ATTR_MAX_CRIT_PROT_DURATION                     = 0xb4
 	NL80211_ATTR_MAX_CSA_COUNTERS                           = 0xce
 	NL80211_ATTR_MAX_HW_TIMESTAMP_PEERS                     = 0x143
@@ -5414,7 +5435,7 @@ const (
 	NL80211_FREQUENCY_ATTR_GO_CONCURRENT                    = 0xf
 	NL80211_FREQUENCY_ATTR_INDOOR_ONLY                      = 0xe
 	NL80211_FREQUENCY_ATTR_IR_CONCURRENT                    = 0xf
-	NL80211_FREQUENCY_ATTR_MAX                              = 0x21
+	NL80211_FREQUENCY_ATTR_MAX                              = 0x22
 	NL80211_FREQUENCY_ATTR_MAX_TX_POWER                     = 0x6
 	NL80211_FREQUENCY_ATTR_NO_10MHZ                         = 0x11
 	NL80211_FREQUENCY_ATTR_NO_160MHZ                        = 0xc
@@ -5530,7 +5551,7 @@ const (
 	NL80211_MAX_SUPP_SELECTORS                              = 0x80
 	NL80211_MBSSID_CONFIG_ATTR_EMA                          = 0x5
 	NL80211_MBSSID_CONFIG_ATTR_INDEX                        = 0x3
-	NL80211_MBSSID_CONFIG_ATTR_MAX                          = 0x5
+	NL80211_MBSSID_CONFIG_ATTR_MAX                          = 0x6
 	NL80211_MBSSID_CONFIG_ATTR_MAX_EMA_PROFILE_PERIODICITY  = 0x2
 	NL80211_MBSSID_CONFIG_ATTR_MAX_INTERFACES               = 0x1
 	NL80211_MBSSID_CONFIG_ATTR_TX_IFINDEX                   = 0x4

vendor/golang.org/x/sys/unix/ztypes_linux_386.go

@@ -282,19 +282,13 @@ type Taskstats struct {
 	Ac_exitcode               uint32
 	Ac_flag                   uint8
 	Ac_nice                   uint8
-	_                         [4]byte
+	_                         [6]byte
 	Cpu_count                 uint64
 	Cpu_delay_total           uint64
-	Cpu_delay_max             uint64
-	Cpu_delay_min             uint64
 	Blkio_count               uint64
 	Blkio_delay_total         uint64
-	Blkio_delay_max           uint64
-	Blkio_delay_min           uint64
 	Swapin_count              uint64
 	Swapin_delay_total        uint64
-	Swapin_delay_max          uint64
-	Swapin_delay_min          uint64
 	Cpu_run_real_total        uint64
 	Cpu_run_virtual_total     uint64
 	Ac_comm                   [32]int8
@@ -330,17 +324,11 @@ type Taskstats struct {
 	Cpu_scaled_run_real_total uint64
 	Freepages_count           uint64
 	Freepages_delay_total     uint64
-	Freepages_delay_max       uint64
-	Freepages_delay_min       uint64
 	Thrashing_count           uint64
 	Thrashing_delay_total     uint64
-	Thrashing_delay_max       uint64
-	Thrashing_delay_min       uint64
 	Ac_btime64                uint64
 	Compact_count             uint64
 	Compact_delay_total       uint64
-	Compact_delay_max         uint64
-	Compact_delay_min         uint64
 	Ac_tgid                   uint32
 	_                         [4]byte
 	Ac_tgetime                uint64
@@ -348,10 +336,22 @@ type Taskstats struct {
 	Ac_exe_inode              uint64
 	Wpcopy_count              uint64
 	Wpcopy_delay_total        uint64
-	Wpcopy_delay_max          uint64
-	Wpcopy_delay_min          uint64
 	Irq_count                 uint64
 	Irq_delay_total           uint64
+	Cpu_delay_max             uint64
+	Cpu_delay_min             uint64
+	Blkio_delay_max           uint64
+	Blkio_delay_min           uint64
+	Swapin_delay_max          uint64
+	Swapin_delay_min          uint64
+	Freepages_delay_max       uint64
+	Freepages_delay_min       uint64
+	Thrashing_delay_max       uint64
+	Thrashing_delay_min       uint64
+	Compact_delay_max         uint64
+	Compact_delay_min         uint64
+	Wpcopy_delay_max          uint64
+	Wpcopy_delay_min          uint64
 	Irq_delay_max             uint64
 	Irq_delay_min             uint64
 }

vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go

@@ -300,16 +300,10 @@ type Taskstats struct {
 	Ac_nice                   uint8
 	Cpu_count                 uint64
 	Cpu_delay_total           uint64
-	Cpu_delay_max             uint64
-	Cpu_delay_min             uint64
 	Blkio_count               uint64
 	Blkio_delay_total         uint64
-	Blkio_delay_max           uint64
-	Blkio_delay_min           uint64
 	Swapin_count              uint64
 	Swapin_delay_total        uint64
-	Swapin_delay_max          uint64
-	Swapin_delay_min          uint64
 	Cpu_run_real_total        uint64
 	Cpu_run_virtual_total     uint64
 	Ac_comm                   [32]int8
@@ -344,27 +338,33 @@ type Taskstats struct {
 	Cpu_scaled_run_real_total uint64
 	Freepages_count           uint64
 	Freepages_delay_total     uint64
-	Freepages_delay_max       uint64
-	Freepages_delay_min       uint64
 	Thrashing_count           uint64
 	Thrashing_delay_total     uint64
-	Thrashing_delay_max       uint64
-	Thrashing_delay_min       uint64
 	Ac_btime64                uint64
 	Compact_count             uint64
 	Compact_delay_total       uint64
-	Compact_delay_max         uint64
-	Compact_delay_min         uint64
 	Ac_tgid                   uint32
 	Ac_tgetime                uint64
 	Ac_exe_dev                uint64
 	Ac_exe_inode              uint64
 	Wpcopy_count              uint64
 	Wpcopy_delay_total        uint64
-	Wpcopy_delay_max          uint64
-	Wpcopy_delay_min          uint64
 	Irq_count                 uint64
 	Irq_delay_total           uint64
+	Cpu_delay_max             uint64
+	Cpu_delay_min             uint64
+	Blkio_delay_max           uint64
+	Blkio_delay_min           uint64
+	Swapin_delay_max          uint64
+	Swapin_delay_min          uint64
+	Freepages_delay_max       uint64
+	Freepages_delay_min       uint64
+	Thrashing_delay_max       uint64
+	Thrashing_delay_min       uint64
+	Compact_delay_max         uint64
+	Compact_delay_min         uint64
+	Wpcopy_delay_max          uint64
+	Wpcopy_delay_min          uint64
 	Irq_delay_max             uint64
 	Irq_delay_min             uint64
 }

