bump reva to 4eb591e

Signed-off-by: Jörn Friedrich Dreyer <jfd@butonic.de>
This commit is contained in:
Jörn Friedrich Dreyer
2025-02-26 15:00:30 +01:00
parent 8cf4f1638e
commit d09149cace
74 changed files with 3332 additions and 2581 deletions
+7 -6
View File
@@ -65,7 +65,7 @@ require (
github.com/onsi/ginkgo/v2 v2.22.2
github.com/onsi/gomega v1.36.2
github.com/open-policy-agent/opa v1.1.0
github.com/opencloud-eu/reva/v2 v2.27.3-0.20250225150735-7d4559bbf520
github.com/opencloud-eu/reva/v2 v2.27.3-0.20250226135705-4eb591e3210d
github.com/orcaman/concurrent-map v1.0.0
github.com/owncloud/libre-graph-api-go v1.0.5-0.20240829135935-80dc00d6f5ea
github.com/pkg/errors v0.9.1
@@ -73,7 +73,7 @@ require (
github.com/prometheus/client_golang v1.21.0
github.com/r3labs/sse/v2 v2.10.0
github.com/riandyrn/otelchi v0.12.0
github.com/rogpeppe/go-internal v1.13.1
github.com/rogpeppe/go-internal v1.14.1
github.com/rs/cors v1.11.1
github.com/rs/zerolog v1.33.0
github.com/shamaton/msgpack/v2 v2.2.2
@@ -101,7 +101,7 @@ require (
golang.org/x/crypto v0.33.0
golang.org/x/exp v0.0.0-20241009180824-f66d83c29e7c
golang.org/x/image v0.24.0
golang.org/x/net v0.34.0
golang.org/x/net v0.35.0
golang.org/x/oauth2 v0.26.0
golang.org/x/sync v0.11.0
golang.org/x/term v0.29.0
@@ -208,7 +208,7 @@ require (
github.com/gobwas/httphead v0.1.0 // indirect
github.com/gobwas/pool v0.2.1 // indirect
github.com/gobwas/ws v1.2.1 // indirect
github.com/goccy/go-json v0.10.3 // indirect
github.com/goccy/go-json v0.10.5 // indirect
github.com/goccy/go-yaml v1.11.2 // indirect
github.com/gofrs/flock v0.12.1 // indirect
github.com/gogo/protobuf v1.3.2 // indirect
@@ -239,7 +239,7 @@ require (
github.com/juliangruber/go-intersect v1.1.0 // indirect
github.com/kevinburke/ssh_config v1.2.0 // indirect
github.com/klauspost/compress v1.17.11 // indirect
github.com/klauspost/cpuid/v2 v2.2.8 // indirect
github.com/klauspost/cpuid/v2 v2.2.9 // indirect
github.com/leodido/go-urn v1.4.0 // indirect
github.com/libregraph/oidc-go v1.1.0 // indirect
github.com/longsleep/go-metrics v1.0.0 // indirect
@@ -253,9 +253,10 @@ require (
github.com/mendsley/gojwk v0.0.0-20141217222730-4d5ec6e58103 // indirect
github.com/miekg/dns v1.1.57 // indirect
github.com/mileusna/useragent v1.3.5 // indirect
github.com/minio/crc64nvme v1.0.1 // indirect
github.com/minio/highwayhash v1.0.3 // indirect
github.com/minio/md5-simd v1.1.2 // indirect
github.com/minio/minio-go/v7 v7.0.78 // indirect
github.com/minio/minio-go/v7 v7.0.87 // indirect
github.com/mitchellh/copystructure v1.2.0 // indirect
github.com/mitchellh/reflectwalk v1.0.2 // indirect
github.com/modern-go/concurrent v0.0.0-20180306012644-bacd9c7ef1dd // indirect
+14 -12
View File
@@ -438,8 +438,8 @@ github.com/gobwas/pool v0.2.1 h1:xfeeEhW7pwmX8nuLVlqbzVc7udMDrwetjEv+TZIz1og=
github.com/gobwas/pool v0.2.1/go.mod h1:q8bcK0KcYlCgd9e7WYLm9LpyS+YeLd8JVDW6WezmKEw=
github.com/gobwas/ws v1.2.1 h1:F2aeBZrm2NDsc7vbovKrWSogd4wvfAxg0FQ89/iqOTk=
github.com/gobwas/ws v1.2.1/go.mod h1:hRKAFb8wOxFROYNsT1bqfWnhX+b5MFeJM9r2ZSwg/KY=
github.com/goccy/go-json v0.10.3 h1:KZ5WoDbxAIgm2HNbYckL0se1fHD6rz5j4ywS6ebzDqA=
github.com/goccy/go-json v0.10.3/go.mod h1:oq7eo15ShAhp70Anwd5lgX2pLfOS3QCiwU/PULtXL6M=
github.com/goccy/go-json v0.10.5 h1:Fq85nIqj+gXn/S5ahsiTlK3TmC85qgirsdTP/+DeaC4=
github.com/goccy/go-json v0.10.5/go.mod h1:oq7eo15ShAhp70Anwd5lgX2pLfOS3QCiwU/PULtXL6M=
github.com/goccy/go-yaml v1.11.2 h1:joq77SxuyIs9zzxEjgyLBugMQ9NEgTWxXfz2wVqwAaQ=
github.com/goccy/go-yaml v1.11.2/go.mod h1:wKnAMd44+9JAAnGQpWVEgBzGt3YuTaQ4uXoHvE4m7WU=
github.com/godbus/dbus/v5 v5.0.4/go.mod h1:xhWf0FNVPg57R7Z0UbKHbJfkEywrmjJnf7w5xrFpKfA=
@@ -687,8 +687,8 @@ github.com/klauspost/compress v1.15.9/go.mod h1:PhcZ0MbTNciWF3rruxRgKxI5NkcHHrHU
github.com/klauspost/compress v1.17.11 h1:In6xLpyWOi1+C7tXUUWv2ot1QvBjxevKAaI6IXrJmUc=
github.com/klauspost/compress v1.17.11/go.mod h1:pMDklpSncoRMuLFrf1W9Ss9KT+0rH90U12bZKk7uwG0=
github.com/klauspost/cpuid/v2 v2.0.1/go.mod h1:FInQzS24/EEf25PyTYn52gqo7WaD8xa0213Md/qVLRg=
github.com/klauspost/cpuid/v2 v2.2.8 h1:+StwCXwm9PdpiEkPyzBXIy+M9KUb4ODm0Zarf1kS5BM=
github.com/klauspost/cpuid/v2 v2.2.8/go.mod h1:Lcz8mBdAVJIBVzewtcLocK12l3Y+JytZYpaMropDUws=
github.com/klauspost/cpuid/v2 v2.2.9 h1:66ze0taIn2H33fBvCkXuv9BmCwDfafmiIVpKV9kKGuY=
github.com/klauspost/cpuid/v2 v2.2.9/go.mod h1:rqkxqrZ1EhYM9G+hXH7YdowN5R5RGN6NK4QwQ3WMXF8=
github.com/kobergj/gowebdav v0.0.0-20250102091030-aa65266db202 h1:A1xJ2NKgiYFiaHiLl9B5yw/gUBACSs9crDykTS3GuQI=
github.com/kobergj/gowebdav v0.0.0-20250102091030-aa65266db202/go.mod h1:bHA7t77X/QFExdeAnDzK6vKM34kEZAcE1OX4MfiwjkE=
github.com/kobergj/plugins/v4/store/nats-js-kv v0.0.0-20240807130109-f62bb67e8c90 h1:pfI8Z5yavO6fU6vDGlWhZ4BgDlvj8c6xB7J57HfTPwA=
@@ -781,12 +781,14 @@ github.com/miekg/dns v1.1.57 h1:Jzi7ApEIzwEPLHWRcafCN9LZSBbqQpxjt/wpgvg7wcM=
github.com/miekg/dns v1.1.57/go.mod h1:uqRjCRUuEAA6qsOiJvDd+CFo/vW+y5WR6SNmHE55hZk=
github.com/mileusna/useragent v1.3.5 h1:SJM5NzBmh/hO+4LGeATKpaEX9+b4vcGg2qXGLiNGDws=
github.com/mileusna/useragent v1.3.5/go.mod h1:3d8TOmwL/5I8pJjyVDteHtgDGcefrFUX4ccGOMKNYYc=
github.com/minio/crc64nvme v1.0.1 h1:DHQPrYPdqK7jQG/Ls5CTBZWeex/2FMS3G5XGkycuFrY=
github.com/minio/crc64nvme v1.0.1/go.mod h1:eVfm2fAzLlxMdUGc0EEBGSMmPwmXD5XiNRpnu9J3bvg=
github.com/minio/highwayhash v1.0.3 h1:kbnuUMoHYyVl7szWjSxJnxw11k2U709jqFPPmIUyD6Q=
github.com/minio/highwayhash v1.0.3/go.mod h1:GGYsuwP/fPD6Y9hMiXuapVvlIUEhFhMTh0rxU3ik1LQ=
github.com/minio/md5-simd v1.1.2 h1:Gdi1DZK69+ZVMoNHRXJyNcxrMA4dSxoYHZSQbirFg34=
github.com/minio/md5-simd v1.1.2/go.mod h1:MzdKDxYpY2BT9XQFocsiZf/NKVtR7nkE4RoEpN+20RM=
github.com/minio/minio-go/v7 v7.0.78 h1:LqW2zy52fxnI4gg8C2oZviTaKHcBV36scS+RzJnxUFs=
github.com/minio/minio-go/v7 v7.0.78/go.mod h1:84gmIilaX4zcvAWWzJ5Z1WI5axN+hAbM5w25xf8xvC0=
github.com/minio/minio-go/v7 v7.0.87 h1:nkr9x0u53PespfxfUqxP3UYWiE2a41gaofgNnC4Y8WQ=
github.com/minio/minio-go/v7 v7.0.87/go.mod h1:33+O8h0tO7pCeCWwBVa07RhVVfB/3vS4kEX7rwYKmIg=
github.com/mitchellh/cli v1.0.0/go.mod h1:hNIlj7HEI86fIcpObd7a0FcrxTWetlwJDGcceTlRvqc=
github.com/mitchellh/copystructure v1.2.0 h1:vpKXTN4ewci03Vljg/q9QvCGUDttBOGBIa15WveJJGw=
github.com/mitchellh/copystructure v1.2.0/go.mod h1:qLl+cE2AmVv+CoeAwDPye/v+N2HKCj9FbZEVFJRxO9s=
@@ -861,8 +863,8 @@ github.com/onsi/gomega v1.36.2 h1:koNYke6TVk6ZmnyHrCXba/T/MoLBXFjeC1PtvYgw0A8=
github.com/onsi/gomega v1.36.2/go.mod h1:DdwyADRjrc825LhMEkD76cHR5+pUnjhUN8GlHlRPHzY=
github.com/open-policy-agent/opa v1.1.0 h1:HMz2evdEMTyNqtdLjmu3Vyx06BmhNYAx67Yz3Ll9q2s=
github.com/open-policy-agent/opa v1.1.0/go.mod h1:T1pASQ1/vwfTa+e2fYcfpLCvWgYtqtiUv+IuA/dLPQs=
github.com/opencloud-eu/reva/v2 v2.27.3-0.20250225150735-7d4559bbf520 h1:JCFtRPS6l0zouBBMBewWDXOBiKBhmAzsw6liG83b+Xw=
github.com/opencloud-eu/reva/v2 v2.27.3-0.20250225150735-7d4559bbf520/go.mod h1:ZERf8ae/ppN23rL0TwUH+oxxGY2DZ0x3o31ho3w7GeY=
github.com/opencloud-eu/reva/v2 v2.27.3-0.20250226135705-4eb591e3210d h1:0AldgkqIcc6K3ciTB4zaWK/PvCeq6M5J66SXGOTQyOY=
github.com/opencloud-eu/reva/v2 v2.27.3-0.20250226135705-4eb591e3210d/go.mod h1:BQdl4BybewOQRtKtmM57qg05IsWXETCItuHPsnYvhZg=
github.com/opentracing/opentracing-go v1.1.0/go.mod h1:UkNAQd3GIcIGf0SeVgPpRdFStlNbqXla1AfSYxPUl2o=
github.com/opentracing/opentracing-go v1.2.0 h1:uEJPy/1a5RIPAJ0Ov+OIO8OxWu77jEv+1B0VhjKrZUs=
github.com/opentracing/opentracing-go v1.2.0/go.mod h1:GxEUsuufX4nBwe+T+Wl9TAgYrxe9dPLANfrWvHYVTgc=
@@ -974,8 +976,8 @@ github.com/rogpeppe/fastuuid v0.0.0-20150106093220-6724a57986af/go.mod h1:XWv6So
github.com/rogpeppe/go-internal v1.3.0/go.mod h1:M8bDsm7K2OlrFYOpmOWEs/qY81heoFRclV5y23lUDJ4=
github.com/rogpeppe/go-internal v1.6.1/go.mod h1:xXDCJY+GAPziupqXw64V24skbSoqbTEfhy4qGm1nDQc=
github.com/rogpeppe/go-internal v1.8.0/go.mod h1:WmiCO8CzOY8rg0OYDC4/i/2WRWAB6poM+XZ2dLUbcbE=
github.com/rogpeppe/go-internal v1.13.1 h1:KvO1DLK/DRN07sQ1LQKScxyZJuNnedQ5/wKSR38lUII=
github.com/rogpeppe/go-internal v1.13.1/go.mod h1:uMEvuHeurkdAXX61udpOXGD/AzZDWNMNyH2VO9fmH0o=
github.com/rogpeppe/go-internal v1.14.1 h1:UQB4HGPB6osV0SQTLymcB4TgvyWu6ZyliaW0tI/otEQ=
github.com/rogpeppe/go-internal v1.14.1/go.mod h1:MaRKkUm5W0goXpeCfT7UZI6fk/L7L7so1lCWt35ZSgc=
github.com/rs/cors v1.11.1 h1:eU3gRzXLRK57F5rKMGMZURNdIG4EoAmX8k94r9wXWHA=
github.com/rs/cors v1.11.1/go.mod h1:XyqrcTp5zjWr1wsJ8PIRZssZ8b/WMcMf71DJnit4EMU=
github.com/rs/xid v1.5.0/go.mod h1:trrq9SKmegXys3aeAKXMUTdJsYXVwGY3RLcfgqegfbg=
@@ -1323,8 +1325,8 @@ golang.org/x/net v0.21.0/go.mod h1:bIjVDfnllIU7BJ2DNgfnXvpSvtn8VRwhlsaeUTyUS44=
golang.org/x/net v0.23.0/go.mod h1:JKghWKKOSdJwpW2GEx0Ja7fmaKnMsbu+MWVZTokSYmg=
golang.org/x/net v0.25.0/go.mod h1:JkAGAh7GEvH74S6FOH42FLoXpXbE/aqXSrIQjXgsiwM=
golang.org/x/net v0.33.0/go.mod h1:HXLR5J+9DxmrqMwG9qjGCxZ+zKXxBru04zlTvWlWuN4=
golang.org/x/net v0.34.0 h1:Mb7Mrk043xzHgnRM88suvJFwzVrRfHEHJEl5/71CKw0=
golang.org/x/net v0.34.0/go.mod h1:di0qlW3YNM5oh6GqDGQr92MyTozJPmybPK4Ev/Gm31k=
golang.org/x/net v0.35.0 h1:T5GQRQb2y08kTAByq9L4/bz8cipCdA8FbRTXewonqY8=
golang.org/x/net v0.35.0/go.mod h1:EglIi67kWsHKlRzzVMUD93VMSWGFOMSZgxFjparz1Qk=
golang.org/x/oauth2 v0.0.0-20180821212333-d2e6202438be/go.mod h1:N/0e6XlmueqKjAGxoOufVs8QHGRruUQn6yWY3a++T0U=
golang.org/x/oauth2 v0.0.0-20190226205417-e64efc72b421/go.mod h1:gOpvHmFTYa4IltrdGE7lF6nIHvwfUNPOp7c8zoXwtLw=
golang.org/x/oauth2 v0.0.0-20190604053449-0f29369cfe45/go.mod h1:gOpvHmFTYa4IltrdGE7lF6nIHvwfUNPOp7c8zoXwtLw=
+12 -6
View File
@@ -5,6 +5,7 @@ import (
"fmt"
"reflect"
"strings"
"sync"
"sync/atomic"
"unicode"
"unsafe"
@@ -17,22 +18,27 @@ var (
typeAddr *runtime.TypeAddr
cachedDecoderMap unsafe.Pointer // map[uintptr]decoder
cachedDecoder []Decoder
initOnce sync.Once
)
func init() {
typeAddr = runtime.AnalyzeTypeAddr()
if typeAddr == nil {
typeAddr = &runtime.TypeAddr{}
}
cachedDecoder = make([]Decoder, typeAddr.AddrRange>>typeAddr.AddrShift+1)
func initDecoder() {
initOnce.Do(func() {
typeAddr = runtime.AnalyzeTypeAddr()
if typeAddr == nil {
typeAddr = &runtime.TypeAddr{}
}
cachedDecoder = make([]Decoder, typeAddr.AddrRange>>typeAddr.AddrShift+1)
})
}
func loadDecoderMap() map[uintptr]Decoder {
initDecoder()
p := atomic.LoadPointer(&cachedDecoderMap)
return *(*map[uintptr]Decoder)(unsafe.Pointer(&p))
}
func storeDecoder(typ uintptr, dec Decoder, m map[uintptr]Decoder) {
initDecoder()
newDecoderMap := make(map[uintptr]Decoder, len(m)+1)
newDecoderMap[typ] = dec
+1
View File
@@ -10,6 +10,7 @@ import (
)
func CompileToGetDecoder(typ *runtime.Type) (Decoder, error) {
initDecoder()
typeptr := uintptr(unsafe.Pointer(typ))
if typeptr > typeAddr.MaxTypeAddr {
return compileToGetDecoderSlowPath(typeptr, typ)
+1
View File
@@ -13,6 +13,7 @@ import (
var decMu sync.RWMutex
func CompileToGetDecoder(typ *runtime.Type) (Decoder, error) {
initDecoder()
typeptr := uintptr(unsafe.Pointer(typ))
if typeptr > typeAddr.MaxTypeAddr {
return compileToGetDecoderSlowPath(typeptr, typ)
+10 -6
View File
@@ -5,6 +5,7 @@ import (
"encoding"
"encoding/json"
"reflect"
"sync"
"sync/atomic"
"unsafe"
@@ -24,14 +25,17 @@ var (
cachedOpcodeSets []*OpcodeSet
cachedOpcodeMap unsafe.Pointer // map[uintptr]*OpcodeSet
typeAddr *runtime.TypeAddr
initEncoderOnce sync.Once
)
func init() {
typeAddr = runtime.AnalyzeTypeAddr()
if typeAddr == nil {
typeAddr = &runtime.TypeAddr{}
}
cachedOpcodeSets = make([]*OpcodeSet, typeAddr.AddrRange>>typeAddr.AddrShift+1)
func initEncoder() {
initEncoderOnce.Do(func() {
typeAddr = runtime.AnalyzeTypeAddr()
if typeAddr == nil {
typeAddr = &runtime.TypeAddr{}
}
cachedOpcodeSets = make([]*OpcodeSet, typeAddr.AddrRange>>typeAddr.AddrShift+1)
})
}
func loadOpcodeMap() map[uintptr]*OpcodeSet {
+1
View File
@@ -4,6 +4,7 @@
package encoder
func CompileToGetCodeSet(ctx *RuntimeContext, typeptr uintptr) (*OpcodeSet, error) {
initEncoder()
if typeptr > typeAddr.MaxTypeAddr || typeptr < typeAddr.BaseTypeAddr {
codeSet, err := compileToGetCodeSetSlowPath(typeptr)
if err != nil {
+1
View File
@@ -10,6 +10,7 @@ import (
var setsMu sync.RWMutex
func CompileToGetCodeSet(ctx *RuntimeContext, typeptr uintptr) (*OpcodeSet, error) {
initEncoder()
if typeptr > typeAddr.MaxTypeAddr || typeptr < typeAddr.BaseTypeAddr {
codeSet, err := compileToGetCodeSetSlowPath(typeptr)
if err != nil {
+5
View File
@@ -406,6 +406,11 @@ func AppendMarshalJSON(ctx *RuntimeContext, code *Opcode, b []byte, v interface{
rv = newV
}
}
if rv.Kind() == reflect.Ptr && rv.IsNil() {
return AppendNull(ctx, b), nil
}
v = rv.Interface()
var bb []byte
if (code.Flags & MarshalerContextFlags) != 0 {
+53 -55
View File
@@ -2,6 +2,7 @@ package runtime
import (
"reflect"
"sync"
"unsafe"
)
@@ -23,8 +24,8 @@ type TypeAddr struct {
}
var (
typeAddr *TypeAddr
alreadyAnalyzed bool
typeAddr *TypeAddr
once sync.Once
)
//go:linkname typelinks reflect.typelinks
@@ -34,67 +35,64 @@ func typelinks() ([]unsafe.Pointer, [][]int32)
func rtypeOff(unsafe.Pointer, int32) unsafe.Pointer
func AnalyzeTypeAddr() *TypeAddr {
defer func() {
alreadyAnalyzed = true
}()
if alreadyAnalyzed {
return typeAddr
}
sections, offsets := typelinks()
if len(sections) != 1 {
return nil
}
if len(offsets) != 1 {
return nil
}
section := sections[0]
offset := offsets[0]
var (
min uintptr = uintptr(^uint(0))
max uintptr = 0
isAligned64 = true
isAligned32 = true
)
for i := 0; i < len(offset); i++ {
typ := (*Type)(rtypeOff(section, offset[i]))
addr := uintptr(unsafe.Pointer(typ))
if min > addr {
min = addr
once.Do(func() {
sections, offsets := typelinks()
if len(sections) != 1 {
return
}
if max < addr {
max = addr
if len(offsets) != 1 {
return
}
if typ.Kind() == reflect.Ptr {
addr = uintptr(unsafe.Pointer(typ.Elem()))
section := sections[0]
offset := offsets[0]
var (
min uintptr = uintptr(^uint(0))
max uintptr = 0
isAligned64 = true
isAligned32 = true
)
for i := 0; i < len(offset); i++ {
typ := (*Type)(rtypeOff(section, offset[i]))
addr := uintptr(unsafe.Pointer(typ))
if min > addr {
min = addr
}
if max < addr {
max = addr
}
if typ.Kind() == reflect.Ptr {
addr = uintptr(unsafe.Pointer(typ.Elem()))
if min > addr {
min = addr
}
if max < addr {
max = addr
}
}
isAligned64 = isAligned64 && (addr-min)&63 == 0
isAligned32 = isAligned32 && (addr-min)&31 == 0
}
isAligned64 = isAligned64 && (addr-min)&63 == 0
isAligned32 = isAligned32 && (addr-min)&31 == 0
}
addrRange := max - min
if addrRange == 0 {
return nil
}
var addrShift uintptr
if isAligned64 {
addrShift = 6
} else if isAligned32 {
addrShift = 5
}
cacheSize := addrRange >> addrShift
if cacheSize > maxAcceptableTypeAddrRange {
return nil
}
typeAddr = &TypeAddr{
BaseTypeAddr: min,
MaxTypeAddr: max,
AddrRange: addrRange,
AddrShift: addrShift,
}
addrRange := max - min
if addrRange == 0 {
return
}
var addrShift uintptr
if isAligned64 {
addrShift = 6
} else if isAligned32 {
addrShift = 5
}
cacheSize := addrRange >> addrShift
if cacheSize > maxAcceptableTypeAddrRange {
return
}
typeAddr = &TypeAddr{
BaseTypeAddr: min,
MaxTypeAddr: max,
AddrRange: addrRange,
AddrShift: addrShift,
}
})
return typeAddr
}
+1
View File
@@ -281,6 +281,7 @@ Exit Code 1
| AMXBF16 | Tile computational operations on BFLOAT16 numbers |
| AMXINT8 | Tile computational operations on 8-bit integers |
| AMXFP16 | Tile computational operations on FP16 numbers |
| AMXFP8 | Tile computational operations on FP8 numbers |
| AMXTILE | Tile architecture |
| APX_F | Intel APX |
| AVX | AVX functions |
+63 -21
View File
@@ -55,6 +55,12 @@ const (
Qualcomm
Marvell
QEMU
QNX
ACRN
SRE
Apple
lastVendor
)
@@ -75,6 +81,7 @@ const (
AMXBF16 // Tile computational operations on BFLOAT16 numbers
AMXFP16 // Tile computational operations on FP16 numbers
AMXINT8 // Tile computational operations on 8-bit integers
AMXFP8 // Tile computational operations on FP8 numbers
AMXTILE // Tile architecture
APX_F // Intel APX
AVX // AVX functions
@@ -296,20 +303,22 @@ const (
// CPUInfo contains information about the detected system CPU.
type CPUInfo struct {
BrandName string // Brand name reported by the CPU
VendorID Vendor // Comparable CPU vendor ID
VendorString string // Raw vendor string.
featureSet flagSet // Features of the CPU
PhysicalCores int // Number of physical processor cores in your CPU. Will be 0 if undetectable.
ThreadsPerCore int // Number of threads per physical core. Will be 1 if undetectable.
LogicalCores int // Number of physical cores times threads that can run on each core through the use of hyperthreading. Will be 0 if undetectable.
Family int // CPU family number
Model int // CPU model number
Stepping int // CPU stepping info
CacheLine int // Cache line size in bytes. Will be 0 if undetectable.
Hz int64 // Clock speed, if known, 0 otherwise. Will attempt to contain base clock speed.
BoostFreq int64 // Max clock speed, if known, 0 otherwise
Cache struct {
BrandName string // Brand name reported by the CPU
VendorID Vendor // Comparable CPU vendor ID
VendorString string // Raw vendor string.
HypervisorVendorID Vendor // Hypervisor vendor
HypervisorVendorString string // Raw hypervisor vendor string
featureSet flagSet // Features of the CPU
PhysicalCores int // Number of physical processor cores in your CPU. Will be 0 if undetectable.
ThreadsPerCore int // Number of threads per physical core. Will be 1 if undetectable.
LogicalCores int // Number of physical cores times threads that can run on each core through the use of hyperthreading. Will be 0 if undetectable.
Family int // CPU family number
Model int // CPU model number
Stepping int // CPU stepping info
CacheLine int // Cache line size in bytes. Will be 0 if undetectable.
Hz int64 // Clock speed, if known, 0 otherwise. Will attempt to contain base clock speed.
BoostFreq int64 // Max clock speed, if known, 0 otherwise
Cache struct {
L1I int // L1 Instruction Cache (per core or shared). Will be -1 if undetected
L1D int // L1 Data Cache (per core or shared). Will be -1 if undetected
L2 int // L2 Cache (per core or shared). Will be -1 if undetected
@@ -318,8 +327,9 @@ type CPUInfo struct {
SGX SGXSupport
AMDMemEncryption AMDMemEncryptionSupport
AVX10Level uint8
maxFunc uint32
maxExFunc uint32
maxFunc uint32
maxExFunc uint32
}
var cpuid func(op uint32) (eax, ebx, ecx, edx uint32)
@@ -503,7 +513,7 @@ func (c CPUInfo) FeatureSet() []string {
// Uses the RDTSCP instruction. The value 0 is returned
// if the CPU does not support the instruction.
func (c CPUInfo) RTCounter() uint64 {
if !c.Supports(RDTSCP) {
if !c.Has(RDTSCP) {
return 0
}
a, _, _, d := rdtscpAsm()
@@ -515,13 +525,22 @@ func (c CPUInfo) RTCounter() uint64 {
// about the current cpu/core the code is running on.
// If the RDTSCP instruction isn't supported on the CPU, the value 0 is returned.
func (c CPUInfo) Ia32TscAux() uint32 {
if !c.Supports(RDTSCP) {
if !c.Has(RDTSCP) {
return 0
}
_, _, ecx, _ := rdtscpAsm()
return ecx
}
// SveLengths returns arm SVE vector and predicate lengths.
// Will return 0, 0 if SVE is not enabled or otherwise unable to detect.
func (c CPUInfo) SveLengths() (vl, pl uint64) {
if !c.Has(SVE) {
return 0, 0
}
return getVectorLength()
}
// LogicalCPU will return the Logical CPU the code is currently executing on.
// This is likely to change when the OS re-schedules the running thread
// to another CPU.
@@ -781,11 +800,16 @@ func threadsPerCore() int {
_, b, _, _ := cpuidex(0xb, 0)
if b&0xffff == 0 {
if vend == AMD {
// Workaround for AMD returning 0, assume 2 if >= Zen 2
// It will be more correct than not.
// if >= Zen 2 0x8000001e EBX 15-8 bits means threads per core.
// The number of threads per core is ThreadsPerCore+1
// See PPR for AMD Family 17h Models 00h-0Fh (page 82)
fam, _, _ := familyModel()
_, _, _, d := cpuid(1)
if (d&(1<<28)) != 0 && fam >= 23 {
if maxExtendedFunction() >= 0x8000001e {
_, b, _, _ := cpuid(0x8000001e)
return int((b>>8)&0xff) + 1
}
return 2
}
}
@@ -877,7 +901,9 @@ var vendorMapping = map[string]Vendor{
"GenuineTMx86": Transmeta,
"Geode by NSC": NSC,
"VIA VIA VIA ": VIA,
"KVMKVMKVMKVM": KVM,
"KVMKVMKVM": KVM,
"Linux KVM Hv": KVM,
"TCGTCGTCGTCG": QEMU,
"Microsoft Hv": MSVM,
"VMwareVMware": VMware,
"XenVMMXenVMM": XenHVM,
@@ -887,6 +913,10 @@ var vendorMapping = map[string]Vendor{
"SiS SiS SiS ": SiS,
"RiseRiseRise": SiS,
"Genuine RDC": RDC,
"QNXQVMBSQG": QNX,
"ACRNACRNACRN": ACRN,
"SRESRESRESRE": SRE,
"Apple VZ": Apple,
}
func vendorID() (Vendor, string) {
@@ -899,6 +929,17 @@ func vendorID() (Vendor, string) {
return vend, v
}
func hypervisorVendorID() (Vendor, string) {
// https://lwn.net/Articles/301888/
_, b, c, d := cpuid(0x40000000)
v := string(valAsString(b, c, d))
vend, ok := vendorMapping[v]
if !ok {
return VendorUnknown, v
}
return vend, v
}
func cacheLine() int {
if maxFunctionID() < 0x1 {
return 0
@@ -1271,6 +1312,7 @@ func support() flagSet {
fs.setIf(ebx&(1<<31) != 0, AVX512VL)
// ecx
fs.setIf(ecx&(1<<1) != 0, AVX512VBMI)
fs.setIf(ecx&(1<<3) != 0, AMXFP8)
fs.setIf(ecx&(1<<6) != 0, AVX512VBMI2)
fs.setIf(ecx&(1<<11) != 0, AVX512VNNI)
fs.setIf(ecx&(1<<12) != 0, AVX512BITALG)
+10
View File
@@ -24,3 +24,13 @@ TEXT ·getInstAttributes(SB), 7, $0
MOVD R1, instAttrReg1+8(FP)
RET
TEXT ·getVectorLength(SB), 7, $0
WORD $0xd2800002 // mov x2, #0
WORD $0x04225022 // addvl x2, x2, #1
WORD $0xd37df042 // lsl x2, x2, #3
WORD $0xd2800003 // mov x3, #0
WORD $0x04635023 // addpl x3, x3, #1
WORD $0xd37df063 // lsl x3, x3, #3
MOVD R2, vl+0(FP)
MOVD R3, pl+8(FP)
RET
+2 -1
View File
@@ -10,6 +10,7 @@ import "runtime"
func getMidr() (midr uint64)
func getProcFeatures() (procFeatures uint64)
func getInstAttributes() (instAttrReg0, instAttrReg1 uint64)
func getVectorLength() (vl, pl uint64)
func initCPU() {
cpuid = func(uint32) (a, b, c, d uint32) { return 0, 0, 0, 0 }
@@ -24,7 +25,7 @@ func addInfo(c *CPUInfo, safe bool) {
detectOS(c)
// ARM64 disabled since it may crash if interrupt is not intercepted by OS.
if safe && !c.Supports(ARMCPUID) && runtime.GOOS != "freebsd" {
if safe && !c.Has(ARMCPUID) && runtime.GOOS != "freebsd" {
return
}
midr := getMidr()
+2
View File
@@ -10,6 +10,8 @@ func initCPU() {
cpuidex = func(x, y uint32) (a, b, c, d uint32) { return 0, 0, 0, 0 }
xgetbv = func(uint32) (a, b uint32) { return 0, 0 }
rdtscpAsm = func() (a, b, c, d uint32) { return 0, 0, 0, 0 }
}
func addInfo(info *CPUInfo, safe bool) {}
func getVectorLength() (vl, pl uint64) { return 0, 0 }
+3
View File
@@ -32,7 +32,10 @@ func addInfo(c *CPUInfo, safe bool) {
c.LogicalCores = logicalCores()
c.PhysicalCores = physicalCores()
c.VendorID, c.VendorString = vendorID()
c.HypervisorVendorID, c.HypervisorVendorString = hypervisorVendorID()
c.AVX10Level = c.supportAVX10()
c.cacheSize()
c.frequencies()
}
func getVectorLength() (vl, pl uint64) { return 0, 0 }
+223 -217
View File
@@ -15,224 +15,225 @@ func _() {
_ = x[AMXBF16-5]
_ = x[AMXFP16-6]
_ = x[AMXINT8-7]
_ = x[AMXTILE-8]
_ = x[APX_F-9]
_ = x[AVX-10]
_ = x[AVX10-11]
_ = x[AVX10_128-12]
_ = x[AVX10_256-13]
_ = x[AVX10_512-14]
_ = x[AVX2-15]
_ = x[AVX512BF16-16]
_ = x[AVX512BITALG-17]
_ = x[AVX512BW-18]
_ = x[AVX512CD-19]
_ = x[AVX512DQ-20]
_ = x[AVX512ER-21]
_ = x[AVX512F-22]
_ = x[AVX512FP16-23]
_ = x[AVX512IFMA-24]
_ = x[AVX512PF-25]
_ = x[AVX512VBMI-26]
_ = x[AVX512VBMI2-27]
_ = x[AVX512VL-28]
_ = x[AVX512VNNI-29]
_ = x[AVX512VP2INTERSECT-30]
_ = x[AVX512VPOPCNTDQ-31]
_ = x[AVXIFMA-32]
_ = x[AVXNECONVERT-33]
_ = x[AVXSLOW-34]
_ = x[AVXVNNI-35]
_ = x[AVXVNNIINT8-36]
_ = x[AVXVNNIINT16-37]
_ = x[BHI_CTRL-38]
_ = x[BMI1-39]
_ = x[BMI2-40]
_ = x[CETIBT-41]
_ = x[CETSS-42]
_ = x[CLDEMOTE-43]
_ = x[CLMUL-44]
_ = x[CLZERO-45]
_ = x[CMOV-46]
_ = x[CMPCCXADD-47]
_ = x[CMPSB_SCADBS_SHORT-48]
_ = x[CMPXCHG8-49]
_ = x[CPBOOST-50]
_ = x[CPPC-51]
_ = x[CX16-52]
_ = x[EFER_LMSLE_UNS-53]
_ = x[ENQCMD-54]
_ = x[ERMS-55]
_ = x[F16C-56]
_ = x[FLUSH_L1D-57]
_ = x[FMA3-58]
_ = x[FMA4-59]
_ = x[FP128-60]
_ = x[FP256-61]
_ = x[FSRM-62]
_ = x[FXSR-63]
_ = x[FXSROPT-64]
_ = x[GFNI-65]
_ = x[HLE-66]
_ = x[HRESET-67]
_ = x[HTT-68]
_ = x[HWA-69]
_ = x[HYBRID_CPU-70]
_ = x[HYPERVISOR-71]
_ = x[IA32_ARCH_CAP-72]
_ = x[IA32_CORE_CAP-73]
_ = x[IBPB-74]
_ = x[IBPB_BRTYPE-75]
_ = x[IBRS-76]
_ = x[IBRS_PREFERRED-77]
_ = x[IBRS_PROVIDES_SMP-78]
_ = x[IBS-79]
_ = x[IBSBRNTRGT-80]
_ = x[IBSFETCHSAM-81]
_ = x[IBSFFV-82]
_ = x[IBSOPCNT-83]
_ = x[IBSOPCNTEXT-84]
_ = x[IBSOPSAM-85]
_ = x[IBSRDWROPCNT-86]
_ = x[IBSRIPINVALIDCHK-87]
_ = x[IBS_FETCH_CTLX-88]
_ = x[IBS_OPDATA4-89]
_ = x[IBS_OPFUSE-90]
_ = x[IBS_PREVENTHOST-91]
_ = x[IBS_ZEN4-92]
_ = x[IDPRED_CTRL-93]
_ = x[INT_WBINVD-94]
_ = x[INVLPGB-95]
_ = x[KEYLOCKER-96]
_ = x[KEYLOCKERW-97]
_ = x[LAHF-98]
_ = x[LAM-99]
_ = x[LBRVIRT-100]
_ = x[LZCNT-101]
_ = x[MCAOVERFLOW-102]
_ = x[MCDT_NO-103]
_ = x[MCOMMIT-104]
_ = x[MD_CLEAR-105]
_ = x[MMX-106]
_ = x[MMXEXT-107]
_ = x[MOVBE-108]
_ = x[MOVDIR64B-109]
_ = x[MOVDIRI-110]
_ = x[MOVSB_ZL-111]
_ = x[MOVU-112]
_ = x[MPX-113]
_ = x[MSRIRC-114]
_ = x[MSRLIST-115]
_ = x[MSR_PAGEFLUSH-116]
_ = x[NRIPS-117]
_ = x[NX-118]
_ = x[OSXSAVE-119]
_ = x[PCONFIG-120]
_ = x[POPCNT-121]
_ = x[PPIN-122]
_ = x[PREFETCHI-123]
_ = x[PSFD-124]
_ = x[RDPRU-125]
_ = x[RDRAND-126]
_ = x[RDSEED-127]
_ = x[RDTSCP-128]
_ = x[RRSBA_CTRL-129]
_ = x[RTM-130]
_ = x[RTM_ALWAYS_ABORT-131]
_ = x[SBPB-132]
_ = x[SERIALIZE-133]
_ = x[SEV-134]
_ = x[SEV_64BIT-135]
_ = x[SEV_ALTERNATIVE-136]
_ = x[SEV_DEBUGSWAP-137]
_ = x[SEV_ES-138]
_ = x[SEV_RESTRICTED-139]
_ = x[SEV_SNP-140]
_ = x[SGX-141]
_ = x[SGXLC-142]
_ = x[SHA-143]
_ = x[SME-144]
_ = x[SME_COHERENT-145]
_ = x[SPEC_CTRL_SSBD-146]
_ = x[SRBDS_CTRL-147]
_ = x[SRSO_MSR_FIX-148]
_ = x[SRSO_NO-149]
_ = x[SRSO_USER_KERNEL_NO-150]
_ = x[SSE-151]
_ = x[SSE2-152]
_ = x[SSE3-153]
_ = x[SSE4-154]
_ = x[SSE42-155]
_ = x[SSE4A-156]
_ = x[SSSE3-157]
_ = x[STIBP-158]
_ = x[STIBP_ALWAYSON-159]
_ = x[STOSB_SHORT-160]
_ = x[SUCCOR-161]
_ = x[SVM-162]
_ = x[SVMDA-163]
_ = x[SVMFBASID-164]
_ = x[SVML-165]
_ = x[SVMNP-166]
_ = x[SVMPF-167]
_ = x[SVMPFT-168]
_ = x[SYSCALL-169]
_ = x[SYSEE-170]
_ = x[TBM-171]
_ = x[TDX_GUEST-172]
_ = x[TLB_FLUSH_NESTED-173]
_ = x[TME-174]
_ = x[TOPEXT-175]
_ = x[TSCRATEMSR-176]
_ = x[TSXLDTRK-177]
_ = x[VAES-178]
_ = x[VMCBCLEAN-179]
_ = x[VMPL-180]
_ = x[VMSA_REGPROT-181]
_ = x[VMX-182]
_ = x[VPCLMULQDQ-183]
_ = x[VTE-184]
_ = x[WAITPKG-185]
_ = x[WBNOINVD-186]
_ = x[WRMSRNS-187]
_ = x[X87-188]
_ = x[XGETBV1-189]
_ = x[XOP-190]
_ = x[XSAVE-191]
_ = x[XSAVEC-192]
_ = x[XSAVEOPT-193]
_ = x[XSAVES-194]
_ = x[AESARM-195]
_ = x[ARMCPUID-196]
_ = x[ASIMD-197]
_ = x[ASIMDDP-198]
_ = x[ASIMDHP-199]
_ = x[ASIMDRDM-200]
_ = x[ATOMICS-201]
_ = x[CRC32-202]
_ = x[DCPOP-203]
_ = x[EVTSTRM-204]
_ = x[FCMA-205]
_ = x[FP-206]
_ = x[FPHP-207]
_ = x[GPA-208]
_ = x[JSCVT-209]
_ = x[LRCPC-210]
_ = x[PMULL-211]
_ = x[SHA1-212]
_ = x[SHA2-213]
_ = x[SHA3-214]
_ = x[SHA512-215]
_ = x[SM3-216]
_ = x[SM4-217]
_ = x[SVE-218]
_ = x[lastID-219]
_ = x[AMXFP8-8]
_ = x[AMXTILE-9]
_ = x[APX_F-10]
_ = x[AVX-11]
_ = x[AVX10-12]
_ = x[AVX10_128-13]
_ = x[AVX10_256-14]
_ = x[AVX10_512-15]
_ = x[AVX2-16]
_ = x[AVX512BF16-17]
_ = x[AVX512BITALG-18]
_ = x[AVX512BW-19]
_ = x[AVX512CD-20]
_ = x[AVX512DQ-21]
_ = x[AVX512ER-22]
_ = x[AVX512F-23]
_ = x[AVX512FP16-24]
_ = x[AVX512IFMA-25]
_ = x[AVX512PF-26]
_ = x[AVX512VBMI-27]
_ = x[AVX512VBMI2-28]
_ = x[AVX512VL-29]
_ = x[AVX512VNNI-30]
_ = x[AVX512VP2INTERSECT-31]
_ = x[AVX512VPOPCNTDQ-32]
_ = x[AVXIFMA-33]
_ = x[AVXNECONVERT-34]
_ = x[AVXSLOW-35]
_ = x[AVXVNNI-36]
_ = x[AVXVNNIINT8-37]
_ = x[AVXVNNIINT16-38]
_ = x[BHI_CTRL-39]
_ = x[BMI1-40]
_ = x[BMI2-41]
_ = x[CETIBT-42]
_ = x[CETSS-43]
_ = x[CLDEMOTE-44]
_ = x[CLMUL-45]
_ = x[CLZERO-46]
_ = x[CMOV-47]
_ = x[CMPCCXADD-48]
_ = x[CMPSB_SCADBS_SHORT-49]
_ = x[CMPXCHG8-50]
_ = x[CPBOOST-51]
_ = x[CPPC-52]
_ = x[CX16-53]
_ = x[EFER_LMSLE_UNS-54]
_ = x[ENQCMD-55]
_ = x[ERMS-56]
_ = x[F16C-57]
_ = x[FLUSH_L1D-58]
_ = x[FMA3-59]
_ = x[FMA4-60]
_ = x[FP128-61]
_ = x[FP256-62]
_ = x[FSRM-63]
_ = x[FXSR-64]
_ = x[FXSROPT-65]
_ = x[GFNI-66]
_ = x[HLE-67]
_ = x[HRESET-68]