vendor/golang.org/x/sys/unix/ztypes_linux_arm.go

@@ -91,7 +91,7 @@ type Stat_t struct {
 	Gid     uint32
 	Rdev    uint64
 	_       uint16
-	_       [4]byte
+	_       [6]byte
 	Size    int64
 	Blksize int32
 	_       [4]byte
@@ -273,19 +273,13 @@ type Taskstats struct {
 	Ac_exitcode               uint32
 	Ac_flag                   uint8
 	Ac_nice                   uint8
-	_                         [4]byte
+	_                         [6]byte
 	Cpu_count                 uint64
 	Cpu_delay_total           uint64
-	Cpu_delay_max             uint64
-	Cpu_delay_min             uint64
 	Blkio_count               uint64
 	Blkio_delay_total         uint64
-	Blkio_delay_max           uint64
-	Blkio_delay_min           uint64
 	Swapin_count              uint64
 	Swapin_delay_total        uint64
-	Swapin_delay_max          uint64
-	Swapin_delay_min          uint64
 	Cpu_run_real_total        uint64
 	Cpu_run_virtual_total     uint64
 	Ac_comm                   [32]uint8
@@ -321,17 +315,11 @@ type Taskstats struct {
 	Cpu_scaled_run_real_total uint64
 	Freepages_count           uint64
 	Freepages_delay_total     uint64
-	Freepages_delay_max       uint64
-	Freepages_delay_min       uint64
 	Thrashing_count           uint64
 	Thrashing_delay_total     uint64
-	Thrashing_delay_max       uint64
-	Thrashing_delay_min       uint64
 	Ac_btime64                uint64
 	Compact_count             uint64
 	Compact_delay_total       uint64
-	Compact_delay_max         uint64
-	Compact_delay_min         uint64
 	Ac_tgid                   uint32
 	_                         [4]byte
 	Ac_tgetime                uint64
@@ -339,10 +327,22 @@ type Taskstats struct {
 	Ac_exe_inode              uint64
 	Wpcopy_count              uint64
 	Wpcopy_delay_total        uint64
-	Wpcopy_delay_max          uint64
-	Wpcopy_delay_min          uint64
 	Irq_count                 uint64
 	Irq_delay_total           uint64
+	Cpu_delay_max             uint64
+	Cpu_delay_min             uint64
+	Blkio_delay_max           uint64
+	Blkio_delay_min           uint64
+	Swapin_delay_max          uint64
+	Swapin_delay_min          uint64
+	Freepages_delay_max       uint64
+	Freepages_delay_min       uint64
+	Thrashing_delay_max       uint64
+	Thrashing_delay_min       uint64
+	Compact_delay_max         uint64
+	Compact_delay_min         uint64
+	Wpcopy_delay_max          uint64
+	Wpcopy_delay_min          uint64
 	Irq_delay_max             uint64
 	Irq_delay_min             uint64
 }

vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go

@@ -279,16 +279,10 @@ type Taskstats struct {
 	Ac_nice                   uint8
 	Cpu_count                 uint64
 	Cpu_delay_total           uint64
-	Cpu_delay_max             uint64
-	Cpu_delay_min             uint64
 	Blkio_count               uint64
 	Blkio_delay_total         uint64
-	Blkio_delay_max           uint64
-	Blkio_delay_min           uint64
 	Swapin_count              uint64
 	Swapin_delay_total        uint64
-	Swapin_delay_max          uint64
-	Swapin_delay_min          uint64
 	Cpu_run_real_total        uint64
 	Cpu_run_virtual_total     uint64
 	Ac_comm                   [32]int8
@@ -323,27 +317,33 @@ type Taskstats struct {
 	Cpu_scaled_run_real_total uint64
 	Freepages_count           uint64
 	Freepages_delay_total     uint64
-	Freepages_delay_max       uint64
-	Freepages_delay_min       uint64
 	Thrashing_count           uint64
 	Thrashing_delay_total     uint64
-	Thrashing_delay_max       uint64
-	Thrashing_delay_min       uint64
 	Ac_btime64                uint64
 	Compact_count             uint64
 	Compact_delay_total       uint64
-	Compact_delay_max         uint64
-	Compact_delay_min         uint64
 	Ac_tgid                   uint32
 	Ac_tgetime                uint64
 	Ac_exe_dev                uint64
 	Ac_exe_inode              uint64
 	Wpcopy_count              uint64
 	Wpcopy_delay_total        uint64
-	Wpcopy_delay_max          uint64
-	Wpcopy_delay_min          uint64
 	Irq_count                 uint64
 	Irq_delay_total           uint64
+	Cpu_delay_max             uint64
+	Cpu_delay_min             uint64
+	Blkio_delay_max           uint64
+	Blkio_delay_min           uint64
+	Swapin_delay_max          uint64
+	Swapin_delay_min          uint64
+	Freepages_delay_max       uint64
+	Freepages_delay_min       uint64
+	Thrashing_delay_max       uint64
+	Thrashing_delay_min       uint64
+	Compact_delay_max         uint64
+	Compact_delay_min         uint64
+	Wpcopy_delay_max          uint64
+	Wpcopy_delay_min          uint64
 	Irq_delay_max             uint64
 	Irq_delay_min             uint64
 }

vendor/golang.org/x/sys/unix/ztypes_linux_loong64.go

@@ -280,16 +280,10 @@ type Taskstats struct {
 	Ac_nice                   uint8
 	Cpu_count                 uint64
 	Cpu_delay_total           uint64
-	Cpu_delay_max             uint64
-	Cpu_delay_min             uint64
 	Blkio_count               uint64
 	Blkio_delay_total         uint64
-	Blkio_delay_max           uint64
-	Blkio_delay_min           uint64
 	Swapin_count              uint64
 	Swapin_delay_total        uint64
-	Swapin_delay_max          uint64
-	Swapin_delay_min          uint64
 	Cpu_run_real_total        uint64
 	Cpu_run_virtual_total     uint64
 	Ac_comm                   [32]int8
@@ -324,27 +318,33 @@ type Taskstats struct {
 	Cpu_scaled_run_real_total uint64
 	Freepages_count           uint64
 	Freepages_delay_total     uint64
-	Freepages_delay_max       uint64
-	Freepages_delay_min       uint64
 	Thrashing_count           uint64
 	Thrashing_delay_total     uint64
-	Thrashing_delay_max       uint64
-	Thrashing_delay_min       uint64
 	Ac_btime64                uint64
 	Compact_count             uint64
 	Compact_delay_total       uint64
-	Compact_delay_max         uint64
-	Compact_delay_min         uint64
 	Ac_tgid                   uint32
 	Ac_tgetime                uint64
 	Ac_exe_dev                uint64
 	Ac_exe_inode              uint64
 	Wpcopy_count              uint64
 	Wpcopy_delay_total        uint64
-	Wpcopy_delay_max          uint64
-	Wpcopy_delay_min          uint64
 	Irq_count                 uint64
 	Irq_delay_total           uint64
+	Cpu_delay_max             uint64
+	Cpu_delay_min             uint64
+	Blkio_delay_max           uint64
+	Blkio_delay_min           uint64
+	Swapin_delay_max          uint64
+	Swapin_delay_min          uint64
+	Freepages_delay_max       uint64
+	Freepages_delay_min       uint64
+	Thrashing_delay_max       uint64
+	Thrashing_delay_min       uint64
+	Compact_delay_max         uint64
+	Compact_delay_min         uint64
+	Wpcopy_delay_max          uint64
+	Wpcopy_delay_min          uint64
 	Irq_delay_max             uint64
 	Irq_delay_min             uint64
 }

vendor/golang.org/x/sys/unix/ztypes_linux_mips.go

@@ -278,19 +278,13 @@ type Taskstats struct {
 	Ac_exitcode               uint32
 	Ac_flag                   uint8
 	Ac_nice                   uint8
-	_                         [4]byte
+	_                         [6]byte
 	Cpu_count                 uint64
 	Cpu_delay_total           uint64
-	Cpu_delay_max             uint64
-	Cpu_delay_min             uint64
 	Blkio_count               uint64
 	Blkio_delay_total         uint64
-	Blkio_delay_max           uint64
-	Blkio_delay_min           uint64
 	Swapin_count              uint64
 	Swapin_delay_total        uint64
-	Swapin_delay_max          uint64
-	Swapin_delay_min          uint64
 	Cpu_run_real_total        uint64
 	Cpu_run_virtual_total     uint64
 	Ac_comm                   [32]int8
@@ -326,17 +320,11 @@ type Taskstats struct {
 	Cpu_scaled_run_real_total uint64
 	Freepages_count           uint64
 	Freepages_delay_total     uint64
-	Freepages_delay_max       uint64
-	Freepages_delay_min       uint64
 	Thrashing_count           uint64
 	Thrashing_delay_total     uint64
-	Thrashing_delay_max       uint64
-	Thrashing_delay_min       uint64
 	Ac_btime64                uint64
 	Compact_count             uint64
 	Compact_delay_total       uint64
-	Compact_delay_max         uint64
-	Compact_delay_min         uint64
 	Ac_tgid                   uint32
 	_                         [4]byte
 	Ac_tgetime                uint64
@@ -344,10 +332,22 @@ type Taskstats struct {
 	Ac_exe_inode              uint64
 	Wpcopy_count              uint64
 	Wpcopy_delay_total        uint64
-	Wpcopy_delay_max          uint64
-	Wpcopy_delay_min          uint64
 	Irq_count                 uint64
 	Irq_delay_total           uint64
+	Cpu_delay_max             uint64
+	Cpu_delay_min             uint64
+	Blkio_delay_max           uint64
+	Blkio_delay_min           uint64
+	Swapin_delay_max          uint64
+	Swapin_delay_min          uint64
+	Freepages_delay_max       uint64
+	Freepages_delay_min       uint64
+	Thrashing_delay_max       uint64
+	Thrashing_delay_min       uint64
+	Compact_delay_max         uint64
+	Compact_delay_min         uint64
+	Wpcopy_delay_max          uint64
+	Wpcopy_delay_min          uint64
 	Irq_delay_max             uint64
 	Irq_delay_min             uint64
 }

vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go

@@ -282,16 +282,10 @@ type Taskstats struct {
 	Ac_nice                   uint8
 	Cpu_count                 uint64
 	Cpu_delay_total           uint64
-	Cpu_delay_max             uint64
-	Cpu_delay_min             uint64
 	Blkio_count               uint64
 	Blkio_delay_total         uint64
-	Blkio_delay_max           uint64
-	Blkio_delay_min           uint64
 	Swapin_count              uint64
 	Swapin_delay_total        uint64
-	Swapin_delay_max          uint64
-	Swapin_delay_min          uint64
 	Cpu_run_real_total        uint64
 	Cpu_run_virtual_total     uint64
 	Ac_comm                   [32]int8
@@ -326,27 +320,33 @@ type Taskstats struct {
 	Cpu_scaled_run_real_total uint64
 	Freepages_count           uint64
 	Freepages_delay_total     uint64
-	Freepages_delay_max       uint64
-	Freepages_delay_min       uint64
 	Thrashing_count           uint64
 	Thrashing_delay_total     uint64
-	Thrashing_delay_max       uint64
-	Thrashing_delay_min       uint64
 	Ac_btime64                uint64
 	Compact_count             uint64
 	Compact_delay_total       uint64
-	Compact_delay_max         uint64
-	Compact_delay_min         uint64
 	Ac_tgid                   uint32
 	Ac_tgetime                uint64
 	Ac_exe_dev                uint64
 	Ac_exe_inode              uint64
 	Wpcopy_count              uint64
 	Wpcopy_delay_total        uint64
-	Wpcopy_delay_max          uint64
-	Wpcopy_delay_min          uint64
 	Irq_count                 uint64
 	Irq_delay_total           uint64
+	Cpu_delay_max             uint64
+	Cpu_delay_min             uint64
+	Blkio_delay_max           uint64
+	Blkio_delay_min           uint64
+	Swapin_delay_max          uint64
+	Swapin_delay_min          uint64
+	Freepages_delay_max       uint64
+	Freepages_delay_min       uint64
+	Thrashing_delay_max       uint64
+	Thrashing_delay_min       uint64
+	Compact_delay_max         uint64
+	Compact_delay_min         uint64
+	Wpcopy_delay_max          uint64
+	Wpcopy_delay_min          uint64
 	Irq_delay_max             uint64
 	Irq_delay_min             uint64
 }

vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go

@@ -282,16 +282,10 @@ type Taskstats struct {
 	Ac_nice                   uint8
 	Cpu_count                 uint64
 	Cpu_delay_total           uint64
-	Cpu_delay_max             uint64
-	Cpu_delay_min             uint64
 	Blkio_count               uint64
 	Blkio_delay_total         uint64
-	Blkio_delay_max           uint64
-	Blkio_delay_min           uint64
 	Swapin_count              uint64
 	Swapin_delay_total        uint64
-	Swapin_delay_max          uint64
-	Swapin_delay_min          uint64
 	Cpu_run_real_total        uint64
 	Cpu_run_virtual_total     uint64
 	Ac_comm                   [32]int8
@@ -326,27 +320,33 @@ type Taskstats struct {
 	Cpu_scaled_run_real_total uint64
 	Freepages_count           uint64
 	Freepages_delay_total     uint64
-	Freepages_delay_max       uint64
-	Freepages_delay_min       uint64
 	Thrashing_count           uint64
 	Thrashing_delay_total     uint64
-	Thrashing_delay_max       uint64
-	Thrashing_delay_min       uint64
 	Ac_btime64                uint64
 	Compact_count             uint64
 	Compact_delay_total       uint64
-	Compact_delay_max         uint64
-	Compact_delay_min         uint64
 	Ac_tgid                   uint32
 	Ac_tgetime                uint64
 	Ac_exe_dev                uint64
 	Ac_exe_inode              uint64
 	Wpcopy_count              uint64
 	Wpcopy_delay_total        uint64
-	Wpcopy_delay_max          uint64
-	Wpcopy_delay_min          uint64
 	Irq_count                 uint64
 	Irq_delay_total           uint64
+	Cpu_delay_max             uint64
+	Cpu_delay_min             uint64
+	Blkio_delay_max           uint64
+	Blkio_delay_min           uint64
+	Swapin_delay_max          uint64
+	Swapin_delay_min          uint64
+	Freepages_delay_max       uint64
+	Freepages_delay_min       uint64
+	Thrashing_delay_max       uint64
+	Thrashing_delay_min       uint64
+	Compact_delay_max         uint64
+	Compact_delay_min         uint64
+	Wpcopy_delay_max          uint64
+	Wpcopy_delay_min          uint64
 	Irq_delay_max             uint64
 	Irq_delay_min             uint64
 }

vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go

@@ -278,19 +278,13 @@ type Taskstats struct {
 	Ac_exitcode               uint32
 	Ac_flag                   uint8
 	Ac_nice                   uint8
-	_                         [4]byte
+	_                         [6]byte
 	Cpu_count                 uint64
 	Cpu_delay_total           uint64
-	Cpu_delay_max             uint64
-	Cpu_delay_min             uint64
 	Blkio_count               uint64
 	Blkio_delay_total         uint64
-	Blkio_delay_max           uint64
-	Blkio_delay_min           uint64
 	Swapin_count              uint64
 	Swapin_delay_total        uint64
-	Swapin_delay_max          uint64
-	Swapin_delay_min          uint64
 	Cpu_run_real_total        uint64
 	Cpu_run_virtual_total     uint64
 	Ac_comm                   [32]int8
@@ -326,17 +320,11 @@ type Taskstats struct {
 	Cpu_scaled_run_real_total uint64
 	Freepages_count           uint64
 	Freepages_delay_total     uint64
-	Freepages_delay_max       uint64
-	Freepages_delay_min       uint64
 	Thrashing_count           uint64
 	Thrashing_delay_total     uint64
-	Thrashing_delay_max       uint64
-	Thrashing_delay_min       uint64
 	Ac_btime64                uint64
 	Compact_count             uint64
 	Compact_delay_total       uint64
-	Compact_delay_max         uint64
-	Compact_delay_min         uint64
 	Ac_tgid                   uint32
 	_                         [4]byte
 	Ac_tgetime                uint64
@@ -344,10 +332,22 @@ type Taskstats struct {
 	Ac_exe_inode              uint64
 	Wpcopy_count              uint64
 	Wpcopy_delay_total        uint64
-	Wpcopy_delay_max          uint64
-	Wpcopy_delay_min          uint64
 	Irq_count                 uint64
 	Irq_delay_total           uint64
+	Cpu_delay_max             uint64
+	Cpu_delay_min             uint64
+	Blkio_delay_max           uint64
+	Blkio_delay_min           uint64
+	Swapin_delay_max          uint64
+	Swapin_delay_min          uint64
+	Freepages_delay_max       uint64
+	Freepages_delay_min       uint64
+	Thrashing_delay_max       uint64
+	Thrashing_delay_min       uint64
+	Compact_delay_max         uint64
+	Compact_delay_min         uint64
+	Wpcopy_delay_max          uint64
+	Wpcopy_delay_min          uint64
 	Irq_delay_max             uint64
 	Irq_delay_min             uint64
 }