_ = x[HTT-69]
_ = x[HWA-70]
_ = x[HYBRID_CPU-71]
_ = x[HYPERVISOR-72]
_ = x[IA32_ARCH_CAP-73]
_ = x[IA32_CORE_CAP-74]
_ = x[IBPB-75]
_ = x[IBPB_BRTYPE-76]
_ = x[IBRS-77]
_ = x[IBRS_PREFERRED-78]
_ = x[IBRS_PROVIDES_SMP-79]
_ = x[IBS-80]
_ = x[IBSBRNTRGT-81]
_ = x[IBSFETCHSAM-82]
_ = x[IBSFFV-83]
_ = x[IBSOPCNT-84]
_ = x[IBSOPCNTEXT-85]
_ = x[IBSOPSAM-86]
_ = x[IBSRDWROPCNT-87]
_ = x[IBSRIPINVALIDCHK-88]
_ = x[IBS_FETCH_CTLX-89]
_ = x[IBS_OPDATA4-90]
_ = x[IBS_OPFUSE-91]
_ = x[IBS_PREVENTHOST-92]
_ = x[IBS_ZEN4-93]
_ = x[IDPRED_CTRL-94]
_ = x[INT_WBINVD-95]
_ = x[INVLPGB-96]
_ = x[KEYLOCKER-97]
_ = x[KEYLOCKERW-98]
_ = x[LAHF-99]
_ = x[LAM-100]
_ = x[LBRVIRT-101]
_ = x[LZCNT-102]
_ = x[MCAOVERFLOW-103]
_ = x[MCDT_NO-104]
_ = x[MCOMMIT-105]
_ = x[MD_CLEAR-106]
_ = x[MMX-107]
_ = x[MMXEXT-108]
_ = x[MOVBE-109]
_ = x[MOVDIR64B-110]
_ = x[MOVDIRI-111]
_ = x[MOVSB_ZL-112]
_ = x[MOVU-113]
_ = x[MPX-114]
_ = x[MSRIRC-115]
_ = x[MSRLIST-116]
_ = x[MSR_PAGEFLUSH-117]
_ = x[NRIPS-118]
_ = x[NX-119]
_ = x[OSXSAVE-120]
_ = x[PCONFIG-121]
_ = x[POPCNT-122]
_ = x[PPIN-123]
_ = x[PREFETCHI-124]
_ = x[PSFD-125]
_ = x[RDPRU-126]
_ = x[RDRAND-127]
_ = x[RDSEED-128]
_ = x[RDTSCP-129]
_ = x[RRSBA_CTRL-130]
_ = x[RTM-131]
_ = x[RTM_ALWAYS_ABORT-132]
_ = x[SBPB-133]
_ = x[SERIALIZE-134]
_ = x[SEV-135]
_ = x[SEV_64BIT-136]
_ = x[SEV_ALTERNATIVE-137]
_ = x[SEV_DEBUGSWAP-138]
_ = x[SEV_ES-139]
_ = x[SEV_RESTRICTED-140]
_ = x[SEV_SNP-141]
_ = x[SGX-142]
_ = x[SGXLC-143]
_ = x[SHA-144]
_ = x[SME-145]
_ = x[SME_COHERENT-146]
_ = x[SPEC_CTRL_SSBD-147]
_ = x[SRBDS_CTRL-148]
_ = x[SRSO_MSR_FIX-149]
_ = x[SRSO_NO-150]
_ = x[SRSO_USER_KERNEL_NO-151]
_ = x[SSE-152]
_ = x[SSE2-153]
_ = x[SSE3-154]
_ = x[SSE4-155]
_ = x[SSE42-156]
_ = x[SSE4A-157]
_ = x[SSSE3-158]
_ = x[STIBP-159]
_ = x[STIBP_ALWAYSON-160]
_ = x[STOSB_SHORT-161]
_ = x[SUCCOR-162]
_ = x[SVM-163]
_ = x[SVMDA-164]
_ = x[SVMFBASID-165]
_ = x[SVML-166]
_ = x[SVMNP-167]
_ = x[SVMPF-168]
_ = x[SVMPFT-169]
_ = x[SYSCALL-170]
_ = x[SYSEE-171]
_ = x[TBM-172]
_ = x[TDX_GUEST-173]
_ = x[TLB_FLUSH_NESTED-174]
_ = x[TME-175]
_ = x[TOPEXT-176]
_ = x[TSCRATEMSR-177]
_ = x[TSXLDTRK-178]
_ = x[VAES-179]
_ = x[VMCBCLEAN-180]
_ = x[VMPL-181]
_ = x[VMSA_REGPROT-182]
_ = x[VMX-183]
_ = x[VPCLMULQDQ-184]
_ = x[VTE-185]
_ = x[WAITPKG-186]
_ = x[WBNOINVD-187]
_ = x[WRMSRNS-188]
_ = x[X87-189]
_ = x[XGETBV1-190]
_ = x[XOP-191]
_ = x[XSAVE-192]
_ = x[XSAVEC-193]
_ = x[XSAVEOPT-194]
_ = x[XSAVES-195]
_ = x[AESARM-196]
_ = x[ARMCPUID-197]
_ = x[ASIMD-198]
_ = x[ASIMDDP-199]
_ = x[ASIMDHP-200]
_ = x[ASIMDRDM-201]
_ = x[ATOMICS-202]
_ = x[CRC32-203]
_ = x[DCPOP-204]
_ = x[EVTSTRM-205]
_ = x[FCMA-206]
_ = x[FP-207]
_ = x[FPHP-208]
_ = x[GPA-209]
_ = x[JSCVT-210]
_ = x[LRCPC-211]
_ = x[PMULL-212]
_ = x[SHA1-213]
_ = x[SHA2-214]
_ = x[SHA3-215]
_ = x[SHA512-216]
_ = x[SM3-217]
_ = x[SM4-218]
_ = x[SVE-219]
_ = x[lastID-220]
_ = x[firstID-0]
}
const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXTILEAPX_FAVXAVX10AVX10_128AVX10_256AVX10_512AVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8AVXVNNIINT16BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBPB_BRTYPEIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBKEYLOCKERKEYLOCKERWLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSBPBSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSRSO_MSR_FIXSRSO_NOSRSO_USER_KERNEL_NOSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID"
const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXFP8AMXTILEAPX_FAVXAVX10AVX10_128AVX10_256AVX10_512AVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8AVXVNNIINT16BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBPB_BRTYPEIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBKEYLOCKERKEYLOCKERWLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSBPBSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSRSO_MSR_FIXSRSO_NOSRSO_USER_KERNEL_NOSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID"
var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 62, 67, 70, 75, 84, 93, 102, 106, 116, 128, 136, 144, 152, 160, 167, 177, 187, 195, 205, 216, 224, 234, 252, 267, 274, 286, 293, 300, 311, 323, 331, 335, 339, 345, 350, 358, 363, 369, 373, 382, 400, 408, 415, 419, 423, 437, 443, 447, 451, 460, 464, 468, 473, 478, 482, 486, 493, 497, 500, 506, 509, 512, 522, 532, 545, 558, 562, 573, 577, 591, 608, 611, 621, 632, 638, 646, 657, 665, 677, 693, 707, 718, 728, 743, 751, 762, 772, 779, 788, 798, 802, 805, 812, 817, 828, 835, 842, 850, 853, 859, 864, 873, 880, 888, 892, 895, 901, 908, 921, 926, 928, 935, 942, 948, 952, 961, 965, 970, 976, 982, 988, 998, 1001, 1017, 1021, 1030, 1033, 1042, 1057, 1070, 1076, 1090, 1097, 1100, 1105, 1108, 1111, 1123, 1137, 1147, 1159, 1166, 1185, 1188, 1192, 1196, 1200, 1205, 1210, 1215, 1220, 1234, 1245, 1251, 1254, 1259, 1268, 1272, 1277, 1282, 1288, 1295, 1300, 1303, 1312, 1328, 1331, 1337, 1347, 1355, 1359, 1368, 1372, 1384, 1387, 1397, 1400, 1407, 1415, 1422, 1425, 1432, 1435, 1440, 1446, 1454, 1460, 1466, 1474, 1479, 1486, 1493, 1501, 1508, 1513, 1518, 1525, 1529, 1531, 1535, 1538, 1543, 1548, 1553, 1557, 1561, 1565, 1571, 1574, 1577, 1580, 1586}
var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 61, 68, 73, 76, 81, 90, 99, 108, 112, 122, 134, 142, 150, 158, 166, 173, 183, 193, 201, 211, 222, 230, 240, 258, 273, 280, 292, 299, 306, 317, 329, 337, 341, 345, 351, 356, 364, 369, 375, 379, 388, 406, 414, 421, 425, 429, 443, 449, 453, 457, 466, 470, 474, 479, 484, 488, 492, 499, 503, 506, 512, 515, 518, 528, 538, 551, 564, 568, 579, 583, 597, 614, 617, 627, 638, 644, 652, 663, 671, 683, 699, 713, 724, 734, 749, 757, 768, 778, 785, 794, 804, 808, 811, 818, 823, 834, 841, 848, 856, 859, 865, 870, 879, 886, 894, 898, 901, 907, 914, 927, 932, 934, 941, 948, 954, 958, 967, 971, 976, 982, 988, 994, 1004, 1007, 1023, 1027, 1036, 1039, 1048, 1063, 1076, 1082, 1096, 1103, 1106, 1111, 1114, 1117, 1129, 1143, 1153, 1165, 1172, 1191, 1194, 1198, 1202, 1206, 1211, 1216, 1221, 1226, 1240, 1251, 1257, 1260, 1265, 1274, 1278, 1283, 1288, 1294, 1301, 1306, 1309, 1318, 1334, 1337, 1343, 1353, 1361, 1365, 1374, 1378, 1390, 1393, 1403, 1406, 1413, 1421, 1428, 1431, 1438, 1441, 1446, 1452, 1460, 1466, 1472, 1480, 1485, 1492, 1499, 1507, 1514, 1519, 1524, 1531, 1535, 1537, 1541, 1544, 1549, 1554, 1559, 1563, 1567, 1571, 1577, 1580, 1583, 1586, 1592}
func (i FeatureID) String() string {
if i < 0 || i >= FeatureID(len(_FeatureID_index)-1) {
@@ -270,12 +271,17 @@ func _() {
_ = x[AMCC-23]
_ = x[Qualcomm-24]
_ = x[Marvell-25]
_ = x[lastVendor-26]
_ = x[QEMU-26]
_ = x[QNX-27]
_ = x[ACRN-28]
_ = x[SRE-29]
_ = x[Apple-30]
_ = x[lastVendor-31]
}
const _Vendor_name = "VendorUnknownIntelAMDVIATransmetaNSCKVMMSVMVMwareXenHVMBhyveHygonSiSRDCAmpereARMBroadcomCaviumDECFujitsuInfineonMotorolaNVIDIAAMCCQualcommMarvelllastVendor"
const _Vendor_name = "VendorUnknownIntelAMDVIATransmetaNSCKVMMSVMVMwareXenHVMBhyveHygonSiSRDCAmpereARMBroadcomCaviumDECFujitsuInfineonMotorolaNVIDIAAMCCQualcommMarvellQEMUQNXACRNSREApplelastVendor"
var _Vendor_index = [...]uint8{0, 13, 18, 21, 24, 33, 36, 39, 43, 49, 55, 60, 65, 68, 71, 77, 80, 88, 94, 97, 104, 112, 120, 126, 130, 138, 145, 155}
var _Vendor_index = [...]uint8{0, 13, 18, 21, 24, 33, 36, 39, 43, 49, 55, 60, 65, 68, 71, 77, 80, 88, 94, 97, 104, 112, 120, 126, 130, 138, 145, 149, 152, 156, 159, 164, 174}
func (i Vendor) String() string {
if i < 0 || i >= Vendor(len(_Vendor_index)-1) {
+202
View File
@@ -0,0 +1,202 @@
Apache License
Version 2.0, January 2004
http://www.apache.org/licenses/
TERMS AND CONDITIONS FOR USE, REPRODUCTION, AND DISTRIBUTION
1. Definitions.
"License" shall mean the terms and conditions for use, reproduction,
and distribution as defined by Sections 1 through 9 of this document.
"Licensor" shall mean the copyright owner or entity authorized by
the copyright owner that is granting the License.
"Legal Entity" shall mean the union of the acting entity and all
other entities that control, are controlled by, or are under common
control with that entity. For the purposes of this definition,
"control" means (i) the power, direct or indirect, to cause the
direction or management of such entity, whether by contract or
otherwise, or (ii) ownership of fifty percent (50%) or more of the
outstanding shares, or (iii) beneficial ownership of such entity.
"You" (or "Your") shall mean an individual or Legal Entity
exercising permissions granted by this License.
"Source" form shall mean the preferred form for making modifications,
including but not limited to software source code, documentation
source, and configuration files.
"Object" form shall mean any form resulting from mechanical
transformation or translation of a Source form, including but
not limited to compiled object code, generated documentation,
and conversions to other media types.
"Work" shall mean the work of authorship, whether in Source or
Object form, made available under the License, as indicated by a
copyright notice that is included in or attached to the work
(an example is provided in the Appendix below).
"Derivative Works" shall mean any work, whether in Source or Object
form, that is based on (or derived from) the Work and for which the
editorial revisions, annotations, elaborations, or other modifications
represent, as a whole, an original work of authorship. For the purposes
of this License, Derivative Works shall not include works that remain
separable from, or merely link (or bind by name) to the interfaces of,
the Work and Derivative Works thereof.
"Contribution" shall mean any work of authorship, including
the original version of the Work and any modifications or additions
to that Work or Derivative Works thereof, that is intentionally
submitted to Licensor for inclusion in the Work by the copyright owner
or by an individual or Legal Entity authorized to submit on behalf of
the copyright owner. For the purposes of this definition, "submitted"
means any form of electronic, verbal, or written communication sent
to the Licensor or its representatives, including but not limited to
communication on electronic mailing lists, source code control systems,
and issue tracking systems that are managed by, or on behalf of, the
Licensor for the purpose of discussing and improving the Work, but
excluding communication that is conspicuously marked or otherwise
designated in writing by the copyright owner as "Not a Contribution."
"Contributor" shall mean Licensor and any individual or Legal Entity
on behalf of whom a Contribution has been received by Licensor and
subsequently incorporated within the Work.
2. Grant of Copyright License. Subject to the terms and conditions of
this License, each Contributor hereby grants to You a perpetual,
worldwide, non-exclusive, no-charge, royalty-free, irrevocable
copyright license to reproduce, prepare Derivative Works of,
publicly display, publicly perform, sublicense, and distribute the
Work and such Derivative Works in Source or Object form.
3. Grant of Patent License. Subject to the terms and conditions of
this License, each Contributor hereby grants to You a perpetual,
worldwide, non-exclusive, no-charge, royalty-free, irrevocable
(except as stated in this section) patent license to make, have made,
use, offer to sell, sell, import, and otherwise transfer the Work,
where such license applies only to those patent claims licensable
by such Contributor that are necessarily infringed by their
Contribution(s) alone or by combination of their Contribution(s)
with the Work to which such Contribution(s) was submitted. If You
institute patent litigation against any entity (including a
cross-claim or counterclaim in a lawsuit) alleging that the Work
or a Contribution incorporated within the Work constitutes direct
or contributory patent infringement, then any patent licenses
granted to You under this License for that Work shall terminate
as of the date such litigation is filed.
4. Redistribution. You may reproduce and distribute copies of the
Work or Derivative Works thereof in any medium, with or without
modifications, and in Source or Object form, provided that You
meet the following conditions:
(a) You must give any other recipients of the Work or
Derivative Works a copy of this License; and
(b) You must cause any modified files to carry prominent notices
stating that You changed the files; and
(c) You must retain, in the Source form of any Derivative Works
that You distribute, all copyright, patent, trademark, and
attribution notices from the Source form of the Work,
excluding those notices that do not pertain to any part of
the Derivative Works; and
(d) If the Work includes a "NOTICE" text file as part of its
distribution, then any Derivative Works that You distribute must
include a readable copy of the attribution notices contained
within such NOTICE file, excluding those notices that do not
pertain to any part of the Derivative Works, in at least one
of the following places: within a NOTICE text file distributed
as part of the Derivative Works; within the Source form or
documentation, if provided along with the Derivative Works; or,
within a display generated by the Derivative Works, if and
wherever such third-party notices normally appear. The contents
of the NOTICE file are for informational purposes only and
do not modify the License. You may add Your own attribution
notices within Derivative Works that You distribute, alongside
or as an addendum to the NOTICE text from the Work, provided
that such additional attribution notices cannot be construed
as modifying the License.
You may add Your own copyright statement to Your modifications and
may provide additional or different license terms and conditions
for use, reproduction, or distribution of Your modifications, or
for any such Derivative Works as a whole, provided Your use,
reproduction, and distribution of the Work otherwise complies with
the conditions stated in this License.
5. Submission of Contributions. Unless You explicitly state otherwise,
any Contribution intentionally submitted for inclusion in the Work
by You to the Licensor shall be under the terms and conditions of
this License, without any additional terms or conditions.
Notwithstanding the above, nothing herein shall supersede or modify
the terms of any separate license agreement you may have executed
with Licensor regarding such Contributions.
6. Trademarks. This License does not grant permission to use the trade
names, trademarks, service marks, or product names of the Licensor,
except as required for reasonable and customary use in describing the
origin of the Work and reproducing the content of the NOTICE file.
7. Disclaimer of Warranty. Unless required by applicable law or
agreed to in writing, Licensor provides the Work (and each
Contributor provides its Contributions) on an "AS IS" BASIS,
WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or
implied, including, without limitation, any warranties or conditions
of TITLE, NON-INFRINGEMENT, MERCHANTABILITY, or FITNESS FOR A
PARTICULAR PURPOSE. You are solely responsible for determining the
appropriateness of using or redistributing the Work and assume any
risks associated with Your exercise of permissions under this License.
8. Limitation of Liability. In no event and under no legal theory,
whether in tort (including negligence), contract, or otherwise,
unless required by applicable law (such as deliberate and grossly
negligent acts) or agreed to in writing, shall any Contributor be
liable to You for damages, including any direct, indirect, special,
incidental, or consequential damages of any character arising as a
result of this License or out of the use or inability to use the
Work (including but not limited to damages for loss of goodwill,
work stoppage, computer failure or malfunction, or any and all
other commercial damages or losses), even if such Contributor
has been advised of the possibility of such damages.
9. Accepting Warranty or Additional Liability. While redistributing
the Work or Derivative Works thereof, You may choose to offer,
and charge a fee for, acceptance of support, warranty, indemnity,
or other liability obligations and/or rights consistent with this
License. However, in accepting such obligations, You may act only
on Your own behalf and on Your sole responsibility, not on behalf
of any other Contributor, and only if You agree to indemnify,
defend, and hold each Contributor harmless for any liability
incurred by, or claims asserted against, such Contributor by reason
of your accepting any such warranty or additional liability.
END OF TERMS AND CONDITIONS
APPENDIX: How to apply the Apache License to your work.
To apply the Apache License to your work, attach the following
boilerplate notice, with the fields enclosed by brackets "[]"
replaced with your own identifying information. (Don't include
the brackets!) The text should be enclosed in the appropriate
comment syntax for the file format. We also recommend that a
file or class name and description of purpose be included on the
same "printed page" as the copyright notice for easier
identification within third-party archives.
Copyright [yyyy] [name of copyright owner]
Licensed under the Apache License, Version 2.0 (the "License");
you may not use this file except in compliance with the License.
You may obtain a copy of the License at
http://www.apache.org/licenses/LICENSE-2.0
Unless required by applicable law or agreed to in writing, software
distributed under the License is distributed on an "AS IS" BASIS,
WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
See the License for the specific language governing permissions and
limitations under the License.
+20
View File
@@ -0,0 +1,20 @@
## crc64nvme
This Golang package calculates CRC64 checksums using carryless-multiplication accelerated with SIMD instructions for both ARM and x86. It is based on the NVME polynomial as specified in the [NVM Express® NVM Command Set Specification](https://nvmexpress.org/wp-content/uploads/NVM-Express-NVM-Command-Set-Specification-1.0d-2023.12.28-Ratified.pdf).
The code is based on the [crc64fast-nvme](https://github.com/awesomized/crc64fast-nvme.git) package in Rust and is released under the Apache 2.0 license.
For more background on the exact technique used, see this [Fast CRC Computation for Generic Polynomials Using PCLMULQDQ Instruction](https://web.archive.org/web/20131224125630/https://www.intel.com/content/dam/www/public/us/en/documents/white-papers/fast-crc-computation-generic-polynomials-pclmulqdq-paper.pdf) paper.
### Performance
To follow.
### Requirements
All Go versions >= 1.22 are supported.
### Contributing
Contributions are welcome, please send PRs for any enhancements.
+180
View File
@@ -0,0 +1,180 @@
// Copyright (c) 2025 Minio Inc. All rights reserved.
// Use of this source code is governed by a license that can be
// found in the LICENSE file.
// Package crc64nvme implements the 64-bit cyclic redundancy check with NVME polynomial.
package crc64nvme
import (
"encoding/binary"
"errors"
"hash"
"sync"
"unsafe"
)
const (
// The size of a CRC-64 checksum in bytes.
Size = 8
// The NVME polynoimial (reversed, as used by Go)
NVME = 0x9a6c9329ac4bc9b5
)
var (
// precalculated table.
nvmeTable = makeTable(NVME)
)
// table is a 256-word table representing the polynomial for efficient processing.
type table [256]uint64
var (
slicing8TablesBuildOnce sync.Once
slicing8TableNVME *[8]table
)
func buildSlicing8TablesOnce() {
slicing8TablesBuildOnce.Do(buildSlicing8Tables)
}
func buildSlicing8Tables() {
slicing8TableNVME = makeSlicingBy8Table(makeTable(NVME))
}
func makeTable(poly uint64) *table {
t := new(table)
for i := 0; i < 256; i++ {
crc := uint64(i)
for j := 0; j < 8; j++ {
if crc&1 == 1 {
crc = (crc >> 1) ^ poly
} else {
crc >>= 1
}
}
t[i] = crc
}
return t
}
func makeSlicingBy8Table(t *table) *[8]table {
var helperTable [8]table
helperTable[0] = *t
for i := 0; i < 256; i++ {
crc := t[i]
for j := 1; j < 8; j++ {
crc = t[crc&0xff] ^ (crc >> 8)
helperTable[j][i] = crc
}
}
return &helperTable
}
// digest represents the partial evaluation of a checksum.
type digest struct {
crc uint64
}
// New creates a new hash.Hash64 computing the CRC-64 checksum using the
// NVME polynomial. Its Sum method will lay the
// value out in big-endian byte order. The returned Hash64 also
// implements [encoding.BinaryMarshaler] and [encoding.BinaryUnmarshaler] to
// marshal and unmarshal the internal state of the hash.
func New() hash.Hash64 { return &digest{0} }
func (d *digest) Size() int { return Size }
func (d *digest) BlockSize() int { return 1 }
func (d *digest) Reset() { d.crc = 0 }
const (
magic = "crc\x02"
marshaledSize = len(magic) + 8 + 8
)
func (d *digest) MarshalBinary() ([]byte, error) {
b := make([]byte, 0, marshaledSize)
b = append(b, magic...)
b = binary.BigEndian.AppendUint64(b, tableSum)
b = binary.BigEndian.AppendUint64(b, d.crc)
return b, nil
}
func (d *digest) UnmarshalBinary(b []byte) error {
if len(b) < len(magic) || string(b[:len(magic)]) != magic {
return errors.New("hash/crc64: invalid hash state identifier")
}
if len(b) != marshaledSize {
return errors.New("hash/crc64: invalid hash state size")
}
if tableSum != binary.BigEndian.Uint64(b[4:]) {
return errors.New("hash/crc64: tables do not match")
}
d.crc = binary.BigEndian.Uint64(b[12:])
return nil
}
func update(crc uint64, p []byte) uint64 {
if hasAsm && len(p) > 127 {
ptr := unsafe.Pointer(&p[0])
if align := (uintptr(ptr)+15)&^0xf - uintptr(ptr); align > 0 {
// Align to 16-byte boundary.
crc = update(crc, p[:align])
p = p[align:]
}
runs := len(p) / 128
crc = updateAsm(crc, p[:128*runs])
return update(crc, p[128*runs:])
}
buildSlicing8TablesOnce()
crc = ^crc
// table comparison is somewhat expensive, so avoid it for small sizes
for len(p) >= 64 {
var helperTable = slicing8TableNVME
// Update using slicing-by-8
for len(p) > 8 {
crc ^= binary.LittleEndian.Uint64(p)
crc = helperTable[7][crc&0xff] ^
helperTable[6][(crc>>8)&0xff] ^
helperTable[5][(crc>>16)&0xff] ^
helperTable[4][(crc>>24)&0xff] ^
helperTable[3][(crc>>32)&0xff] ^
helperTable[2][(crc>>40)&0xff] ^
helperTable[1][(crc>>48)&0xff] ^
helperTable[0][crc>>56]
p = p[8:]
}
}
// For reminders or small sizes
for _, v := range p {
crc = nvmeTable[byte(crc)^v] ^ (crc >> 8)
}
return ^crc
}
// Update returns the result of adding the bytes in p to the crc.
func Update(crc uint64, p []byte) uint64 {
return update(crc, p)
}
func (d *digest) Write(p []byte) (n int, err error) {
d.crc = update(d.crc, p)
return len(p), nil
}
func (d *digest) Sum64() uint64 { return d.crc }
func (d *digest) Sum(in []byte) []byte {
s := d.Sum64()
return append(in, byte(s>>56), byte(s>>48), byte(s>>40), byte(s>>32), byte(s>>24), byte(s>>16), byte(s>>8), byte(s))
}
// Checksum returns the CRC-64 checksum of data
// using the NVME polynomial.
func Checksum(data []byte) uint64 { return update(0, data) }
// ISO tablesum of NVME poly
const tableSum = 0x8ddd9ee4402c7163
+15
View File
@@ -0,0 +1,15 @@
// Copyright (c) 2025 Minio Inc. All rights reserved.
// Use of this source code is governed by a license that can be
// found in the LICENSE file.
//go:build !noasm && !appengine && !gccgo
package crc64nvme
import (
"github.com/klauspost/cpuid/v2"
)
var hasAsm = cpuid.CPU.Supports(cpuid.SSE2, cpuid.CLMUL, cpuid.SSE4)
func updateAsm(crc uint64, p []byte) (checksum uint64)
+157
View File
@@ -0,0 +1,157 @@
// Copyright (c) 2025 Minio Inc. All rights reserved.
// Use of this source code is governed by a license that can be
// found in the LICENSE file.
//go:build !noasm && !appengine && !gccgo
#include "textflag.h"
TEXT ·updateAsm(SB), $0-40
MOVQ crc+0(FP), AX // checksum
MOVQ p_base+8(FP), SI // start pointer
MOVQ p_len+16(FP), CX // length of buffer
NOTQ AX
SHRQ $7, CX
CMPQ CX, $1
JLT skip128
VMOVDQA 0x00(SI), X0
VMOVDQA 0x10(SI), X1
VMOVDQA 0x20(SI), X2
VMOVDQA 0x30(SI), X3
VMOVDQA 0x40(SI), X4
VMOVDQA 0x50(SI), X5
VMOVDQA 0x60(SI), X6
VMOVDQA 0x70(SI), X7
MOVQ AX, X8
PXOR X8, X0
CMPQ CX, $1
JE tail128
MOVQ $0xa1ca681e733f9c40, AX
MOVQ AX, X8
MOVQ $0x5f852fb61e8d92dc, AX
PINSRQ $0x1, AX, X9
loop128:
ADDQ $128, SI
SUBQ $1, CX
VMOVDQA X0, X10
PCLMULQDQ $0x00, X8, X10
PCLMULQDQ $0x11, X9, X0
PXOR X10, X0
PXOR 0(SI), X0
VMOVDQA X1, X10
PCLMULQDQ $0x00, X8, X10
PCLMULQDQ $0x11, X9, X1
PXOR X10, X1
PXOR 0x10(SI), X1
VMOVDQA X2, X10
PCLMULQDQ $0x00, X8, X10
PCLMULQDQ $0x11, X9, X2
PXOR X10, X2
PXOR 0x20(SI), X2
VMOVDQA X3, X10
PCLMULQDQ $0x00, X8, X10
PCLMULQDQ $0x11, X9, X3
PXOR X10, X3
PXOR 0x30(SI), X3
VMOVDQA X4, X10
PCLMULQDQ $0x00, X8, X10
PCLMULQDQ $0x11, X9, X4
PXOR X10, X4
PXOR 0x40(SI), X4
VMOVDQA X5, X10
PCLMULQDQ $0x00, X8, X10
PCLMULQDQ $0x11, X9, X5
PXOR X10, X5
PXOR 0x50(SI), X5
VMOVDQA X6, X10
PCLMULQDQ $0x00, X8, X10
PCLMULQDQ $0x11, X9, X6
PXOR X10, X6
PXOR 0x60(SI), X6
VMOVDQA X7, X10
PCLMULQDQ $0x00, X8, X10
PCLMULQDQ $0x11, X9, X7
PXOR X10, X7
PXOR 0x70(SI), X7
CMPQ CX, $1
JGT loop128
tail128:
MOVQ $0xd083dd594d96319d, AX
MOVQ AX, X11
PCLMULQDQ $0x00, X0, X11
MOVQ $0x946588403d4adcbc, AX
PINSRQ $0x1, AX, X12
PCLMULQDQ $0x11, X12, X0
PXOR X11, X7
PXOR X0, X7
MOVQ $0x3c255f5ebc414423, AX
MOVQ AX, X11
PCLMULQDQ $0x00, X1, X11
MOVQ $0x34f5a24e22d66e90, AX
PINSRQ $0x1, AX, X12
PCLMULQDQ $0x11, X12, X1
PXOR X11, X1
PXOR X7, X1
MOVQ $0x7b0ab10dd0f809fe, AX
MOVQ AX, X11
PCLMULQDQ $0x00, X2, X11
MOVQ $0x03363823e6e791e5, AX
PINSRQ $0x1, AX, X12
PCLMULQDQ $0x11, X12, X2
PXOR X11, X2
PXOR X1, X2
MOVQ $0x0c32cdb31e18a84a, AX
MOVQ AX, X11
PCLMULQDQ $0x00, X3, X11
MOVQ $0x62242240ace5045a, AX
PINSRQ $0x1, AX, X12
PCLMULQDQ $0x11, X12, X3
PXOR X11, X3
PXOR X2, X3
MOVQ $0xbdd7ac0ee1a4a0f0, AX
MOVQ AX, X11
PCLMULQDQ $0x00, X4, X11
MOVQ $0xa3ffdc1fe8e82a8b, AX
PINSRQ $0x1, AX, X12
PCLMULQDQ $0x11, X12, X4
PXOR X11, X4
PXOR X3, X4
MOVQ $0xb0bc2e589204f500, AX
MOVQ AX, X11
PCLMULQDQ $0x00, X5, X11
MOVQ $0xe1e0bb9d45d7a44c, AX
PINSRQ $0x1, AX, X12
PCLMULQDQ $0x11, X12, X5
PXOR X11, X5
PXOR X4, X5
MOVQ $0xeadc41fd2ba3d420, AX
MOVQ AX, X11
PCLMULQDQ $0x00, X6, X11
MOVQ $0x21e9761e252621ac, AX
PINSRQ $0x1, AX, X12
PCLMULQDQ $0x11, X12, X6
PXOR X11, X6
PXOR X5, X6
MOVQ AX, X5
PCLMULQDQ $0x00, X6, X5
PSHUFD $0xee, X6, X6
PXOR X5, X6
MOVQ $0x27ecfa329aef9f77, AX
MOVQ AX, X4
PCLMULQDQ $0x00, X4, X6
PEXTRQ $0, X6, BX
MOVQ $0x34d926535897936b, AX
MOVQ AX, X4
PCLMULQDQ $0x00, X4, X6
PXOR X5, X6
PEXTRQ $1, X6, AX
XORQ BX, AX
skip128:
NOTQ AX
MOVQ AX, checksum+32(FP)
RET
+15
View File
@@ -0,0 +1,15 @@
// Copyright (c) 2025 Minio Inc. All rights reserved.
// Use of this source code is governed by a license that can be
// found in the LICENSE file.
//go:build !noasm && !appengine && !gccgo
package crc64nvme
import (
"github.com/klauspost/cpuid/v2"
)
var hasAsm = cpuid.CPU.Supports(cpuid.ASIMD) && cpuid.CPU.Supports(cpuid.PMULL)
func updateAsm(crc uint64, p []byte) (checksum uint64)
+157
View File
@@ -0,0 +1,157 @@
// Copyright (c) 2025 Minio Inc. All rights reserved.
// Use of this source code is governed by a license that can be
// found in the LICENSE file.