vendor/golang.org/x/sys/unix/ztypes_linux_ppc.go

@@ -90,7 +90,7 @@ type Stat_t struct {
 	Gid     uint32
 	Rdev    uint64
 	_       uint16
-	_       [4]byte
+	_       [6]byte
 	Size    int64
 	Blksize int32
 	_       [4]byte
@@ -285,19 +285,13 @@ type Taskstats struct {
 	Ac_exitcode               uint32
 	Ac_flag                   uint8
 	Ac_nice                   uint8
-	_                         [4]byte
+	_                         [6]byte
 	Cpu_count                 uint64
 	Cpu_delay_total           uint64
-	Cpu_delay_max             uint64
-	Cpu_delay_min             uint64
 	Blkio_count               uint64
 	Blkio_delay_total         uint64
-	Blkio_delay_max           uint64
-	Blkio_delay_min           uint64
 	Swapin_count              uint64
 	Swapin_delay_total        uint64
-	Swapin_delay_max          uint64
-	Swapin_delay_min          uint64
 	Cpu_run_real_total        uint64
 	Cpu_run_virtual_total     uint64
 	Ac_comm                   [32]uint8
@@ -333,17 +327,11 @@ type Taskstats struct {
 	Cpu_scaled_run_real_total uint64
 	Freepages_count           uint64
 	Freepages_delay_total     uint64
-	Freepages_delay_max       uint64
-	Freepages_delay_min       uint64
 	Thrashing_count           uint64
 	Thrashing_delay_total     uint64
-	Thrashing_delay_max       uint64
-	Thrashing_delay_min       uint64
 	Ac_btime64                uint64
 	Compact_count             uint64
 	Compact_delay_total       uint64
-	Compact_delay_max         uint64
-	Compact_delay_min         uint64
 	Ac_tgid                   uint32
 	_                         [4]byte
 	Ac_tgetime                uint64
@@ -351,10 +339,22 @@ type Taskstats struct {
 	Ac_exe_inode              uint64
 	Wpcopy_count              uint64
 	Wpcopy_delay_total        uint64
-	Wpcopy_delay_max          uint64
-	Wpcopy_delay_min          uint64
 	Irq_count                 uint64
 	Irq_delay_total           uint64
+	Cpu_delay_max             uint64
+	Cpu_delay_min             uint64
+	Blkio_delay_max           uint64
+	Blkio_delay_min           uint64
+	Swapin_delay_max          uint64
+	Swapin_delay_min          uint64
+	Freepages_delay_max       uint64
+	Freepages_delay_min       uint64
+	Thrashing_delay_max       uint64
+	Thrashing_delay_min       uint64
+	Compact_delay_max         uint64
+	Compact_delay_min         uint64
+	Wpcopy_delay_max          uint64
+	Wpcopy_delay_min          uint64
 	Irq_delay_max             uint64
 	Irq_delay_min             uint64
 }

vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go

@@ -289,16 +289,10 @@ type Taskstats struct {
 	Ac_nice                   uint8
 	Cpu_count                 uint64
 	Cpu_delay_total           uint64
-	Cpu_delay_max             uint64
-	Cpu_delay_min             uint64
 	Blkio_count               uint64
 	Blkio_delay_total         uint64
-	Blkio_delay_max           uint64
-	Blkio_delay_min           uint64
 	Swapin_count              uint64
 	Swapin_delay_total        uint64
-	Swapin_delay_max          uint64
-	Swapin_delay_min          uint64
 	Cpu_run_real_total        uint64
 	Cpu_run_virtual_total     uint64
 	Ac_comm                   [32]uint8
@@ -333,27 +327,33 @@ type Taskstats struct {
 	Cpu_scaled_run_real_total uint64
 	Freepages_count           uint64
 	Freepages_delay_total     uint64
-	Freepages_delay_max       uint64
-	Freepages_delay_min       uint64
 	Thrashing_count           uint64
 	Thrashing_delay_total     uint64
-	Thrashing_delay_max       uint64
-	Thrashing_delay_min       uint64
 	Ac_btime64                uint64
 	Compact_count             uint64
 	Compact_delay_total       uint64
-	Compact_delay_max         uint64
-	Compact_delay_min         uint64
 	Ac_tgid                   uint32
 	Ac_tgetime                uint64
 	Ac_exe_dev                uint64
 	Ac_exe_inode              uint64
 	Wpcopy_count              uint64
 	Wpcopy_delay_total        uint64
-	Wpcopy_delay_max          uint64
-	Wpcopy_delay_min          uint64
 	Irq_count                 uint64
 	Irq_delay_total           uint64
+	Cpu_delay_max             uint64
+	Cpu_delay_min             uint64
+	Blkio_delay_max           uint64
+	Blkio_delay_min           uint64
+	Swapin_delay_max          uint64
+	Swapin_delay_min          uint64
+	Freepages_delay_max       uint64
+	Freepages_delay_min       uint64
+	Thrashing_delay_max       uint64
+	Thrashing_delay_min       uint64
+	Compact_delay_max         uint64
+	Compact_delay_min         uint64
+	Wpcopy_delay_max          uint64
+	Wpcopy_delay_min          uint64
 	Irq_delay_max             uint64
 	Irq_delay_min             uint64
 }

vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go

@@ -289,16 +289,10 @@ type Taskstats struct {
 	Ac_nice                   uint8
 	Cpu_count                 uint64
 	Cpu_delay_total           uint64
-	Cpu_delay_max             uint64
-	Cpu_delay_min             uint64
 	Blkio_count               uint64
 	Blkio_delay_total         uint64
-	Blkio_delay_max           uint64
-	Blkio_delay_min           uint64
 	Swapin_count              uint64
 	Swapin_delay_total        uint64
-	Swapin_delay_max          uint64
-	Swapin_delay_min          uint64
 	Cpu_run_real_total        uint64
 	Cpu_run_virtual_total     uint64
 	Ac_comm                   [32]uint8
@@ -333,27 +327,33 @@ type Taskstats struct {
 	Cpu_scaled_run_real_total uint64
 	Freepages_count           uint64
 	Freepages_delay_total     uint64
-	Freepages_delay_max       uint64
-	Freepages_delay_min       uint64
 	Thrashing_count           uint64
 	Thrashing_delay_total     uint64
-	Thrashing_delay_max       uint64
-	Thrashing_delay_min       uint64
 	Ac_btime64                uint64
 	Compact_count             uint64
 	Compact_delay_total       uint64
-	Compact_delay_max         uint64
-	Compact_delay_min         uint64
 	Ac_tgid                   uint32
 	Ac_tgetime                uint64
 	Ac_exe_dev                uint64
 	Ac_exe_inode              uint64
 	Wpcopy_count              uint64
 	Wpcopy_delay_total        uint64
-	Wpcopy_delay_max          uint64
-	Wpcopy_delay_min          uint64
 	Irq_count                 uint64
 	Irq_delay_total           uint64
+	Cpu_delay_max             uint64
+	Cpu_delay_min             uint64
+	Blkio_delay_max           uint64
+	Blkio_delay_min           uint64
+	Swapin_delay_max          uint64
+	Swapin_delay_min          uint64
+	Freepages_delay_max       uint64
+	Freepages_delay_min       uint64
+	Thrashing_delay_max       uint64
+	Thrashing_delay_min       uint64
+	Compact_delay_max         uint64
+	Compact_delay_min         uint64
+	Wpcopy_delay_max          uint64
+	Wpcopy_delay_min          uint64
 	Irq_delay_max             uint64
 	Irq_delay_min             uint64
 }

vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go

@@ -307,16 +307,10 @@ type Taskstats struct {
 	Ac_nice                   uint8
 	Cpu_count                 uint64
 	Cpu_delay_total           uint64
-	Cpu_delay_max             uint64
-	Cpu_delay_min             uint64
 	Blkio_count               uint64
 	Blkio_delay_total         uint64
-	Blkio_delay_max           uint64
-	Blkio_delay_min           uint64
 	Swapin_count              uint64
 	Swapin_delay_total        uint64
-	Swapin_delay_max          uint64
-	Swapin_delay_min          uint64
 	Cpu_run_real_total        uint64
 	Cpu_run_virtual_total     uint64
 	Ac_comm                   [32]uint8
@@ -351,27 +345,33 @@ type Taskstats struct {
 	Cpu_scaled_run_real_total uint64
 	Freepages_count           uint64
 	Freepages_delay_total     uint64
-	Freepages_delay_max       uint64
-	Freepages_delay_min       uint64
 	Thrashing_count           uint64
 	Thrashing_delay_total     uint64
-	Thrashing_delay_max       uint64
-	Thrashing_delay_min       uint64
 	Ac_btime64                uint64
 	Compact_count             uint64
 	Compact_delay_total       uint64
-	Compact_delay_max         uint64
-	Compact_delay_min         uint64
 	Ac_tgid                   uint32
 	Ac_tgetime                uint64
 	Ac_exe_dev                uint64
 	Ac_exe_inode              uint64
 	Wpcopy_count              uint64
 	Wpcopy_delay_total        uint64
-	Wpcopy_delay_max          uint64
-	Wpcopy_delay_min          uint64
 	Irq_count                 uint64
 	Irq_delay_total           uint64
+	Cpu_delay_max             uint64
+	Cpu_delay_min             uint64
+	Blkio_delay_max           uint64
+	Blkio_delay_min           uint64
+	Swapin_delay_max          uint64
+	Swapin_delay_min          uint64
+	Freepages_delay_max       uint64
+	Freepages_delay_min       uint64
+	Thrashing_delay_max       uint64
+	Thrashing_delay_min       uint64
+	Compact_delay_max         uint64
+	Compact_delay_min         uint64
+	Wpcopy_delay_max          uint64
+	Wpcopy_delay_min          uint64
 	Irq_delay_max             uint64
 	Irq_delay_min             uint64
 }

vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go

@@ -302,16 +302,10 @@ type Taskstats struct {
 	Ac_nice                   uint8
 	Cpu_count                 uint64
 	Cpu_delay_total           uint64
-	Cpu_delay_max             uint64
-	Cpu_delay_min             uint64
 	Blkio_count               uint64
 	Blkio_delay_total         uint64
-	Blkio_delay_max           uint64
-	Blkio_delay_min           uint64
 	Swapin_count              uint64
 	Swapin_delay_total        uint64
-	Swapin_delay_max          uint64
-	Swapin_delay_min          uint64
 	Cpu_run_real_total        uint64
 	Cpu_run_virtual_total     uint64
 	Ac_comm                   [32]int8
@@ -346,27 +340,33 @@ type Taskstats struct {
 	Cpu_scaled_run_real_total uint64
 	Freepages_count           uint64
 	Freepages_delay_total     uint64
-	Freepages_delay_max       uint64
-	Freepages_delay_min       uint64
 	Thrashing_count           uint64
 	Thrashing_delay_total     uint64
-	Thrashing_delay_max       uint64
-	Thrashing_delay_min       uint64
 	Ac_btime64                uint64
 	Compact_count             uint64
 	Compact_delay_total       uint64
-	Compact_delay_max         uint64
-	Compact_delay_min         uint64
 	Ac_tgid                   uint32
 	Ac_tgetime                uint64
 	Ac_exe_dev                uint64
 	Ac_exe_inode              uint64
 	Wpcopy_count              uint64
 	Wpcopy_delay_total        uint64
-	Wpcopy_delay_max          uint64
-	Wpcopy_delay_min          uint64
 	Irq_count                 uint64
 	Irq_delay_total           uint64
+	Cpu_delay_max             uint64
+	Cpu_delay_min             uint64
+	Blkio_delay_max           uint64
+	Blkio_delay_min           uint64
+	Swapin_delay_max          uint64
+	Swapin_delay_min          uint64
+	Freepages_delay_max       uint64
+	Freepages_delay_min       uint64
+	Thrashing_delay_max       uint64
+	Thrashing_delay_min       uint64
+	Compact_delay_max         uint64
+	Compact_delay_min         uint64
+	Wpcopy_delay_max          uint64
+	Wpcopy_delay_min          uint64
 	Irq_delay_max             uint64
 	Irq_delay_min             uint64
 }

vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go

@@ -284,16 +284,10 @@ type Taskstats struct {
 	Ac_nice                   uint8
 	Cpu_count                 uint64
 	Cpu_delay_total           uint64
-	Cpu_delay_max             uint64
-	Cpu_delay_min             uint64
 	Blkio_count               uint64
 	Blkio_delay_total         uint64
-	Blkio_delay_max           uint64
-	Blkio_delay_min           uint64
 	Swapin_count              uint64
 	Swapin_delay_total        uint64
-	Swapin_delay_max          uint64
-	Swapin_delay_min          uint64
 	Cpu_run_real_total        uint64
 	Cpu_run_virtual_total     uint64
 	Ac_comm                   [32]int8
@@ -328,27 +322,33 @@ type Taskstats struct {
 	Cpu_scaled_run_real_total uint64
 	Freepages_count           uint64
 	Freepages_delay_total     uint64
-	Freepages_delay_max       uint64
-	Freepages_delay_min       uint64
 	Thrashing_count           uint64
 	Thrashing_delay_total     uint64
-	Thrashing_delay_max       uint64
-	Thrashing_delay_min       uint64
 	Ac_btime64                uint64
 	Compact_count             uint64
 	Compact_delay_total       uint64
-	Compact_delay_max         uint64
-	Compact_delay_min         uint64
 	Ac_tgid                   uint32
 	Ac_tgetime                uint64
 	Ac_exe_dev                uint64
 	Ac_exe_inode              uint64
 	Wpcopy_count              uint64
 	Wpcopy_delay_total        uint64
-	Wpcopy_delay_max          uint64
-	Wpcopy_delay_min          uint64
 	Irq_count                 uint64
 	Irq_delay_total           uint64
+	Cpu_delay_max             uint64
+	Cpu_delay_min             uint64
+	Blkio_delay_max           uint64
+	Blkio_delay_min           uint64
+	Swapin_delay_max          uint64
+	Swapin_delay_min          uint64
+	Freepages_delay_max       uint64
+	Freepages_delay_min       uint64
+	Thrashing_delay_max       uint64
+	Thrashing_delay_min       uint64
+	Compact_delay_max         uint64
+	Compact_delay_min         uint64
+	Wpcopy_delay_max          uint64
+	Wpcopy_delay_min          uint64
 	Irq_delay_max             uint64
 	Irq_delay_min             uint64
 }

vendor/golang.org/x/term/term_windows.go

@@ -20,12 +20,14 @@ func isTerminal(fd int) bool {
 	return err == nil
 }
 
+// This is intended to be used on a console input handle.
+// See https://learn.microsoft.com/en-us/windows/console/setconsolemode
 func makeRaw(fd int) (*State, error) {
 	var st uint32
 	if err := windows.GetConsoleMode(windows.Handle(fd), &st); err != nil {
 		return nil, err
 	}
-	raw := st &^ (windows.ENABLE_ECHO_INPUT | windows.ENABLE_PROCESSED_INPUT | windows.ENABLE_LINE_INPUT | windows.ENABLE_PROCESSED_OUTPUT)
+	raw := st &^ (windows.ENABLE_ECHO_INPUT | windows.ENABLE_PROCESSED_INPUT | windows.ENABLE_LINE_INPUT)
 	raw |= windows.ENABLE_VIRTUAL_TERMINAL_INPUT
 	if err := windows.SetConsoleMode(windows.Handle(fd), raw); err != nil {
 		return nil, err