//go:build !noasm && !appengine && !gccgo
#include "textflag.h"
TEXT ·updateAsm(SB), $0-40
MOVD crc+0(FP), R0 // checksum
MOVD p_base+8(FP), R1 // start pointer
MOVD p_len+16(FP), R2 // length of buffer
MOVD $·const(SB), R3 // constants
MVN R0, R0
LSR $7, R2, R2
CMP $1, R2
BLT skip128
FLDPQ (R1), (F0, F1)
FLDPQ 32(R1), (F2, F3)
FLDPQ 64(R1), (F4, F5)
FLDPQ 96(R1), (F6, F7)
FMOVD R0, F8
VMOVI $0, V9.B16
VMOV V9.D[0], V8.D[1]
VEOR V8.B16, V0.B16, V0.B16
CMP $1, R2
BEQ tail128
MOVD 112(R3), R4
MOVD 120(R3), R5
FMOVD R4, F8
VDUP R5, V9.D2
loop128:
ADD $128, R1, R1
SUB $1, R2, R2
VPMULL V0.D1, V8.D1, V10.Q1
VPMULL2 V0.D2, V9.D2, V0.Q1
FLDPQ (R1), (F11, F12)
VEOR3 V0.B16, V11.B16, V10.B16, V0.B16
VPMULL V1.D1, V8.D1, V10.Q1
VPMULL2 V1.D2, V9.D2, V1.Q1
VEOR3 V1.B16, V12.B16, V10.B16, V1.B16
VPMULL V2.D1, V8.D1, V10.Q1
VPMULL2 V2.D2, V9.D2, V2.Q1
FLDPQ 32(R1), (F11, F12)
VEOR3 V2.B16, V11.B16, V10.B16, V2.B16
VPMULL V3.D1, V8.D1, V10.Q1
VPMULL2 V3.D2, V9.D2, V3.Q1
VEOR3 V3.B16, V12.B16, V10.B16, V3.B16
VPMULL V4.D1, V8.D1, V10.Q1
VPMULL2 V4.D2, V9.D2, V4.Q1
FLDPQ 64(R1), (F11, F12)
VEOR3 V4.B16, V11.B16, V10.B16, V4.B16
VPMULL V5.D1, V8.D1, V10.Q1
VPMULL2 V5.D2, V9.D2, V5.Q1
VEOR3 V5.B16, V12.B16, V10.B16, V5.B16
VPMULL V6.D1, V8.D1, V10.Q1
VPMULL2 V6.D2, V9.D2, V6.Q1
FLDPQ 96(R1), (F11, F12)
VEOR3 V6.B16, V11.B16, V10.B16, V6.B16
VPMULL V7.D1, V8.D1, V10.Q1
VPMULL2 V7.D2, V9.D2, V7.Q1
VEOR3 V7.B16, V12.B16, V10.B16, V7.B16
CMP $1, R2
BHI loop128
tail128:
MOVD (R3), R4
FMOVD R4, F11
VPMULL V0.D1, V11.D1, V11.Q1
MOVD 8(R3), R4
VDUP R4, V12.D2
VPMULL2 V0.D2, V12.D2, V0.Q1
VEOR3 V0.B16, V7.B16, V11.B16, V7.B16
MOVD 16(R3), R4
FMOVD R4, F11
VPMULL V1.D1, V11.D1, V11.Q1
MOVD 24(R3), R4
VDUP R4, V12.D2
VPMULL2 V1.D2, V12.D2, V1.Q1
VEOR3 V1.B16, V11.B16, V7.B16, V1.B16
MOVD 32(R3), R4
FMOVD R4, F11
VPMULL V2.D1, V11.D1, V11.Q1
MOVD 40(R3), R4
VDUP R4, V12.D2
VPMULL2 V2.D2, V12.D2, V2.Q1
VEOR3 V2.B16, V11.B16, V1.B16, V2.B16
MOVD 48(R3), R4
FMOVD R4, F11
VPMULL V3.D1, V11.D1, V11.Q1
MOVD 56(R3), R4
VDUP R4, V12.D2
VPMULL2 V3.D2, V12.D2, V3.Q1
VEOR3 V3.B16, V11.B16, V2.B16, V3.B16
MOVD 64(R3), R4
FMOVD R4, F11
VPMULL V4.D1, V11.D1, V11.Q1
MOVD 72(R3), R4
VDUP R4, V12.D2
VPMULL2 V4.D2, V12.D2, V4.Q1
VEOR3 V4.B16, V11.B16, V3.B16, V4.B16
MOVD 80(R3), R4
FMOVD R4, F11
VPMULL V5.D1, V11.D1, V11.Q1
MOVD 88(R3), R4
VDUP R4, V12.D2
VPMULL2 V5.D2, V12.D2, V5.Q1
VEOR3 V5.B16, V11.B16, V4.B16, V5.B16
MOVD 96(R3), R4
FMOVD R4, F11
VPMULL V6.D1, V11.D1, V11.Q1
MOVD 104(R3), R4
VDUP R4, V12.D2
VPMULL2 V6.D2, V12.D2, V6.Q1
VEOR3 V6.B16, V11.B16, V5.B16, V6.B16
FMOVD R4, F5
VPMULL V6.D1, V5.D1, V5.Q1
VDUP V6.D[1], V6.D2
VEOR V5.B8, V6.B8, V6.B8
MOVD 128(R3), R4
FMOVD R4, F4
VPMULL V4.D1, V6.D1, V6.Q1
FMOVD F6, R4
MOVD 136(R3), R5
FMOVD R5, F4
VPMULL V4.D1, V6.D1, V6.Q1
VEOR V6.B16, V5.B16, V6.B16
VMOV V6.D[1], R5
EOR R4, R5, R0
skip128:
MVN R0, R0
MOVD R0, checksum+32(FP)
RET
DATA ·const+0x000(SB)/8, $0xd083dd594d96319d // K_959
DATA ·const+0x008(SB)/8, $0x946588403d4adcbc // K_895
DATA ·const+0x010(SB)/8, $0x3c255f5ebc414423 // K_831
DATA ·const+0x018(SB)/8, $0x34f5a24e22d66e90 // K_767
DATA ·const+0x020(SB)/8, $0x7b0ab10dd0f809fe // K_703
DATA ·const+0x028(SB)/8, $0x03363823e6e791e5 // K_639
DATA ·const+0x030(SB)/8, $0x0c32cdb31e18a84a // K_575
DATA ·const+0x038(SB)/8, $0x62242240ace5045a // K_511
DATA ·const+0x040(SB)/8, $0xbdd7ac0ee1a4a0f0 // K_447
DATA ·const+0x048(SB)/8, $0xa3ffdc1fe8e82a8b // K_383
DATA ·const+0x050(SB)/8, $0xb0bc2e589204f500 // K_319
DATA ·const+0x058(SB)/8, $0xe1e0bb9d45d7a44c // K_255
DATA ·const+0x060(SB)/8, $0xeadc41fd2ba3d420 // K_191
DATA ·const+0x068(SB)/8, $0x21e9761e252621ac // K_127
DATA ·const+0x070(SB)/8, $0xa1ca681e733f9c40 // K_1087
DATA ·const+0x078(SB)/8, $0x5f852fb61e8d92dc // K_1023
DATA ·const+0x080(SB)/8, $0x27ecfa329aef9f77 // MU
DATA ·const+0x088(SB)/8, $0x34d926535897936b // POLY
GLOBL ·const(SB), (NOPTR+RODATA), $144
+11
View File
@@ -0,0 +1,11 @@
// Copyright (c) 2025 Minio Inc. All rights reserved.
// Use of this source code is governed by a license that can be
// found in the LICENSE file.
//go:build (!amd64 || noasm || appengine || gccgo) && (!arm64 || noasm || appengine || gccgo)
package crc64nvme
var hasAsm = false
func updateAsm(crc uint64, p []byte) (checksum uint64) { panic("should not be reached") }
+1 -1
View File
@@ -253,7 +253,7 @@ The full API Reference is available here.
* [setbucketencryption.go](https://github.com/minio/minio-go/blob/master/examples/s3/setbucketencryption.go)
* [getbucketencryption.go](https://github.com/minio/minio-go/blob/master/examples/s3/getbucketencryption.go)
* [deletebucketencryption.go](https://github.com/minio/minio-go/blob/master/examples/s3/deletebucketencryption.go)
* [removebucketencryption.go](https://github.com/minio/minio-go/blob/master/examples/s3/removebucketencryption.go)
### Full Examples : Bucket replication Operations
+6 -3
View File
@@ -30,6 +30,7 @@ import (
"github.com/google/uuid"
"github.com/minio/minio-go/v7/pkg/encrypt"
"github.com/minio/minio-go/v7/pkg/s3utils"
"github.com/minio/minio-go/v7/pkg/tags"
)
// CopyDestOptions represents options specified by user for CopyObject/ComposeObject APIs
@@ -98,8 +99,8 @@ func (opts CopyDestOptions) Marshal(header http.Header) {
const replaceDirective = "REPLACE"
if opts.ReplaceTags {
header.Set(amzTaggingHeaderDirective, replaceDirective)
if tags := s3utils.TagEncode(opts.UserTags); tags != "" {
header.Set(amzTaggingHeader, tags)
if tags, _ := tags.NewTags(opts.UserTags, true); tags != nil {
header.Set(amzTaggingHeader, tags.String())
}
}
@@ -236,7 +237,9 @@ func (c *Client) copyObjectDo(ctx context.Context, srcBucket, srcObject, destBuc
}
if len(dstOpts.UserTags) != 0 {
headers.Set(amzTaggingHeader, s3utils.TagEncode(dstOpts.UserTags))
if tags, _ := tags.NewTags(dstOpts.UserTags, true); tags != nil {
headers.Set(amzTaggingHeader, tags.String())
}
}
reqMetadata := requestMetadata{
+1 -1
View File
@@ -68,7 +68,7 @@ func (c *Client) CopyObject(ctx context.Context, dst CopyDestOptions, src CopySr
Bucket: dst.Bucket,
Key: dst.Object,
LastModified: cpObjRes.LastModified,
ETag: trimEtag(resp.Header.Get("ETag")),
ETag: trimEtag(cpObjRes.ETag),
VersionID: resp.Header.Get(amzVersionID),
Expiration: expTime,
ExpirationRuleID: ruleID,
+10 -8
View File
@@ -143,10 +143,11 @@ type UploadInfo struct {
// Verified checksum values, if any.
// Values are base64 (standard) encoded.
// For multipart objects this is a checksum of the checksum of each part.
ChecksumCRC32 string
ChecksumCRC32C string
ChecksumSHA1 string
ChecksumSHA256 string
ChecksumCRC32 string
ChecksumCRC32C string
ChecksumSHA1 string
ChecksumSHA256 string
ChecksumCRC64NVME string
}
// RestoreInfo contains information of the restore operation of an archived object
@@ -215,10 +216,11 @@ type ObjectInfo struct {
Restore *RestoreInfo
// Checksum values
ChecksumCRC32 string
ChecksumCRC32C string
ChecksumSHA1 string
ChecksumSHA256 string
ChecksumCRC32 string
ChecksumCRC32C string
ChecksumSHA1 string
ChecksumSHA256 string
ChecksumCRC64NVME string
Internal *struct {
K int // Data blocks
+2 -2
View File
@@ -318,7 +318,7 @@ func (o *Object) doGetRequest(request getRequest) (getResponse, error) {
response := <-o.resCh
// Return any error to the top level.
if response.Error != nil {
if response.Error != nil && response.Error != io.EOF {
return response, response.Error
}
@@ -340,7 +340,7 @@ func (o *Object) doGetRequest(request getRequest) (getResponse, error) {
// Data are ready on the wire, no need to reinitiate connection in lower level
o.seekData = false
return response, nil
return response, response.Error
}
// setOffset - handles the setting of offsets for
+1 -1
View File
@@ -140,7 +140,7 @@ func (c *Client) PresignedPostPolicy(ctx context.Context, p *PostPolicy) (u *url
}
// Get credentials from the configured credentials provider.
credValues, err := c.credsProvider.Get()
credValues, err := c.credsProvider.GetWithContext(c.CredContext())
if err != nil {
return nil, nil, err
}
+78
View File
@@ -0,0 +1,78 @@
/*
* MinIO Go Library for Amazon S3 Compatible Cloud Storage
* Copyright 2015-2024 MinIO, Inc.
*
* Licensed under the Apache License, Version 2.0 (the "License");
* you may not use this file except in compliance with the License.
* You may obtain a copy of the License at
*
* http://www.apache.org/licenses/LICENSE-2.0
*
* Unless required by applicable law or agreed to in writing, software
* distributed under the License is distributed on an "AS IS" BASIS,
* WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
* See the License for the specific language governing permissions and
* limitations under the License.
*/
package minio
import (
"bytes"
"context"
"io"
"net/http"
"github.com/goccy/go-json"
"github.com/minio/minio-go/v7/pkg/s3utils"
)
// PromptObject performs language model inference with the prompt and referenced object as context.
// Inference is performed using a Lambda handler that can process the prompt and object.
// Currently, this functionality is limited to certain MinIO servers.
func (c *Client) PromptObject(ctx context.Context, bucketName, objectName, prompt string, opts PromptObjectOptions) (io.ReadCloser, error) {
// Input validation.
if err := s3utils.CheckValidBucketName(bucketName); err != nil {
return nil, ErrorResponse{
StatusCode: http.StatusBadRequest,
Code: "InvalidBucketName",
Message: err.Error(),
}
}
if err := s3utils.CheckValidObjectName(objectName); err != nil {
return nil, ErrorResponse{
StatusCode: http.StatusBadRequest,
Code: "XMinioInvalidObjectName",
Message: err.Error(),
}
}
opts.AddLambdaArnToReqParams(opts.LambdaArn)
opts.SetHeader("Content-Type", "application/json")
opts.AddPromptArg("prompt", prompt)
promptReqBytes, err := json.Marshal(opts.PromptArgs)
if err != nil {
return nil, err
}
// Execute POST on bucket/object.
resp, err := c.executeMethod(ctx, http.MethodPost, requestMetadata{
bucketName: bucketName,
objectName: objectName,
queryValues: opts.toQueryValues(),
customHeader: opts.Header(),
contentSHA256Hex: sum256Hex(promptReqBytes),
contentBody: bytes.NewReader(promptReqBytes),
contentLength: int64(len(promptReqBytes)),
})
if err != nil {
return nil, err
}
if resp.StatusCode != http.StatusOK {
defer closeResponse(resp)
return nil, httpRespToErrorResponse(resp, bucketName, objectName)
}
return resp.Body, nil
}
+84
View File
@@ -0,0 +1,84 @@
/*
* MinIO Go Library for Amazon S3 Compatible Cloud Storage
* Copyright 2015-2024 MinIO, Inc.
*
* Licensed under the Apache License, Version 2.0 (the "License");
* you may not use this file except in compliance with the License.
* You may obtain a copy of the License at
*
* http://www.apache.org/licenses/LICENSE-2.0
*
* Unless required by applicable law or agreed to in writing, software
* distributed under the License is distributed on an "AS IS" BASIS,
* WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
* See the License for the specific language governing permissions and
* limitations under the License.
*/
package minio
import (
"net/http"
"net/url"
)
// PromptObjectOptions provides options to PromptObject call.
// LambdaArn is the ARN of the Prompt Lambda to be invoked.
// PromptArgs is a map of key-value pairs to be passed to the inference action on the Prompt Lambda.
// "prompt" is a reserved key and should not be used as a key in PromptArgs.
type PromptObjectOptions struct {
LambdaArn string
PromptArgs map[string]any
headers map[string]string
reqParams url.Values
}
// Header returns the http.Header representation of the POST options.
func (o PromptObjectOptions) Header() http.Header {
headers := make(http.Header, len(o.headers))
for k, v := range o.headers {
headers.Set(k, v)
}
return headers
}
// AddPromptArg Add a key value pair to the prompt arguments where the key is a string and
// the value is a JSON serializable.
func (o *PromptObjectOptions) AddPromptArg(key string, value any) {
if o.PromptArgs == nil {
o.PromptArgs = make(map[string]any)
}
o.PromptArgs[key] = value
}
// AddLambdaArnToReqParams adds the lambdaArn to the request query string parameters.
func (o *PromptObjectOptions) AddLambdaArnToReqParams(lambdaArn string) {
if o.reqParams == nil {
o.reqParams = make(url.Values)
}
o.reqParams.Add("lambdaArn", lambdaArn)
}
// SetHeader adds a key value pair to the options. The
// key-value pair will be part of the HTTP POST request
// headers.
func (o *PromptObjectOptions) SetHeader(key, value string) {
if o.headers == nil {
o.headers = make(map[string]string)
}
o.headers[http.CanonicalHeaderKey(key)] = value
}
// toQueryValues - Convert the reqParams in Options to query string parameters.
func (o *PromptObjectOptions) toQueryValues() url.Values {
urlValues := make(url.Values)
if o.reqParams != nil {
for key, values := range o.reqParams {
for _, value := range values {
urlValues.Add(key, value)
}
}
}
return urlValues
}
+4 -1
View File
@@ -85,7 +85,10 @@ func (c *Client) PutObjectFanOut(ctx context.Context, bucket string, fanOutData
policy.SetEncryption(fanOutReq.SSE)
// Set checksum headers if any.
policy.SetChecksum(fanOutReq.Checksum)
err := policy.SetChecksum(fanOutReq.Checksum)
if err != nil {
return nil, err
}
url, formData, err := c.PresignedPostPolicy(ctx, policy)
if err != nil {
+22 -26
View File
@@ -83,10 +83,7 @@ func (c *Client) putObjectMultipartNoStream(ctx context.Context, bucketName, obj
// HTTPS connection.
hashAlgos, hashSums := c.hashMaterials(opts.SendContentMd5, !opts.DisableContentSha256)
if len(hashSums) == 0 {
if opts.UserMetadata == nil {
opts.UserMetadata = make(map[string]string, 1)
}
opts.UserMetadata["X-Amz-Checksum-Algorithm"] = opts.AutoChecksum.String()
addAutoChecksumHeaders(&opts)
}
// Initiate a new multipart upload.
@@ -113,7 +110,6 @@ func (c *Client) putObjectMultipartNoStream(ctx context.Context, bucketName, obj
// Create checksums
// CRC32C is ~50% faster on AMD64 @ 30GB/s
var crcBytes []byte
customHeader := make(http.Header)
crc := opts.AutoChecksum.Hasher()
for partNumber <= totalPartsCount {
@@ -154,7 +150,6 @@ func (c *Client) putObjectMultipartNoStream(ctx context.Context, bucketName, obj
crc.Write(buf[:length])
cSum := crc.Sum(nil)
customHeader.Set(opts.AutoChecksum.Key(), base64.StdEncoding.EncodeToString(cSum))
crcBytes = append(crcBytes, cSum...)
}
p := uploadPartParams{bucketName: bucketName, objectName: objectName, uploadID: uploadID, reader: rd, partNumber: partNumber, md5Base64: md5Base64, sha256Hex: sha256Hex, size: int64(length), sse: opts.ServerSideEncryption, streamSha256: !opts.DisableContentSha256, customHeader: customHeader}
@@ -182,18 +177,21 @@ func (c *Client) putObjectMultipartNoStream(ctx context.Context, bucketName, obj
// Loop over total uploaded parts to save them in
// Parts array before completing the multipart request.
allParts := make([]ObjectPart, 0, len(partsInfo))
for i := 1; i < partNumber; i++ {
part, ok := partsInfo[i]
if !ok {
return UploadInfo{}, errInvalidArgument(fmt.Sprintf("Missing part number %d", i))
}
allParts = append(allParts, part)
complMultipartUpload.Parts = append(complMultipartUpload.Parts, CompletePart{
ETag: part.ETag,
PartNumber: part.PartNumber,
ChecksumCRC32: part.ChecksumCRC32,
ChecksumCRC32C: part.ChecksumCRC32C,
ChecksumSHA1: part.ChecksumSHA1,
ChecksumSHA256: part.ChecksumSHA256,
ETag: part.ETag,
PartNumber: part.PartNumber,
ChecksumCRC32: part.ChecksumCRC32,
ChecksumCRC32C: part.ChecksumCRC32C,
ChecksumSHA1: part.ChecksumSHA1,
ChecksumSHA256: part.ChecksumSHA256,
ChecksumCRC64NVME: part.ChecksumCRC64NVME,
})
}
@@ -203,12 +201,8 @@ func (c *Client) putObjectMultipartNoStream(ctx context.Context, bucketName, obj
ServerSideEncryption: opts.ServerSideEncryption,
AutoChecksum: opts.AutoChecksum,
}
if len(crcBytes) > 0 {
// Add hash of hashes.
crc.Reset()
crc.Write(crcBytes)
opts.UserMetadata = map[string]string{opts.AutoChecksum.Key(): base64.StdEncoding.EncodeToString(crc.Sum(nil))}
}
applyAutoChecksum(&opts, allParts)
uploadInfo, err := c.completeMultipartUpload(ctx, bucketName, objectName, uploadID, complMultipartUpload, opts)
if err != nil {
return UploadInfo{}, err
@@ -354,10 +348,11 @@ func (c *Client) uploadPart(ctx context.Context, p uploadPartParams) (ObjectPart
// Once successfully uploaded, return completed part.
h := resp.Header
objPart := ObjectPart{
ChecksumCRC32: h.Get("x-amz-checksum-crc32"),
ChecksumCRC32C: h.Get("x-amz-checksum-crc32c"),
ChecksumSHA1: h.Get("x-amz-checksum-sha1"),
ChecksumSHA256: h.Get("x-amz-checksum-sha256"),
ChecksumCRC32: h.Get(ChecksumCRC32.Key()),
ChecksumCRC32C: h.Get(ChecksumCRC32C.Key()),
ChecksumSHA1: h.Get(ChecksumSHA1.Key()),
ChecksumSHA256: h.Get(ChecksumSHA256.Key()),
ChecksumCRC64NVME: h.Get(ChecksumCRC64NVME.Key()),
}
objPart.Size = p.size
objPart.PartNumber = p.partNumber
@@ -457,9 +452,10 @@ func (c *Client) completeMultipartUpload(ctx context.Context, bucketName, object
Expiration: expTime,
ExpirationRuleID: ruleID,
ChecksumSHA256: completeMultipartUploadResult.ChecksumSHA256,
ChecksumSHA1: completeMultipartUploadResult.ChecksumSHA1,
ChecksumCRC32: completeMultipartUploadResult.ChecksumCRC32,
ChecksumCRC32C: completeMultipartUploadResult.ChecksumCRC32C,
ChecksumSHA256: completeMultipartUploadResult.ChecksumSHA256,
ChecksumSHA1: completeMultipartUploadResult.ChecksumSHA1,
ChecksumCRC32: completeMultipartUploadResult.ChecksumCRC32,
ChecksumCRC32C: completeMultipartUploadResult.ChecksumCRC32C,
ChecksumCRC64NVME: completeMultipartUploadResult.ChecksumCRC64NVME,
}, nil
}
+40 -61
View File
@@ -52,7 +52,7 @@ func (c *Client) putObjectMultipartStream(ctx context.Context, bucketName, objec
} else {
info, err = c.putObjectMultipartStreamOptionalChecksum(ctx, bucketName, objectName, reader, size, opts)
}
if err != nil {
if err != nil && s3utils.IsGoogleEndpoint(*c.endpointURL) {
errResp := ToErrorResponse(err)
// Verify if multipart functionality is not available, if not
// fall back to single PutObject operation.
@@ -113,10 +113,7 @@ func (c *Client) putObjectMultipartStreamFromReadAt(ctx context.Context, bucketN
}
withChecksum := c.trailingHeaderSupport
if withChecksum {
if opts.UserMetadata == nil {
opts.UserMetadata = make(map[string]string, 1)
}
opts.UserMetadata["X-Amz-Checksum-Algorithm"] = opts.AutoChecksum.String()
addAutoChecksumHeaders(&opts)
}
// Initiate a new multipart upload.
uploadID, err := c.newUploadID(ctx, bucketName, objectName, opts)
@@ -240,6 +237,7 @@ func (c *Client) putObjectMultipartStreamFromReadAt(ctx context.Context, bucketN
// Gather the responses as they occur and update any
// progress bar.
allParts := make([]ObjectPart, 0, totalPartsCount)
for u := 1; u <= totalPartsCount; u++ {
select {
case <-ctx.Done():
@@ -248,16 +246,17 @@ func (c *Client) putObjectMultipartStreamFromReadAt(ctx context.Context, bucketN
if uploadRes.Error != nil {
return UploadInfo{}, uploadRes.Error
}
allParts = append(allParts, uploadRes.Part)
// Update the totalUploadedSize.
totalUploadedSize += uploadRes.Size
complMultipartUpload.Parts = append(complMultipartUpload.Parts, CompletePart{
ETag: uploadRes.Part.ETag,
PartNumber: uploadRes.Part.PartNumber,
ChecksumCRC32: uploadRes.Part.ChecksumCRC32,
ChecksumCRC32C: uploadRes.Part.ChecksumCRC32C,
ChecksumSHA1: uploadRes.Part.ChecksumSHA1,
ChecksumSHA256: uploadRes.Part.ChecksumSHA256,
ETag: uploadRes.Part.ETag,
PartNumber: uploadRes.Part.PartNumber,
ChecksumCRC32: uploadRes.Part.ChecksumCRC32,
ChecksumCRC32C: uploadRes.Part.ChecksumCRC32C,
ChecksumSHA1: uploadRes.Part.ChecksumSHA1,
ChecksumSHA256: uploadRes.Part.ChecksumSHA256,
ChecksumCRC64NVME: uploadRes.Part.ChecksumCRC64NVME,
})
}
}
@@ -275,15 +274,7 @@ func (c *Client) putObjectMultipartStreamFromReadAt(ctx context.Context, bucketN
AutoChecksum: opts.AutoChecksum,
}
if withChecksum {
// Add hash of hashes.
crc := opts.AutoChecksum.Hasher()
for _, part := range complMultipartUpload.Parts {
cs, err := base64.StdEncoding.DecodeString(part.Checksum(opts.AutoChecksum))
if err == nil {
crc.Write(cs)
}
}
opts.UserMetadata = map[string]string{opts.AutoChecksum.KeyCapitalized(): base64.StdEncoding.EncodeToString(crc.Sum(nil))}
applyAutoChecksum(&opts, allParts)
}
uploadInfo, err := c.completeMultipartUpload(ctx, bucketName, objectName, uploadID, complMultipartUpload, opts)
@@ -312,10 +303,7 @@ func (c *Client) putObjectMultipartStreamOptionalChecksum(ctx context.Context, b
}
if !opts.SendContentMd5 {
if opts.UserMetadata == nil {
opts.UserMetadata = make(map[string]string, 1)
}
opts.UserMetadata["X-Amz-Checksum-Algorithm"] = opts.AutoChecksum.String()
addAutoChecksumHeaders(&opts)
}
// Calculate the optimal parts info for a given size.
@@ -342,7 +330,6 @@ func (c *Client) putObjectMultipartStreamOptionalChecksum(ctx context.Context, b
// Create checksums
// CRC32C is ~50% faster on AMD64 @ 30GB/s
var crcBytes []byte
customHeader := make(http.Header)
crc := opts.AutoChecksum.Hasher()
md5Hash := c.md5Hasher()
@@ -389,7 +376,6 @@ func (c *Client) putObjectMultipartStreamOptionalChecksum(ctx context.Context, b
crc.Write(buf[:length])
cSum := crc.Sum(nil)
customHeader.Set(opts.AutoChecksum.KeyCapitalized(), base64.StdEncoding.EncodeToString(cSum))
crcBytes = append(crcBytes, cSum...)
}
// Update progress reader appropriately to the latest offset
@@ -420,18 +406,21 @@ func (c *Client) putObjectMultipartStreamOptionalChecksum(ctx context.Context, b
// Loop over total uploaded parts to save them in
// Parts array before completing the multipart request.
allParts := make([]ObjectPart, 0, len(partsInfo))
for i := 1; i < partNumber; i++ {
part, ok := partsInfo[i]
if !ok {
return UploadInfo{}, errInvalidArgument(fmt.Sprintf("Missing part number %d", i))
}
allParts = append(allParts, part)
complMultipartUpload.Parts = append(complMultipartUpload.Parts, CompletePart{
ETag: part.ETag,
PartNumber: part.PartNumber,
ChecksumCRC32: part.ChecksumCRC32,
ChecksumCRC32C: part.ChecksumCRC32C,
ChecksumSHA1: part.ChecksumSHA1,
ChecksumSHA256: part.ChecksumSHA256,
ETag: part.ETag,
PartNumber: part.PartNumber,
ChecksumCRC32: part.ChecksumCRC32,
ChecksumCRC32C: part.ChecksumCRC32C,
ChecksumSHA1: part.ChecksumSHA1,
ChecksumSHA256: part.ChecksumSHA256,
ChecksumCRC64NVME: part.ChecksumCRC64NVME,
})
}
@@ -442,12 +431,7 @@ func (c *Client) putObjectMultipartStreamOptionalChecksum(ctx context.Context, b
ServerSideEncryption: opts.ServerSideEncryption,
AutoChecksum: opts.AutoChecksum,
}
if len(crcBytes) > 0 {
// Add hash of hashes.
crc.Reset()
crc.Write(crcBytes)
opts.UserMetadata = map[string]string{opts.AutoChecksum.KeyCapitalized(): base64.StdEncoding.EncodeToString(crc.Sum(nil))}
}
applyAutoChecksum(&opts, allParts)
uploadInfo, err := c.completeMultipartUpload(ctx, bucketName, objectName, uploadID, complMultipartUpload, opts)
if err != nil {
return UploadInfo{}, err
@@ -475,10 +459,7 @@ func (c *Client) putObjectMultipartStreamParallel(ctx context.Context, bucketNam
opts.AutoChecksum = opts.Checksum
}
if !opts.SendContentMd5 {
if opts.UserMetadata == nil {
opts.UserMetadata = make(map[string]string, 1)
}
opts.UserMetadata["X-Amz-Checksum-Algorithm"] = opts.AutoChecksum.String()
addAutoChecksumHeaders(&opts)
}
// Cancel all when an error occurs.
@@ -510,7 +491,6 @@ func (c *Client) putObjectMultipartStreamParallel(ctx context.Context, bucketNam
// Create checksums
// CRC32C is ~50% faster on AMD64 @ 30GB/s
var crcBytes []byte
crc := opts.AutoChecksum.Hasher()
// Total data read and written to server. should be equal to 'size' at the end of the call.
@@ -570,7 +550,6 @@ func (c *Client) putObjectMultipartStreamParallel(ctx context.Context, bucketNam
crc.Write(buf[:length])
cSum := crc.Sum(nil)
customHeader.Set(opts.AutoChecksum.Key(), base64.StdEncoding.EncodeToString(cSum))
crcBytes = append(crcBytes, cSum...)
}
wg.Add(1)
@@ -630,18 +609,21 @@ func (c *Client) putObjectMultipartStreamParallel(ctx context.Context, bucketNam
// Loop over total uploaded parts to save them in
// Parts array before completing the multipart request.
allParts := make([]ObjectPart, 0, len(partsInfo))
for i := 1; i < partNumber; i++ {
part, ok := partsInfo[i]
if !ok {
return UploadInfo{}, errInvalidArgument(fmt.Sprintf("Missing part number %d", i))
}
allParts = append(allParts, part)
complMultipartUpload.Parts = append(complMultipartUpload.Parts, CompletePart{
ETag: part.ETag,
PartNumber: part.PartNumber,
ChecksumCRC32: part.ChecksumCRC32,
ChecksumCRC32C: part.ChecksumCRC32C,
ChecksumSHA1: part.ChecksumSHA1,
ChecksumSHA256: part.ChecksumSHA256,
ETag: part.ETag,
PartNumber: part.PartNumber,
ChecksumCRC32: part.ChecksumCRC32,
ChecksumCRC32C: part.ChecksumCRC32C,
ChecksumSHA1: part.ChecksumSHA1,
ChecksumSHA256: part.ChecksumSHA256,
ChecksumCRC64NVME: part.ChecksumCRC64NVME,
})
}
@@ -652,12 +634,8 @@ func (c *Client) putObjectMultipartStreamParallel(ctx context.Context, bucketNam
ServerSideEncryption: opts.ServerSideEncryption,
AutoChecksum: opts.AutoChecksum,
}
if len(crcBytes) > 0 {
// Add hash of hashes.
crc.Reset()
crc.Write(crcBytes)
opts.UserMetadata = map[string]string{opts.AutoChecksum.KeyCapitalized(): base64.StdEncoding.EncodeToString(crc.Sum(nil))}
}
applyAutoChecksum(&opts, allParts)
uploadInfo, err := c.completeMultipartUpload(ctx, bucketName, objectName, uploadID, complMultipartUpload, opts)
if err != nil {
return UploadInfo{}, err
@@ -823,9 +801,10 @@ func (c *Client) putObjectDo(ctx context.Context, bucketName, objectName string,
ExpirationRuleID: ruleID,
// Checksum values
ChecksumCRC32: h.Get("x-amz-checksum-crc32"),
ChecksumCRC32C: h.Get("x-amz-checksum-crc32c"),
ChecksumSHA1: h.Get("x-amz-checksum-sha1"),
ChecksumSHA256: h.Get("x-amz-checksum-sha256"),
ChecksumCRC32: h.Get(ChecksumCRC32.Key()),
ChecksumCRC32C: h.Get(ChecksumCRC32C.Key()),
ChecksumSHA1: h.Get(ChecksumSHA1.Key()),
ChecksumSHA256: h.Get(ChecksumSHA256.Key()),
ChecksumCRC64NVME: h.Get(ChecksumCRC64NVME.Key()),
}, nil
}
+16 -19
View File
@@ -30,6 +30,7 @@ import (
"github.com/minio/minio-go/v7/pkg/encrypt"
"github.com/minio/minio-go/v7/pkg/s3utils"
"github.com/minio/minio-go/v7/pkg/tags"
"golang.org/x/net/http/httpguts"
)
@@ -229,7 +230,9 @@ func (opts PutObjectOptions) Header() (header http.Header) {
}
if len(opts.UserTags) != 0 {
header.Set(amzTaggingHeader, s3utils.TagEncode(opts.UserTags))
if tags, _ := tags.NewTags(opts.UserTags, true); tags != nil {
header.Set(amzTaggingHeader, tags.String())
}
}
for k, v := range opts.UserMetadata {
@@ -387,10 +390,7 @@ func (c *Client) putObjectMultipartStreamNoLength(ctx context.Context, bucketNam
opts.AutoChecksum = opts.Checksum
}
if !opts.SendContentMd5 {
if opts.UserMetadata == nil {
opts.UserMetadata = make(map[string]string, 1)
}
opts.UserMetadata["X-Amz-Checksum-Algorithm"] = opts.AutoChecksum.String()
addAutoChecksumHeaders(&opts)
}
// Initiate a new multipart upload.
@@ -417,7 +417,6 @@ func (c *Client) putObjectMultipartStreamNoLength(ctx context.Context, bucketNam
// Create checksums
// CRC32C is ~50% faster on AMD64 @ 30GB/s
var crcBytes []byte
customHeader := make(http.Header)
crc := opts.AutoChecksum.Hasher()
@@ -443,7 +442,6 @@ func (c *Client) putObjectMultipartStreamNoLength(ctx context.Context, bucketNam
crc.Write(buf[:length])
cSum := crc.Sum(nil)
customHeader.Set(opts.AutoChecksum.Key(), base64.StdEncoding.EncodeToString(cSum))
crcBytes = append(crcBytes, cSum...)
}
// Update progress reader appropriately to the latest offset
@@ -475,18 +473,21 @@ func (c *Client) putObjectMultipartStreamNoLength(ctx context.Context, bucketNam
// Loop over total uploaded parts to save them in
// Parts array before completing the multipart request.
allParts := make([]ObjectPart, 0, len(partsInfo))
for i := 1; i < partNumber; i++ {
part, ok := partsInfo[i]
if !ok {
return UploadInfo{}, errInvalidArgument(fmt.Sprintf("Missing part number %d", i))
}
allParts = append(allParts, part)
complMultipartUpload.Parts = append(complMultipartUpload.Parts, CompletePart{
ETag: part.ETag,
PartNumber: part.PartNumber,
ChecksumCRC32: part.ChecksumCRC32,
ChecksumCRC32C: part.ChecksumCRC32C,
ChecksumSHA1: part.ChecksumSHA1,
ChecksumSHA256: part.ChecksumSHA256,
ETag: part.ETag,
PartNumber: part.PartNumber,
ChecksumCRC32: part.ChecksumCRC32,
ChecksumCRC32C: part.ChecksumCRC32C,
ChecksumSHA1: part.ChecksumSHA1,
ChecksumSHA256: part.ChecksumSHA256,
ChecksumCRC64NVME: part.ChecksumCRC64NVME,
})
}
@@ -497,12 +498,8 @@ func (c *Client) putObjectMultipartStreamNoLength(ctx context.Context, bucketNam
ServerSideEncryption: opts.ServerSideEncryption,
AutoChecksum: opts.AutoChecksum,
}
if len(crcBytes) > 0 {
// Add hash of hashes.
crc.Reset()
crc.Write(crcBytes)
opts.UserMetadata = map[string]string{opts.AutoChecksum.KeyCapitalized(): base64.StdEncoding.EncodeToString(crc.Sum(nil))}
}
applyAutoChecksum(&opts, allParts)
uploadInfo, err := c.completeMultipartUpload(ctx, bucketName, objectName, uploadID, complMultipartUpload, opts)
if err != nil {
return UploadInfo{}, err
+8
View File
@@ -213,6 +213,14 @@ type RemoveObjectError struct {
Err error
}
func (err *RemoveObjectError) Error() string {
// This should never happen as we will have a non-nil error with no underlying error.
if err.Err == nil {
return "unexpected remove object error result"
}
return err.Err.Error()
}
// RemoveObjectResult - container of Multi Delete S3 API result
type RemoveObjectResult struct {
ObjectName string
+58 -12
View File
@@ -18,6 +18,7 @@
package minio
import (
"encoding/base64"
"encoding/xml"
"errors"
"io"
@@ -276,10 +277,45 @@ type ObjectPart struct {
Size int64
// Checksum values of each part.
ChecksumCRC32 string
ChecksumCRC32C string
ChecksumSHA1 string
ChecksumSHA256 string
ChecksumCRC32 string
ChecksumCRC32C string
ChecksumSHA1 string
ChecksumSHA256 string
ChecksumCRC64NVME string
}
// Checksum will return the checksum for the given type.
// Will return the empty string if not set.
func (c ObjectPart) Checksum(t ChecksumType) string {
switch {
case t.Is(ChecksumCRC32C):
return c.ChecksumCRC32C
case t.Is(ChecksumCRC32):
return c.ChecksumCRC32
case t.Is(ChecksumSHA1):
return c.ChecksumSHA1
case t.Is(ChecksumSHA256):
return c.ChecksumSHA256
case t.Is(ChecksumCRC64NVME):
return c.ChecksumCRC64NVME
}
return ""
}
// ChecksumRaw returns the decoded checksum from the part.
func (c ObjectPart) ChecksumRaw(t ChecksumType) ([]byte, error) {
b64 := c.Checksum(t)
if b64 == "" {
return nil, errors.New("no checksum set")
}
decoded, err := base64.StdEncoding.DecodeString(b64)
if err != nil {
return nil, err
}
if len(decoded) != t.RawByteLen() {
return nil, errors.New("checksum length mismatch")
}
return decoded, nil
}
// ListObjectPartsResult container for ListObjectParts response.
@@ -296,6 +332,12 @@ type ListObjectPartsResult struct {
NextPartNumberMarker int
MaxParts int
// ChecksumAlgorithm will be CRC32, CRC32C, etc.
ChecksumAlgorithm string
// ChecksumType is FULL_OBJECT or COMPOSITE (assume COMPOSITE when unset)
ChecksumType string
// Indicates whether the returned list of parts is truncated.
IsTruncated bool
ObjectParts []ObjectPart `xml:"Part"`
@@ -320,10 +362,11 @@ type completeMultipartUploadResult struct {
ETag string
// Checksum values, hash of hashes of parts.
ChecksumCRC32 string
ChecksumCRC32C string
ChecksumSHA1 string
ChecksumSHA256 string
ChecksumCRC32 string
ChecksumCRC32C string
ChecksumSHA1 string
ChecksumSHA256 string
ChecksumCRC64NVME string
}
// CompletePart sub container lists individual part numbers and their
@@ -334,10 +377,11 @@ type CompletePart struct {
ETag string
// Checksum values
ChecksumCRC32 string `xml:"ChecksumCRC32,omitempty"`
ChecksumCRC32C string `xml:"ChecksumCRC32C,omitempty"`
ChecksumSHA1 string `xml:"ChecksumSHA1,omitempty"`
ChecksumSHA256 string `xml:"ChecksumSHA256,omitempty"`
ChecksumCRC32 string `xml:"ChecksumCRC32,omitempty"`
ChecksumCRC32C string `xml:"ChecksumCRC32C,omitempty"`
ChecksumSHA1 string `xml:"ChecksumSHA1,omitempty"`
ChecksumSHA256 string `xml:"ChecksumSHA256,omitempty"`
ChecksumCRC64NVME string `xml:",omitempty"`
}
// Checksum will return the checksum for the given type.