vendor/golang.org/x/term/terminal.go

@@ -146,6 +146,7 @@ const (
 	keyCtrlD     = 4
 	keyCtrlU     = 21
 	keyEnter     = '\r'
+	keyLF        = '\n'
 	keyEscape    = 27
 	keyBackspace = 127
 	keyUnknown   = 0xd800 /* UTF-16 surrogate area */ + iota
@@ -497,7 +498,7 @@ func (t *Terminal) historyAdd(entry string) {
 // handleKey processes the given key and, optionally, returns a line of text
 // that the user has entered.
 func (t *Terminal) handleKey(key rune) (line string, ok bool) {
-	if t.pasteActive && key != keyEnter {
+	if t.pasteActive && key != keyEnter && key != keyLF {
 		t.addKeyToLine(key)
 		return
 	}
@@ -567,7 +568,7 @@ func (t *Terminal) handleKey(key rune) (line string, ok bool) {
 				t.setLine(runes, len(runes))
 			}
 		}
-	case keyEnter:
+	case keyEnter, keyLF:
 		t.moveCursorToPos(len(t.line))
 		t.queue([]rune("\r\n"))
 		line = string(t.line)
@@ -812,6 +813,10 @@ func (t *Terminal) readLine() (line string, err error) {
 			if !t.pasteActive {
 				lineIsPasted = false
 			}
+			// If we have CR, consume LF if present (CRLF sequence) to avoid returning an extra empty line.
+			if key == keyEnter && len(rest) > 0 && rest[0] == keyLF {
+				rest = rest[1:]
+			}
 			line, lineOk = t.handleKey(key)
 		}
 		if len(rest) > 0 {

vendor/google.golang.org/protobuf/encoding/protowire/wire.go

@@ -371,7 +371,31 @@ func ConsumeVarint(b []byte) (v uint64, n int) {
 func SizeVarint(v uint64) int {
 	// This computes 1 + (bits.Len64(v)-1)/7.
 	// 9/64 is a good enough approximation of 1/7
-	return int(9*uint32(bits.Len64(v))+64) / 64
+	//
+	// The Go compiler can translate the bits.LeadingZeros64 call into the LZCNT
+	// instruction, which is very fast on CPUs from the last few years. The
+	// specific way of expressing the calculation matches C++ Protobuf, see
+	// https://godbolt.org/z/4P3h53oM4 for the C++ code and how gcc/clang
+	// optimize that function for GOAMD64=v1 and GOAMD64=v3 (-march=haswell).
+
+	// By OR'ing v with 1, we guarantee that v is never 0, without changing the
+	// result of SizeVarint. LZCNT is not defined for 0, meaning the compiler
+	// needs to add extra instructions to handle that case.
+	//
+	// The Go compiler currently (go1.24.4) does not make use of this knowledge.
+	// This opportunity (removing the XOR instruction, which handles the 0 case)
+	// results in a small (1%) performance win across CPU architectures.
+	//
+	// Independently of avoiding the 0 case, we need the v |= 1 line because
+	// it allows the Go compiler to eliminate an extra XCHGL barrier.
+	v |= 1
+
+	// It would be clearer to write log2value := 63 - uint32(...), but
+	// writing uint32(...) ^ 63 is much more efficient (-14% ARM, -20% Intel).
+	// Proof of identity for our value range [0..63]:
+	// https://go.dev/play/p/Pdn9hEWYakX
+	log2value := uint32(bits.LeadingZeros64(v)) ^ 63
+	return int((log2value*9 + (64 + 9)) / 64)
 }
 
 // AppendFixed32 appends v to b as a little-endian uint32.

vendor/google.golang.org/protobuf/internal/filedesc/editions.go

@@ -72,6 +72,9 @@ func unmarshalFeatureSet(b []byte, parent EditionFeatures) EditionFeatures {
 			case genid.FeatureSet_EnforceNamingStyle_field_number:
 				// EnforceNamingStyle is enforced in protoc, languages other than C++
 				// are not supposed to do anything with this feature.
+			case genid.FeatureSet_DefaultSymbolVisibility_field_number:
+				// DefaultSymbolVisibility is enforced in protoc, runtimes should not
+				// inspect this value.
 			default:
 				panic(fmt.Sprintf("unkown field number %d while unmarshalling FeatureSet", num))
 			}

vendor/google.golang.org/protobuf/internal/filedesc/presence.go

@@ -0,0 +1,33 @@
+// Copyright 2025 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package filedesc
+
+import "google.golang.org/protobuf/reflect/protoreflect"
+
+// UsePresenceForField reports whether the presence bitmap should be used for
+// the specified field.
+func UsePresenceForField(fd protoreflect.FieldDescriptor) (usePresence, canBeLazy bool) {
+	switch {
+	case fd.ContainingOneof() != nil && !fd.ContainingOneof().IsSynthetic():
+		// Oneof fields never use the presence bitmap.
+		//
+		// Synthetic oneofs are an exception: Those are used to implement proto3
+		// optional fields and hence should follow non-oneof field semantics.
+		return false, false
+
+	case fd.IsMap():
+		// Map-typed fields never use the presence bitmap.
+		return false, false
+
+	case fd.Kind() == protoreflect.MessageKind || fd.Kind() == protoreflect.GroupKind:
+		// Lazy fields always use the presence bitmap (only messages can be lazy).
+		isLazy := fd.(interface{ IsLazy() bool }).IsLazy()
+		return isLazy, isLazy
+
+	default:
+		// If the field has presence, use the presence bitmap.
+		return fd.HasPresence(), false
+	}
+}

vendor/google.golang.org/protobuf/internal/genid/descriptor_gen.go

@@ -34,6 +34,19 @@ const (
 	Edition_EDITION_MAX_enum_value             = 2147483647
 )
 
+// Full and short names for google.protobuf.SymbolVisibility.
+const (
+	SymbolVisibility_enum_fullname = "google.protobuf.SymbolVisibility"
+	SymbolVisibility_enum_name     = "SymbolVisibility"
+)
+
+// Enum values for google.protobuf.SymbolVisibility.
+const (
+	SymbolVisibility_VISIBILITY_UNSET_enum_value  = 0
+	SymbolVisibility_VISIBILITY_LOCAL_enum_value  = 1
+	SymbolVisibility_VISIBILITY_EXPORT_enum_value = 2
+)
+
 // Names for google.protobuf.FileDescriptorSet.
 const (
 	FileDescriptorSet_message_name     protoreflect.Name     = "FileDescriptorSet"
@@ -65,6 +78,7 @@ const (
 	FileDescriptorProto_Dependency_field_name       protoreflect.Name = "dependency"
 	FileDescriptorProto_PublicDependency_field_name protoreflect.Name = "public_dependency"
 	FileDescriptorProto_WeakDependency_field_name   protoreflect.Name = "weak_dependency"
+	FileDescriptorProto_OptionDependency_field_name protoreflect.Name = "option_dependency"
 	FileDescriptorProto_MessageType_field_name      protoreflect.Name = "message_type"
 	FileDescriptorProto_EnumType_field_name         protoreflect.Name = "enum_type"
 	FileDescriptorProto_Service_field_name          protoreflect.Name = "service"
@@ -79,6 +93,7 @@ const (
 	FileDescriptorProto_Dependency_field_fullname       protoreflect.FullName = "google.protobuf.FileDescriptorProto.dependency"
 	FileDescriptorProto_PublicDependency_field_fullname protoreflect.FullName = "google.protobuf.FileDescriptorProto.public_dependency"
 	FileDescriptorProto_WeakDependency_field_fullname   protoreflect.FullName = "google.protobuf.FileDescriptorProto.weak_dependency"
+	FileDescriptorProto_OptionDependency_field_fullname protoreflect.FullName = "google.protobuf.FileDescriptorProto.option_dependency"
 	FileDescriptorProto_MessageType_field_fullname      protoreflect.FullName = "google.protobuf.FileDescriptorProto.message_type"
 	FileDescriptorProto_EnumType_field_fullname         protoreflect.FullName = "google.protobuf.FileDescriptorProto.enum_type"
 	FileDescriptorProto_Service_field_fullname          protoreflect.FullName = "google.protobuf.FileDescriptorProto.service"
@@ -96,6 +111,7 @@ const (
 	FileDescriptorProto_Dependency_field_number       protoreflect.FieldNumber = 3
 	FileDescriptorProto_PublicDependency_field_number protoreflect.FieldNumber = 10
 	FileDescriptorProto_WeakDependency_field_number   protoreflect.FieldNumber = 11
+	FileDescriptorProto_OptionDependency_field_number protoreflect.FieldNumber = 15
 	FileDescriptorProto_MessageType_field_number      protoreflect.FieldNumber = 4
 	FileDescriptorProto_EnumType_field_number         protoreflect.FieldNumber = 5
 	FileDescriptorProto_Service_field_number          protoreflect.FieldNumber = 6
@@ -124,6 +140,7 @@ const (
 	DescriptorProto_Options_field_name        protoreflect.Name = "options"
 	DescriptorProto_ReservedRange_field_name  protoreflect.Name = "reserved_range"
 	DescriptorProto_ReservedName_field_name   protoreflect.Name = "reserved_name"
+	DescriptorProto_Visibility_field_name     protoreflect.Name = "visibility"
 