@@ -352,6 +396,8 @@ func (c CompletePart) Checksum(t ChecksumType) string {
return c.ChecksumSHA1
case t.Is(ChecksumSHA256):
return c.ChecksumSHA256
case t.Is(ChecksumCRC64NVME):
return c.ChecksumCRC64NVME
}
return ""
}
+62 -4
View File
@@ -92,6 +92,9 @@ type Client struct {
// default to Auto.
lookup BucketLookupType
// lookupFn is a custom function to return URL lookup type supported by the server.
lookupFn func(u url.URL, bucketName string) BucketLookupType
// Factory for MD5 hash functions.
md5Hasher func() md5simd.Hasher
sha256Hasher func() md5simd.Hasher
@@ -99,6 +102,7 @@ type Client struct {
healthStatus int32
trailingHeaderSupport bool
maxRetries int
}
// Options for New method
@@ -116,6 +120,25 @@ type Options struct {
// function to perform region lookups appropriately.
CustomRegionViaURL func(u url.URL) string
// Provide a custom function that returns BucketLookupType based
// on the input URL, this is just like s3utils.IsVirtualHostSupported()
// function but allows users to provide their own implementation.
// Once this is set it overrides all settings for opts.BucketLookup
// if this function returns BucketLookupAuto then default detection
// via s3utils.IsVirtualHostSupported() is used, otherwise the
// function is expected to return appropriate value as expected for
// the URL the user wishes to honor.
//
// BucketName is passed additionally for the caller to ensure
// handle situations where `bucketNames` have multiple `.` separators
// in such case HTTPs certs will not work properly for *.<domain>
// wildcards, so you need to specifically handle these situations
// and not return bucket as part of DNS since those requests may fail.
//
// For better understanding look at s3utils.IsVirtualHostSupported()
// implementation.
BucketLookupViaURL func(u url.URL, bucketName string) BucketLookupType
// TrailingHeaders indicates server support of trailing headers.
// Only supported for v4 signatures.
TrailingHeaders bool
@@ -123,12 +146,16 @@ type Options struct {
// Custom hash routines. Leave nil to use standard.
CustomMD5 func() md5simd.Hasher
CustomSHA256 func() md5simd.Hasher
// Number of times a request is retried. Defaults to 10 retries if this option is not configured.
// Set to 1 to disable retries.
MaxRetries int
}
// Global constants.
const (
libraryName = "minio-go"
libraryVersion = "v7.0.78"
libraryVersion = "v7.0.87"
)
// User Agent should always following the below style.
@@ -274,10 +301,16 @@ func privateNew(endpoint string, opts *Options) (*Client, error) {
// Sets bucket lookup style, whether server accepts DNS or Path lookup. Default is Auto - determined
// by the SDK. When Auto is specified, DNS lookup is used for Amazon/Google cloud endpoints and Path for all other endpoints.
clnt.lookup = opts.BucketLookup
clnt.lookupFn = opts.BucketLookupViaURL
// healthcheck is not initialized
clnt.healthStatus = unknown
clnt.maxRetries = MaxRetry
if opts.MaxRetries > 0 {
clnt.maxRetries = opts.MaxRetries
}
// Return.
return clnt, nil
}
@@ -592,7 +625,7 @@ func (c *Client) executeMethod(ctx context.Context, method string, metadata requ
var retryable bool // Indicates if request can be retried.
var bodySeeker io.Seeker // Extracted seeker from io.Reader.
reqRetry := MaxRetry // Indicates how many times we can retry the request
reqRetry := c.maxRetries // Indicates how many times we can retry the request
if metadata.contentBody != nil {
// Check if body is seekable then it is retryable.
@@ -798,7 +831,7 @@ func (c *Client) newRequest(ctx context.Context, method string, metadata request
}
// Get credentials from the configured credentials provider.
value, err := c.credsProvider.Get()
value, err := c.credsProvider.GetWithContext(c.CredContext())
if err != nil {
return nil, err
}
@@ -993,6 +1026,18 @@ func (c *Client) makeTargetURL(bucketName, objectName, bucketLocation string, is
// returns true if virtual hosted style requests are to be used.
func (c *Client) isVirtualHostStyleRequest(url url.URL, bucketName string) bool {
if c.lookupFn != nil {
lookup := c.lookupFn(url, bucketName)
switch lookup {
case BucketLookupDNS:
return true
case BucketLookupPath:
return false
}
// if its auto then we fallback to default detection.
return s3utils.IsVirtualHostSupported(url, bucketName)
}
if bucketName == "" {
return false
}
@@ -1000,11 +1045,24 @@ func (c *Client) isVirtualHostStyleRequest(url url.URL, bucketName string) bool
if c.lookup == BucketLookupDNS {
return true
}
if c.lookup == BucketLookupPath {
return false
}
// default to virtual only for Amazon/Google storage. In all other cases use
// default to virtual only for Amazon/Google storage. In all other cases use
// path style requests
return s3utils.IsVirtualHostSupported(url, bucketName)
}
// CredContext returns the context for fetching credentials
func (c *Client) CredContext() *credentials.CredContext {
httpClient := c.httpClient
if httpClient == nil {
httpClient = http.DefaultClient
}
return &credentials.CredContext{
Client: httpClient,
Endpoint: c.endpointURL.String(),
}
}
+1 -1
View File
@@ -212,7 +212,7 @@ func (c *Client) getBucketLocationRequest(ctx context.Context, bucketName string
c.setUserAgent(req)
// Get credentials from the configured credentials provider.
value, err := c.credsProvider.Get()
value, err := c.credsProvider.GetWithContext(c.CredContext())
if err != nil {
return nil, err
}
+203 -6
View File
@@ -21,11 +21,17 @@ import (
"crypto/sha1"
"crypto/sha256"
"encoding/base64"
"encoding/binary"
"errors"
"hash"
"hash/crc32"
"hash/crc64"
"io"
"math/bits"
"net/http"
"sort"
"github.com/minio/crc64nvme"
)
// ChecksumType contains information about the checksum type.
@@ -41,23 +47,41 @@ const (
ChecksumCRC32
// ChecksumCRC32C indicates a CRC32 checksum with Castagnoli table.
ChecksumCRC32C
// ChecksumCRC64NVME indicates CRC64 with 0xad93d23594c93659 polynomial.
ChecksumCRC64NVME
// Keep after all valid checksums
checksumLast
// ChecksumFullObject is a modifier that can be used on CRC32 and CRC32C
// to indicate full object checksums.
ChecksumFullObject
// checksumMask is a mask for valid checksum types.
checksumMask = checksumLast - 1
// ChecksumNone indicates no checksum.
ChecksumNone ChecksumType = 0
amzChecksumAlgo = "x-amz-checksum-algorithm"
amzChecksumCRC32 = "x-amz-checksum-crc32"
amzChecksumCRC32C = "x-amz-checksum-crc32c"
amzChecksumSHA1 = "x-amz-checksum-sha1"
amzChecksumSHA256 = "x-amz-checksum-sha256"
// ChecksumFullObjectCRC32 indicates full object CRC32
ChecksumFullObjectCRC32 = ChecksumCRC32 | ChecksumFullObject
// ChecksumFullObjectCRC32C indicates full object CRC32C
ChecksumFullObjectCRC32C = ChecksumCRC32C | ChecksumFullObject
amzChecksumAlgo = "x-amz-checksum-algorithm"
amzChecksumCRC32 = "x-amz-checksum-crc32"
amzChecksumCRC32C = "x-amz-checksum-crc32c"
amzChecksumSHA1 = "x-amz-checksum-sha1"
amzChecksumSHA256 = "x-amz-checksum-sha256"
amzChecksumCRC64NVME = "x-amz-checksum-crc64nvme"
)
// Base returns the base type, without modifiers.
func (c ChecksumType) Base() ChecksumType {
return c & checksumMask
}
// Is returns if c is all of t.
func (c ChecksumType) Is(t ChecksumType) bool {
return c&t == t
@@ -75,10 +99,39 @@ func (c ChecksumType) Key() string {
return amzChecksumSHA1
case ChecksumSHA256:
return amzChecksumSHA256
case ChecksumCRC64NVME:
return amzChecksumCRC64NVME
}
return ""
}
// CanComposite will return if the checksum type can be used for composite multipart upload on AWS.
func (c ChecksumType) CanComposite() bool {
switch c & checksumMask {
case ChecksumSHA256, ChecksumSHA1, ChecksumCRC32, ChecksumCRC32C:
return true
}
return false
}
// CanMergeCRC will return if the checksum type can be used for multipart upload on AWS.
func (c ChecksumType) CanMergeCRC() bool {
switch c & checksumMask {
case ChecksumCRC32, ChecksumCRC32C, ChecksumCRC64NVME:
return true
}
return false
}
// FullObjectRequested will return if the checksum type indicates full object checksum was requested.
func (c ChecksumType) FullObjectRequested() bool {
switch c & (ChecksumFullObject | checksumMask) {
case ChecksumFullObjectCRC32C, ChecksumFullObjectCRC32, ChecksumCRC64NVME:
return true
}
return false
}
// KeyCapitalized returns the capitalized key as used in HTTP headers.
func (c ChecksumType) KeyCapitalized() string {
return http.CanonicalHeaderKey(c.Key())
@@ -93,10 +146,14 @@ func (c ChecksumType) RawByteLen() int {
return sha1.Size
case ChecksumSHA256:
return sha256.Size
case ChecksumCRC64NVME:
return crc64.Size
}
return 0
}
const crc64NVMEPolynomial = 0xad93d23594c93659
// Hasher returns a hasher corresponding to the checksum type.
// Returns nil if no checksum.
func (c ChecksumType) Hasher() hash.Hash {
@@ -109,13 +166,15 @@ func (c ChecksumType) Hasher() hash.Hash {
return sha1.New()
case ChecksumSHA256:
return sha256.New()
case ChecksumCRC64NVME:
return crc64nvme.New()
}
return nil
}
// IsSet returns whether the type is valid and known.
func (c ChecksumType) IsSet() bool {
return bits.OnesCount32(uint32(c)) == 1
return bits.OnesCount32(uint32(c&checksumMask)) == 1
}
// SetDefault will set the checksum if not already set.
@@ -125,6 +184,16 @@ func (c *ChecksumType) SetDefault(t ChecksumType) {
}
}
// EncodeToString the encoded hash value of the content provided in b.
func (c ChecksumType) EncodeToString(b []byte) string {
if !c.IsSet() {
return ""
}
h := c.Hasher()
h.Write(b)
return base64.StdEncoding.EncodeToString(h.Sum(nil))
}
// String returns the type as a string.
// CRC32, CRC32C, SHA1, and SHA256 for valid values.
// Empty string for unset and "<invalid>" if not valid.
@@ -140,6 +209,8 @@ func (c ChecksumType) String() string {
return "SHA256"
case ChecksumNone:
return ""
case ChecksumCRC64NVME:
return "CRC64NVME"
}
return "<invalid>"
}
@@ -221,3 +292,129 @@ func (c Checksum) Raw() []byte {
}
return c.r
}
// CompositeChecksum returns the composite checksum of all provided parts.
func (c ChecksumType) CompositeChecksum(p []ObjectPart) (*Checksum, error) {
if !c.CanComposite() {
return nil, errors.New("cannot do composite checksum")
}
sort.Slice(p, func(i, j int) bool {
return p[i].PartNumber < p[j].PartNumber
})
c = c.Base()
crcBytes := make([]byte, 0, len(p)*c.RawByteLen())
for _, part := range p {
pCrc, err := part.ChecksumRaw(c)
if err != nil {
return nil, err
}
crcBytes = append(crcBytes, pCrc...)
}
h := c.Hasher()
h.Write(crcBytes)
return &Checksum{Type: c, r: h.Sum(nil)}, nil
}
// FullObjectChecksum will return the full object checksum from provided parts.
func (c ChecksumType) FullObjectChecksum(p []ObjectPart) (*Checksum, error) {
if !c.CanMergeCRC() {
return nil, errors.New("cannot merge this checksum type")
}
c = c.Base()
sort.Slice(p, func(i, j int) bool {
return p[i].PartNumber < p[j].PartNumber
})
switch len(p) {
case 0:
return nil, errors.New("no parts given")
case 1:
check, err := p[0].ChecksumRaw(c)
if err != nil {
return nil, err
}
return &Checksum{
Type: c,
r: check,
}, nil
}
var merged uint32
var merged64 uint64
first, err := p[0].ChecksumRaw(c)
if err != nil {
return nil, err
}
sz := p[0].Size
switch c {
case ChecksumCRC32, ChecksumCRC32C:
merged = binary.BigEndian.Uint32(first)
case ChecksumCRC64NVME:
merged64 = binary.BigEndian.Uint64(first)
}
poly32 := uint32(crc32.IEEE)
if c.Is(ChecksumCRC32C) {
poly32 = crc32.Castagnoli
}
for _, part := range p[1:] {
if part.Size == 0 {
continue
}
sz += part.Size
pCrc, err := part.ChecksumRaw(c)
if err != nil {
return nil, err
}
switch c {
case ChecksumCRC32, ChecksumCRC32C:
merged = crc32Combine(poly32, merged, binary.BigEndian.Uint32(pCrc), part.Size)
case ChecksumCRC64NVME:
merged64 = crc64Combine(bits.Reverse64(crc64NVMEPolynomial), merged64, binary.BigEndian.Uint64(pCrc), part.Size)
}
}
var tmp [8]byte
switch c {
case ChecksumCRC32, ChecksumCRC32C:
binary.BigEndian.PutUint32(tmp[:], merged)
return &Checksum{
Type: c,
r: tmp[:4],
}, nil
case ChecksumCRC64NVME:
binary.BigEndian.PutUint64(tmp[:], merged64)
return &Checksum{
Type: c,
r: tmp[:8],
}, nil
default:
return nil, errors.New("unknown checksum type")
}
}
func addAutoChecksumHeaders(opts *PutObjectOptions) {
if opts.UserMetadata == nil {
opts.UserMetadata = make(map[string]string, 1)
}
opts.UserMetadata["X-Amz-Checksum-Algorithm"] = opts.AutoChecksum.String()
if opts.AutoChecksum.FullObjectRequested() {
opts.UserMetadata["X-Amz-Checksum-Type"] = "FULL_OBJECT"
}
}
func applyAutoChecksum(opts *PutObjectOptions, allParts []ObjectPart) {
if !opts.AutoChecksum.IsSet() {
return
}
if opts.AutoChecksum.CanComposite() && !opts.AutoChecksum.Is(ChecksumFullObject) {
// Add composite hash of hashes.
crc, err := opts.AutoChecksum.CompositeChecksum(allParts)
if err == nil {
opts.UserMetadata = map[string]string{opts.AutoChecksum.Key(): crc.Encoded()}
}
} else if opts.AutoChecksum.CanMergeCRC() {
crc, err := opts.AutoChecksum.FullObjectChecksum(allParts)
if err == nil {
opts.UserMetadata = map[string]string{opts.AutoChecksum.KeyCapitalized(): crc.Encoded(), "X-Amz-Checksum-Type": "FULL_OBJECT"}
}
}
}
+429 -1557
View File
File diff suppressed because it is too large Load Diff
+32 -11
View File
@@ -76,7 +76,8 @@ type AssumeRoleResult struct {
type STSAssumeRole struct {
Expiry
// Required http Client to use when connecting to MinIO STS service.
// Optional http Client to use when connecting to MinIO STS service
// (overrides default client in CredContext)
Client *http.Client
// STS endpoint to fetch STS credentials.
@@ -108,16 +109,10 @@ type STSAssumeRoleOptions struct {
// NewSTSAssumeRole returns a pointer to a new
// Credentials object wrapping the STSAssumeRole.
func NewSTSAssumeRole(stsEndpoint string, opts STSAssumeRoleOptions) (*Credentials, error) {
if stsEndpoint == "" {
return nil, errors.New("STS endpoint cannot be empty")
}
if opts.AccessKey == "" || opts.SecretKey == "" {
return nil, errors.New("AssumeRole credentials access/secretkey is mandatory")
}
return New(&STSAssumeRole{
Client: &http.Client{
Transport: http.DefaultTransport,
},
STSEndpoint: stsEndpoint,
Options: opts,
}), nil
@@ -222,10 +217,30 @@ func getAssumeRoleCredentials(clnt *http.Client, endpoint string, opts STSAssume
return a, nil
}
// Retrieve retrieves credentials from the MinIO service.
// Error will be returned if the request fails.
func (m *STSAssumeRole) Retrieve() (Value, error) {
a, err := getAssumeRoleCredentials(m.Client, m.STSEndpoint, m.Options)
// RetrieveWithCredContext retrieves credentials from the MinIO service.
// Error will be returned if the request fails, optional cred context.
func (m *STSAssumeRole) RetrieveWithCredContext(cc *CredContext) (Value, error) {
if cc == nil {
cc = defaultCredContext
}
client := m.Client
if client == nil {
client = cc.Client
}
if client == nil {
client = defaultCredContext.Client
}
stsEndpoint := m.STSEndpoint
if stsEndpoint == "" {
stsEndpoint = cc.Endpoint
}
if stsEndpoint == "" {
return Value{}, errors.New("STS endpoint unknown")
}
a, err := getAssumeRoleCredentials(client, stsEndpoint, m.Options)
if err != nil {
return Value{}, err
}
@@ -241,3 +256,9 @@ func (m *STSAssumeRole) Retrieve() (Value, error) {
SignerType: SignatureV4,
}, nil
}
// Retrieve retrieves credentials from the MinIO service.
// Error will be returned if the request fails.
func (m *STSAssumeRole) Retrieve() (Value, error) {
return m.RetrieveWithCredContext(nil)
}
+18
View File
@@ -55,6 +55,24 @@ func NewChainCredentials(providers []Provider) *Credentials {
})
}
// RetrieveWithCredContext is like Retrieve with CredContext
func (c *Chain) RetrieveWithCredContext(cc *CredContext) (Value, error) {
for _, p := range c.Providers {
creds, _ := p.RetrieveWithCredContext(cc)
// Always prioritize non-anonymous providers, if any.
if creds.AccessKeyID == "" && creds.SecretAccessKey == "" {
continue
}
c.curr = p
return creds, nil
}
// At this point we have exhausted all the providers and
// are left without any credentials return anonymous.
return Value{
SignerType: SignatureAnonymous,
}, nil
}
// Retrieve returns the credentials value, returns no credentials(anonymous)
// if no credentials provider returned any value.
//
+47 -1
View File
@@ -18,6 +18,7 @@
package credentials
import (
"net/http"
"sync"
"time"
)
@@ -30,6 +31,10 @@ const (
defaultExpiryWindow = 0.8
)
// defaultCredContext is used when the credential context doesn't
// actually matter or the default context is suitable.
var defaultCredContext = &CredContext{Client: http.DefaultClient}
// A Value is the S3 credentials value for individual credential fields.
type Value struct {
// S3 Access key ID
@@ -52,8 +57,17 @@ type Value struct {
// Value. A provider is required to manage its own Expired state, and what to
// be expired means.
type Provider interface {
// RetrieveWithCredContext returns nil if it successfully retrieved the
// value. Error is returned if the value were not obtainable, or empty.
// optionally takes CredContext for additional context to retrieve credentials.
RetrieveWithCredContext(cc *CredContext) (Value, error)
// Retrieve returns nil if it successfully retrieved the value.
// Error is returned if the value were not obtainable, or empty.
//
// Deprecated: Retrieve() exists for historical compatibility and should not
// be used. To get new credentials use the RetrieveWithCredContext function
// to ensure the proper context (i.e. HTTP client) will be used.