 	DescriptorProto_Name_field_fullname           protoreflect.FullName = "google.protobuf.DescriptorProto.name"
 	DescriptorProto_Field_field_fullname          protoreflect.FullName = "google.protobuf.DescriptorProto.field"
@@ -135,6 +152,7 @@ const (
 	DescriptorProto_Options_field_fullname        protoreflect.FullName = "google.protobuf.DescriptorProto.options"
 	DescriptorProto_ReservedRange_field_fullname  protoreflect.FullName = "google.protobuf.DescriptorProto.reserved_range"
 	DescriptorProto_ReservedName_field_fullname   protoreflect.FullName = "google.protobuf.DescriptorProto.reserved_name"
+	DescriptorProto_Visibility_field_fullname     protoreflect.FullName = "google.protobuf.DescriptorProto.visibility"
 )
 
 // Field numbers for google.protobuf.DescriptorProto.
@@ -149,6 +167,7 @@ const (
 	DescriptorProto_Options_field_number        protoreflect.FieldNumber = 7
 	DescriptorProto_ReservedRange_field_number  protoreflect.FieldNumber = 9
 	DescriptorProto_ReservedName_field_number   protoreflect.FieldNumber = 10
+	DescriptorProto_Visibility_field_number     protoreflect.FieldNumber = 11
 )
 
 // Names for google.protobuf.DescriptorProto.ExtensionRange.
@@ -388,12 +407,14 @@ const (
 	EnumDescriptorProto_Options_field_name       protoreflect.Name = "options"
 	EnumDescriptorProto_ReservedRange_field_name protoreflect.Name = "reserved_range"
 	EnumDescriptorProto_ReservedName_field_name  protoreflect.Name = "reserved_name"
+	EnumDescriptorProto_Visibility_field_name    protoreflect.Name = "visibility"
 
 	EnumDescriptorProto_Name_field_fullname          protoreflect.FullName = "google.protobuf.EnumDescriptorProto.name"
 	EnumDescriptorProto_Value_field_fullname         protoreflect.FullName = "google.protobuf.EnumDescriptorProto.value"
 	EnumDescriptorProto_Options_field_fullname       protoreflect.FullName = "google.protobuf.EnumDescriptorProto.options"
 	EnumDescriptorProto_ReservedRange_field_fullname protoreflect.FullName = "google.protobuf.EnumDescriptorProto.reserved_range"
 	EnumDescriptorProto_ReservedName_field_fullname  protoreflect.FullName = "google.protobuf.EnumDescriptorProto.reserved_name"
+	EnumDescriptorProto_Visibility_field_fullname    protoreflect.FullName = "google.protobuf.EnumDescriptorProto.visibility"
 )
 
 // Field numbers for google.protobuf.EnumDescriptorProto.
@@ -403,6 +424,7 @@ const (
 	EnumDescriptorProto_Options_field_number       protoreflect.FieldNumber = 3
 	EnumDescriptorProto_ReservedRange_field_number protoreflect.FieldNumber = 4
 	EnumDescriptorProto_ReservedName_field_number  protoreflect.FieldNumber = 5
+	EnumDescriptorProto_Visibility_field_number    protoreflect.FieldNumber = 6
 )
 
 // Names for google.protobuf.EnumDescriptorProto.EnumReservedRange.
@@ -1008,32 +1030,35 @@ const (
 
 // Field names for google.protobuf.FeatureSet.
 const (
-	FeatureSet_FieldPresence_field_name         protoreflect.Name = "field_presence"
+	FeatureSet_FieldPresence_field_name           protoreflect.Name = "field_presence"
-	FeatureSet_EnumType_field_name              protoreflect.Name = "enum_type"
+	FeatureSet_EnumType_field_name                protoreflect.Name = "enum_type"
-	FeatureSet_RepeatedFieldEncoding_field_name protoreflect.Name = "repeated_field_encoding"
+	FeatureSet_RepeatedFieldEncoding_field_name   protoreflect.Name = "repeated_field_encoding"
-	FeatureSet_Utf8Validation_field_name        protoreflect.Name = "utf8_validation"
+	FeatureSet_Utf8Validation_field_name          protoreflect.Name = "utf8_validation"
-	FeatureSet_MessageEncoding_field_name       protoreflect.Name = "message_encoding"
+	FeatureSet_MessageEncoding_field_name         protoreflect.Name = "message_encoding"
-	FeatureSet_JsonFormat_field_name            protoreflect.Name = "json_format"
+	FeatureSet_JsonFormat_field_name              protoreflect.Name = "json_format"
-	FeatureSet_EnforceNamingStyle_field_name    protoreflect.Name = "enforce_naming_style"
+	FeatureSet_EnforceNamingStyle_field_name      protoreflect.Name = "enforce_naming_style"
+	FeatureSet_DefaultSymbolVisibility_field_name protoreflect.Name = "default_symbol_visibility"
 
-	FeatureSet_FieldPresence_field_fullname         protoreflect.FullName = "google.protobuf.FeatureSet.field_presence"
+	FeatureSet_FieldPresence_field_fullname           protoreflect.FullName = "google.protobuf.FeatureSet.field_presence"
-	FeatureSet_EnumType_field_fullname              protoreflect.FullName = "google.protobuf.FeatureSet.enum_type"
+	FeatureSet_EnumType_field_fullname                protoreflect.FullName = "google.protobuf.FeatureSet.enum_type"
-	FeatureSet_RepeatedFieldEncoding_field_fullname protoreflect.FullName = "google.protobuf.FeatureSet.repeated_field_encoding"
+	FeatureSet_RepeatedFieldEncoding_field_fullname   protoreflect.FullName = "google.protobuf.FeatureSet.repeated_field_encoding"
-	FeatureSet_Utf8Validation_field_fullname        protoreflect.FullName = "google.protobuf.FeatureSet.utf8_validation"
+	FeatureSet_Utf8Validation_field_fullname          protoreflect.FullName = "google.protobuf.FeatureSet.utf8_validation"
-	FeatureSet_MessageEncoding_field_fullname       protoreflect.FullName = "google.protobuf.FeatureSet.message_encoding"
+	FeatureSet_MessageEncoding_field_fullname         protoreflect.FullName = "google.protobuf.FeatureSet.message_encoding"
-	FeatureSet_JsonFormat_field_fullname            protoreflect.FullName = "google.protobuf.FeatureSet.json_format"
+	FeatureSet_JsonFormat_field_fullname              protoreflect.FullName = "google.protobuf.FeatureSet.json_format"
-	FeatureSet_EnforceNamingStyle_field_fullname    protoreflect.FullName = "google.protobuf.FeatureSet.enforce_naming_style"
+	FeatureSet_EnforceNamingStyle_field_fullname      protoreflect.FullName = "google.protobuf.FeatureSet.enforce_naming_style"
+	FeatureSet_DefaultSymbolVisibility_field_fullname protoreflect.FullName = "google.protobuf.FeatureSet.default_symbol_visibility"
 )
 
 // Field numbers for google.protobuf.FeatureSet.
 const (
-	FeatureSet_FieldPresence_field_number         protoreflect.FieldNumber = 1
+	FeatureSet_FieldPresence_field_number           protoreflect.FieldNumber = 1
-	FeatureSet_EnumType_field_number              protoreflect.FieldNumber = 2
+	FeatureSet_EnumType_field_number                protoreflect.FieldNumber = 2
-	FeatureSet_RepeatedFieldEncoding_field_number protoreflect.FieldNumber = 3
+	FeatureSet_RepeatedFieldEncoding_field_number   protoreflect.FieldNumber = 3
-	FeatureSet_Utf8Validation_field_number        protoreflect.FieldNumber = 4
+	FeatureSet_Utf8Validation_field_number          protoreflect.FieldNumber = 4
-	FeatureSet_MessageEncoding_field_number       protoreflect.FieldNumber = 5
+	FeatureSet_MessageEncoding_field_number         protoreflect.FieldNumber = 5
-	FeatureSet_JsonFormat_field_number            protoreflect.FieldNumber = 6
+	FeatureSet_JsonFormat_field_number              protoreflect.FieldNumber = 6
-	FeatureSet_EnforceNamingStyle_field_number    protoreflect.FieldNumber = 7
+	FeatureSet_EnforceNamingStyle_field_number      protoreflect.FieldNumber = 7
+	FeatureSet_DefaultSymbolVisibility_field_number protoreflect.FieldNumber = 8
 )
 
 // Full and short names for google.protobuf.FeatureSet.FieldPresence.
@@ -1128,6 +1153,27 @@ const (
 	FeatureSet_STYLE_LEGACY_enum_value                 = 2
 )
 
+// Names for google.protobuf.FeatureSet.VisibilityFeature.
+const (
+	FeatureSet_VisibilityFeature_message_name     protoreflect.Name     = "VisibilityFeature"
+	FeatureSet_VisibilityFeature_message_fullname protoreflect.FullName = "google.protobuf.FeatureSet.VisibilityFeature"
+)
+
+// Full and short names for google.protobuf.FeatureSet.VisibilityFeature.DefaultSymbolVisibility.
+const (
+	FeatureSet_VisibilityFeature_DefaultSymbolVisibility_enum_fullname = "google.protobuf.FeatureSet.VisibilityFeature.DefaultSymbolVisibility"
+	FeatureSet_VisibilityFeature_DefaultSymbolVisibility_enum_name     = "DefaultSymbolVisibility"
+)
+
+// Enum values for google.protobuf.FeatureSet.VisibilityFeature.DefaultSymbolVisibility.
+const (
+	FeatureSet_VisibilityFeature_DEFAULT_SYMBOL_VISIBILITY_UNKNOWN_enum_value = 0
+	FeatureSet_VisibilityFeature_EXPORT_ALL_enum_value                        = 1
+	FeatureSet_VisibilityFeature_EXPORT_TOP_LEVEL_enum_value                  = 2
+	FeatureSet_VisibilityFeature_LOCAL_ALL_enum_value                         = 3
+	FeatureSet_VisibilityFeature_STRICT_enum_value                            = 4
+)
+
 // Names for google.protobuf.FeatureSetDefaults.
 const (
 	FeatureSetDefaults_message_name     protoreflect.Name     = "FeatureSetDefaults"

vendor/google.golang.org/protobuf/internal/impl/codec_message_opaque.go

@@ -11,6 +11,7 @@ import (
 
 	"google.golang.org/protobuf/encoding/protowire"
 	"google.golang.org/protobuf/internal/encoding/messageset"
+	"google.golang.org/protobuf/internal/filedesc"
 	"google.golang.org/protobuf/internal/order"
 	"google.golang.org/protobuf/reflect/protoreflect"
 	piface "google.golang.org/protobuf/runtime/protoiface"
@@ -80,7 +81,7 @@ func (mi *MessageInfo) makeOpaqueCoderMethods(t reflect.Type, si opaqueStructInf
 		// permit us to skip over definitely-unset fields at marshal time.
 
 		var hasPresence bool
-		hasPresence, cf.isLazy = usePresenceForField(si, fd)
+		hasPresence, cf.isLazy = filedesc.UsePresenceForField(fd)
 
 		if hasPresence {
 			cf.presenceIndex, mi.presenceSize = presenceIndex(mi.Desc, fd)

vendor/google.golang.org/protobuf/internal/impl/message_opaque.go

@@ -11,6 +11,7 @@ import (
 	"strings"
 	"sync/atomic"
 
+	"google.golang.org/protobuf/internal/filedesc"
 	"google.golang.org/protobuf/reflect/protoreflect"
 )
 
@@ -53,7 +54,7 @@ func opaqueInitHook(mi *MessageInfo) bool {
 		fd := fds.Get(i)
 		fs := si.fieldsByNumber[fd.Number()]
 		var fi fieldInfo
-		usePresence, _ := usePresenceForField(si, fd)
+		usePresence, _ := filedesc.UsePresenceForField(fd)
 
 		switch {
 		case fd.ContainingOneof() != nil && !fd.ContainingOneof().IsSynthetic():
@@ -343,17 +344,15 @@ func (mi *MessageInfo) fieldInfoForMessageListOpaqueNoPresence(si opaqueStructIn
 			if p.IsNil() {
 				return false
 			}
-			sp := p.Apply(fieldOffset).AtomicGetPointer()
+			rv := p.Apply(fieldOffset).AsValueOf(fs.Type).Elem()
-			if sp.IsNil() {
+			if rv.IsNil() {
 				return false
 			}
-			rv := sp.AsValueOf(fs.Type.Elem())
 			return rv.Elem().Len() > 0
 		},
 		clear: func(p pointer) {
-			sp := p.Apply(fieldOffset).AtomicGetPointer()
+			rv := p.Apply(fieldOffset).AsValueOf(fs.Type).Elem()
-			if !sp.IsNil() {
+			if !rv.IsNil() {
-				rv := sp.AsValueOf(fs.Type.Elem())
 				rv.Elem().Set(reflect.Zero(rv.Type().Elem()))
 			}
 		},
@@ -361,11 +360,10 @@ func (mi *MessageInfo) fieldInfoForMessageListOpaqueNoPresence(si opaqueStructIn
 			if p.IsNil() {
 				return conv.Zero()
 			}
-			sp := p.Apply(fieldOffset).AtomicGetPointer()
+			rv := p.Apply(fieldOffset).AsValueOf(fs.Type).Elem()
-			if sp.IsNil() {
+			if rv.IsNil() {
 				return conv.Zero()
 			}
-			rv := sp.AsValueOf(fs.Type.Elem())
 			if rv.Elem().Len() == 0 {
 				return conv.Zero()
 			}
@@ -598,30 +596,3 @@ func (mi *MessageInfo) clearPresent(p pointer, index uint32) {
 func (mi *MessageInfo) present(p pointer, index uint32) bool {
 	return p.Apply(mi.presenceOffset).PresenceInfo().Present(index)
 }
-
-// usePresenceForField implements the somewhat intricate logic of when
-// the presence bitmap is used for a field.  The main logic is that a
-// field that is optional or that can be lazy will use the presence
-// bit, but for proto2, also maps have a presence bit. It also records
-// if the field can ever be lazy, which is true if we have a
-// lazyOffset and the field is a message or a slice of messages. A
-// field that is lazy will always need a presence bit.  Oneofs are not
-// lazy and do not use presence, unless they are a synthetic oneof,
-// which is a proto3 optional field. For proto3 optionals, we use the
-// presence and they can also be lazy when applicable (a message).
-func usePresenceForField(si opaqueStructInfo, fd protoreflect.FieldDescriptor) (usePresence, canBeLazy bool) {
-	hasLazyField := fd.(interface{ IsLazy() bool }).IsLazy()
-
-	// Non-oneof scalar fields with explicit field presence use the presence array.
-	usesPresenceArray := fd.HasPresence() && fd.Message() == nil && (fd.ContainingOneof() == nil || fd.ContainingOneof().IsSynthetic())
-	switch {
-	case fd.ContainingOneof() != nil && !fd.ContainingOneof().IsSynthetic():
-		return false, false
-	case fd.IsMap():
-		return false, false
-	case fd.Kind() == protoreflect.MessageKind || fd.Kind() == protoreflect.GroupKind:
-		return hasLazyField, hasLazyField
-	default:
-		return usesPresenceArray || (hasLazyField && fd.HasPresence()), false
-	}
-}

vendor/google.golang.org/protobuf/internal/impl/presence.go

@@ -32,9 +32,6 @@ func (p presence) toElem(num uint32) (ret *uint32) {
 
 // Present checks for the presence of a specific field number in a presence set.
 func (p presence) Present(num uint32) bool {
-	if p.P == nil {
-		return false
-	}
 	return Export{}.Present(p.toElem(num), num)
 }