Retrieve() (Value, error)
// IsExpired returns if the credentials are no longer valid, and need
@@ -61,6 +75,18 @@ type Provider interface {
IsExpired() bool
}
// CredContext is passed to the Retrieve function of a provider to provide
// some additional context to retrieve credentials.
type CredContext struct {
// Client specifies the HTTP client that should be used if an HTTP
// request is to be made to fetch the credentials.
Client *http.Client
// Endpoint specifies the MinIO endpoint that will be used if no
// explicit endpoint is provided.
Endpoint string
}
// A Expiry provides shared expiration logic to be used by credentials
// providers to implement expiry functionality.
//
@@ -146,16 +172,36 @@ func New(provider Provider) *Credentials {
//
// If Credentials.Expire() was called the credentials Value will be force
// expired, and the next call to Get() will cause them to be refreshed.
//
// Deprecated: Get() exists for historical compatibility and should not be
// used. To get new credentials use the Credentials.GetWithContext function
// to ensure the proper context (i.e. HTTP client) will be used.
func (c *Credentials) Get() (Value, error) {
return c.GetWithContext(nil)
}
// GetWithContext returns the credentials value, or error if the
// credentials Value failed to be retrieved.
//
// Will return the cached credentials Value if it has not expired. If the
// credentials Value has expired the Provider's Retrieve() will be called
// to refresh the credentials.
//
// If Credentials.Expire() was called the credentials Value will be force
// expired, and the next call to Get() will cause them to be refreshed.
func (c *Credentials) GetWithContext(cc *CredContext) (Value, error) {
if c == nil {
return Value{}, nil
}
if cc == nil {
cc = defaultCredContext
}
c.Lock()
defer c.Unlock()
if c.isExpired() {
creds, err := c.provider.Retrieve()
creds, err := c.provider.RetrieveWithCredContext(cc)
if err != nil {
return Value{}, err
}
+11 -2
View File
@@ -37,8 +37,7 @@ func NewEnvAWS() *Credentials {
return New(&EnvAWS{})
}
// Retrieve retrieves the keys from the environment.
func (e *EnvAWS) Retrieve() (Value, error) {
func (e *EnvAWS) retrieve() (Value, error) {
e.retrieved = false
id := os.Getenv("AWS_ACCESS_KEY_ID")
@@ -65,6 +64,16 @@ func (e *EnvAWS) Retrieve() (Value, error) {
}, nil
}
// Retrieve retrieves the keys from the environment.
func (e *EnvAWS) Retrieve() (Value, error) {
return e.retrieve()
}
// RetrieveWithCredContext is like Retrieve (no-op input of Cred Context)
func (e *EnvAWS) RetrieveWithCredContext(_ *CredContext) (Value, error) {
return e.retrieve()
}
// IsExpired returns if the credentials have been retrieved.
func (e *EnvAWS) IsExpired() bool {
return !e.retrieved
+11 -2
View File
@@ -38,8 +38,7 @@ func NewEnvMinio() *Credentials {
return New(&EnvMinio{})
}
// Retrieve retrieves the keys from the environment.
func (e *EnvMinio) Retrieve() (Value, error) {
func (e *EnvMinio) retrieve() (Value, error) {
e.retrieved = false
id := os.Getenv("MINIO_ROOT_USER")
@@ -62,6 +61,16 @@ func (e *EnvMinio) Retrieve() (Value, error) {
}, nil
}
// Retrieve retrieves the keys from the environment.
func (e *EnvMinio) Retrieve() (Value, error) {
return e.retrieve()
}
// RetrieveWithCredContext is like Retrieve() (no-op input cred context)
func (e *EnvMinio) RetrieveWithCredContext(_ *CredContext) (Value, error) {
return e.retrieve()
}
// IsExpired returns if the credentials have been retrieved.
func (e *EnvMinio) IsExpired() bool {
return !e.retrieved
@@ -71,9 +71,7 @@ func NewFileAWSCredentials(filename, profile string) *Credentials {
})
}
// Retrieve reads and extracts the shared credentials from the current
// users home directory.
func (p *FileAWSCredentials) Retrieve() (Value, error) {
func (p *FileAWSCredentials) retrieve() (Value, error) {
if p.Filename == "" {
p.Filename = os.Getenv("AWS_SHARED_CREDENTIALS_FILE")
if p.Filename == "" {
@@ -142,6 +140,17 @@ func (p *FileAWSCredentials) Retrieve() (Value, error) {
}, nil
}
// Retrieve reads and extracts the shared credentials from the current
// users home directory.
func (p *FileAWSCredentials) Retrieve() (Value, error) {
return p.retrieve()
}
// RetrieveWithCredContext is like Retrieve(), cred context is no-op for File credentials
func (p *FileAWSCredentials) RetrieveWithCredContext(_ *CredContext) (Value, error) {
return p.retrieve()
}
// loadProfiles loads from the file pointed to by shared credentials filename for profile.
// The credentials retrieved from the profile will be returned or error. Error will be
// returned if it fails to read from the file, or the data is invalid.
+12 -3
View File
@@ -56,9 +56,7 @@ func NewFileMinioClient(filename, alias string) *Credentials {
})
}
// Retrieve reads and extracts the shared credentials from the current
// users home directory.
func (p *FileMinioClient) Retrieve() (Value, error) {
func (p *FileMinioClient) retrieve() (Value, error) {
if p.Filename == "" {
if value, ok := os.LookupEnv("MINIO_SHARED_CREDENTIALS_FILE"); ok {
p.Filename = value
@@ -96,6 +94,17 @@ func (p *FileMinioClient) Retrieve() (Value, error) {
}, nil
}
// Retrieve reads and extracts the shared credentials from the current
// users home directory.
func (p *FileMinioClient) Retrieve() (Value, error) {
return p.retrieve()
}
// RetrieveWithCredContext - is like Retrieve()
func (p *FileMinioClient) RetrieveWithCredContext(_ *CredContext) (Value, error) {
return p.retrieve()
}
// IsExpired returns if the shared credentials have expired.
func (p *FileMinioClient) IsExpired() bool {
return !p.retrieved
+30 -14
View File
@@ -49,7 +49,8 @@ const DefaultExpiryWindow = -1
type IAM struct {
Expiry
// Required http Client to use when connecting to IAM metadata service.
// Optional http Client to use when connecting to IAM metadata service
// (overrides default client in CredContext)
Client *http.Client
// Custom endpoint to fetch IAM role credentials.
@@ -90,17 +91,16 @@ const (
// NewIAM returns a pointer to a new Credentials object wrapping the IAM.
func NewIAM(endpoint string) *Credentials {
return New(&IAM{
Client: &http.Client{
Transport: http.DefaultTransport,
},
Endpoint: endpoint,
})
}
// Retrieve retrieves credentials from the EC2 service.
// Error will be returned if the request fails, or unable to extract
// the desired
func (m *IAM) Retrieve() (Value, error) {
// RetrieveWithCredContext is like Retrieve with Cred Context
func (m *IAM) RetrieveWithCredContext(cc *CredContext) (Value, error) {
if cc == nil {
cc = defaultCredContext
}
token := os.Getenv("AWS_CONTAINER_AUTHORIZATION_TOKEN")
if token == "" {
token = m.Container.AuthorizationToken
@@ -144,7 +144,16 @@ func (m *IAM) Retrieve() (Value, error) {
var roleCreds ec2RoleCredRespBody
var err error
client := m.Client
if client == nil {
client = cc.Client
}
if client == nil {
client = defaultCredContext.Client
}
endpoint := m.Endpoint
switch {
case identityFile != "":
if len(endpoint) == 0 {
@@ -160,7 +169,7 @@ func (m *IAM) Retrieve() (Value, error) {
}
creds := &STSWebIdentity{
Client: m.Client,
Client: client,
STSEndpoint: endpoint,
GetWebIDTokenExpiry: func() (*WebIdentityToken, error) {
token, err := os.ReadFile(identityFile)
@@ -174,7 +183,7 @@ func (m *IAM) Retrieve() (Value, error) {
roleSessionName: roleSessionName,
}
stsWebIdentityCreds, err := creds.Retrieve()
stsWebIdentityCreds, err := creds.RetrieveWithCredContext(cc)
if err == nil {
m.SetExpiration(creds.Expiration(), DefaultExpiryWindow)
}
@@ -185,11 +194,11 @@ func (m *IAM) Retrieve() (Value, error) {
endpoint = fmt.Sprintf("%s%s", DefaultECSRoleEndpoint, relativeURI)
}
roleCreds, err = getEcsTaskCredentials(m.Client, endpoint, token)
roleCreds, err = getEcsTaskCredentials(client, endpoint, token)
case tokenFile != "" && fullURI != "":
endpoint = fullURI
roleCreds, err = getEKSPodIdentityCredentials(m.Client, endpoint, tokenFile)
roleCreds, err = getEKSPodIdentityCredentials(client, endpoint, tokenFile)
case fullURI != "":
if len(endpoint) == 0 {
@@ -203,10 +212,10 @@ func (m *IAM) Retrieve() (Value, error) {
}
}
roleCreds, err = getEcsTaskCredentials(m.Client, endpoint, token)
roleCreds, err = getEcsTaskCredentials(client, endpoint, token)
default:
roleCreds, err = getCredentials(m.Client, endpoint)
roleCreds, err = getCredentials(client, endpoint)
}
if err != nil {
@@ -224,6 +233,13 @@ func (m *IAM) Retrieve() (Value, error) {
}, nil
}
// Retrieve retrieves credentials from the EC2 service.
// Error will be returned if the request fails, or unable to extract
// the desired
func (m *IAM) Retrieve() (Value, error) {
return m.RetrieveWithCredContext(nil)
}
// A ec2RoleCredRespBody provides the shape for unmarshaling credential
// request responses.
type ec2RoleCredRespBody struct {
+5
View File
@@ -59,6 +59,11 @@ func (s *Static) Retrieve() (Value, error) {
return s.Value, nil
}
// RetrieveWithCredContext returns the static credentials.
func (s *Static) RetrieveWithCredContext(_ *CredContext) (Value, error) {
return s.Retrieve()
}
// IsExpired returns if the credentials are expired.
//
// For Static, the credentials never expired.
+31 -11
View File
@@ -72,7 +72,8 @@ type ClientGrantsToken struct {
type STSClientGrants struct {
Expiry
// Required http Client to use when connecting to MinIO STS service.
// Optional http Client to use when connecting to MinIO STS service.
// (overrides default client in CredContext)
Client *http.Client
// MinIO endpoint to fetch STS credentials.
@@ -90,16 +91,10 @@ type STSClientGrants struct {
// NewSTSClientGrants returns a pointer to a new
// Credentials object wrapping the STSClientGrants.
func NewSTSClientGrants(stsEndpoint string, getClientGrantsTokenExpiry func() (*ClientGrantsToken, error)) (*Credentials, error) {
if stsEndpoint == "" {
return nil, errors.New("STS endpoint cannot be empty")
}
if getClientGrantsTokenExpiry == nil {
return nil, errors.New("Client grants access token and expiry retrieval function should be defined")
}
return New(&STSClientGrants{
Client: &http.Client{
Transport: http.DefaultTransport,
},
STSEndpoint: stsEndpoint,
GetClientGrantsTokenExpiry: getClientGrantsTokenExpiry,
}), nil
@@ -162,10 +157,29 @@ func getClientGrantsCredentials(clnt *http.Client, endpoint string,
return a, nil
}
// Retrieve retrieves credentials from the MinIO service.
// Error will be returned if the request fails.
func (m *STSClientGrants) Retrieve() (Value, error) {
a, err := getClientGrantsCredentials(m.Client, m.STSEndpoint, m.GetClientGrantsTokenExpiry)
// RetrieveWithCredContext is like Retrieve() with cred context
func (m *STSClientGrants) RetrieveWithCredContext(cc *CredContext) (Value, error) {
if cc == nil {
cc = defaultCredContext
}
client := m.Client
if client == nil {
client = cc.Client
}
if client == nil {
client = defaultCredContext.Client
}
stsEndpoint := m.STSEndpoint
if stsEndpoint == "" {
stsEndpoint = cc.Endpoint
}
if stsEndpoint == "" {
return Value{}, errors.New("STS endpoint unknown")
}
a, err := getClientGrantsCredentials(client, stsEndpoint, m.GetClientGrantsTokenExpiry)
if err != nil {
return Value{}, err
}
@@ -181,3 +195,9 @@ func (m *STSClientGrants) Retrieve() (Value, error) {
SignerType: SignatureV4,
}, nil
}
// Retrieve retrieves credentials from the MinIO service.
// Error will be returned if the request fails.
func (m *STSClientGrants) Retrieve() (Value, error) {
return m.RetrieveWithCredContext(nil)
}
+31 -5
View File
@@ -53,6 +53,8 @@ type AssumeRoleWithCustomTokenResponse struct {
type CustomTokenIdentity struct {
Expiry
// Optional http Client to use when connecting to MinIO STS service.
// (overrides default client in CredContext)
Client *http.Client
// MinIO server STS endpoint to fetch STS credentials.
@@ -69,9 +71,21 @@ type CustomTokenIdentity struct {
RequestedExpiry time.Duration
}
// Retrieve - to satisfy Provider interface; fetches credentials from MinIO.
func (c *CustomTokenIdentity) Retrieve() (value Value, err error) {
u, err := url.Parse(c.STSEndpoint)
// RetrieveWithCredContext with Retrieve optionally cred context
func (c *CustomTokenIdentity) RetrieveWithCredContext(cc *CredContext) (value Value, err error) {
if cc == nil {
cc = defaultCredContext
}
stsEndpoint := c.STSEndpoint
if stsEndpoint == "" {
stsEndpoint = cc.Endpoint
}
if stsEndpoint == "" {
return Value{}, errors.New("STS endpoint unknown")
}
u, err := url.Parse(stsEndpoint)
if err != nil {
return value, err
}
@@ -92,7 +106,15 @@ func (c *CustomTokenIdentity) Retrieve() (value Value, err error) {
return value, err
}
resp, err := c.Client.Do(req)
client := c.Client
if client == nil {
client = cc.Client
}
if client == nil {
client = defaultCredContext.Client
}
resp, err := client.Do(req)
if err != nil {
return value, err
}
@@ -118,11 +140,15 @@ func (c *CustomTokenIdentity) Retrieve() (value Value, err error) {
}, nil
}
// Retrieve - to satisfy Provider interface; fetches credentials from MinIO.
func (c *CustomTokenIdentity) Retrieve() (value Value, err error) {
return c.RetrieveWithCredContext(nil)
}
// NewCustomTokenCredentials - returns credentials using the
// AssumeRoleWithCustomToken STS API.
func NewCustomTokenCredentials(stsEndpoint, token, roleArn string, optFuncs ...CustomTokenOpt) (*Credentials, error) {
c := CustomTokenIdentity{
Client: &http.Client{Transport: http.DefaultTransport},
STSEndpoint: stsEndpoint,
Token: token,
RoleArn: roleArn,
+33 -7
View File
@@ -20,6 +20,7 @@ package credentials
import (
"bytes"
"encoding/xml"
"errors"
"fmt"
"io"
"net/http"
@@ -55,7 +56,8 @@ type LDAPIdentityResult struct {
type LDAPIdentity struct {
Expiry
// Required http Client to use when connecting to MinIO STS service.
// Optional http Client to use when connecting to MinIO STS service.
// (overrides default client in CredContext)
Client *http.Client
// Exported STS endpoint to fetch STS credentials.
@@ -77,7 +79,6 @@ type LDAPIdentity struct {
// Identity.
func NewLDAPIdentity(stsEndpoint, ldapUsername, ldapPassword string, optFuncs ...LDAPIdentityOpt) (*Credentials, error) {
l := LDAPIdentity{
Client: &http.Client{Transport: http.DefaultTransport},
STSEndpoint: stsEndpoint,
LDAPUsername: ldapUsername,
LDAPPassword: ldapPassword,
@@ -113,7 +114,6 @@ func LDAPIdentityExpiryOpt(d time.Duration) LDAPIdentityOpt {
// Deprecated: Use the `LDAPIdentityPolicyOpt` with `NewLDAPIdentity` instead.
func NewLDAPIdentityWithSessionPolicy(stsEndpoint, ldapUsername, ldapPassword, policy string) (*Credentials, error) {
return New(&LDAPIdentity{
Client: &http.Client{Transport: http.DefaultTransport},
STSEndpoint: stsEndpoint,
LDAPUsername: ldapUsername,
LDAPPassword: ldapPassword,
@@ -121,10 +121,22 @@ func NewLDAPIdentityWithSessionPolicy(stsEndpoint, ldapUsername, ldapPassword, p
}), nil
}
// Retrieve gets the credential by calling the MinIO STS API for
// RetrieveWithCredContext gets the credential by calling the MinIO STS API for
// LDAP on the configured stsEndpoint.
func (k *LDAPIdentity) Retrieve() (value Value, err error) {
u, err := url.Parse(k.STSEndpoint)
func (k *LDAPIdentity) RetrieveWithCredContext(cc *CredContext) (value Value, err error) {
if cc == nil {
cc = defaultCredContext
}
stsEndpoint := k.STSEndpoint
if stsEndpoint == "" {
stsEndpoint = cc.Endpoint
}
if stsEndpoint == "" {
return Value{}, errors.New("STS endpoint unknown")
}
u, err := url.Parse(stsEndpoint)
if err != nil {
return value, err
}
@@ -148,7 +160,15 @@ func (k *LDAPIdentity) Retrieve() (value Value, err error) {
req.Header.Set("Content-Type", "application/x-www-form-urlencoded")
resp, err := k.Client.Do(req)
client := k.Client
if client == nil {
client = cc.Client
}
if client == nil {
client = defaultCredContext.Client
}
resp, err := client.Do(req)
if err != nil {
return value, err
}
@@ -188,3 +208,9 @@ func (k *LDAPIdentity) Retrieve() (value Value, err error) {
SignerType: SignatureV4,
}, nil
}
// Retrieve gets the credential by calling the MinIO STS API for
// LDAP on the configured stsEndpoint.
func (k *LDAPIdentity) Retrieve() (value Value, err error) {
return k.RetrieveWithCredContext(defaultCredContext)
}
+57 -43
View File
@@ -20,8 +20,8 @@ import (
"crypto/tls"
"encoding/xml"
"errors"
"fmt"
"io"
"net"
"net/http"
"net/url"
"strconv"
@@ -36,7 +36,12 @@ type CertificateIdentityOption func(*STSCertificateIdentity)
// CertificateIdentityWithTransport returns a CertificateIdentityOption that
// customizes the STSCertificateIdentity with the given http.RoundTripper.
func CertificateIdentityWithTransport(t http.RoundTripper) CertificateIdentityOption {
return CertificateIdentityOption(func(i *STSCertificateIdentity) { i.Client.Transport = t })
return CertificateIdentityOption(func(i *STSCertificateIdentity) {
if i.Client == nil {
i.Client = &http.Client{}
}
i.Client.Transport = t
})
}
// CertificateIdentityWithExpiry returns a CertificateIdentityOption that
@@ -53,6 +58,10 @@ func CertificateIdentityWithExpiry(livetime time.Duration) CertificateIdentityOp
type STSCertificateIdentity struct {
Expiry
// Optional http Client to use when connecting to MinIO STS service.
// (overrides default client in CredContext)
Client *http.Client
// STSEndpoint is the base URL endpoint of the STS API.
// For example, https://minio.local:9000
STSEndpoint string
@@ -68,50 +77,18 @@ type STSCertificateIdentity struct {
// The default livetime is one hour.
S3CredentialLivetime time.Duration
// Client is the HTTP client used to authenticate and fetch
// S3 credentials.
//
// A custom TLS client configuration can be specified by
// using a custom http.Transport:
// Client: http.Client {
// Transport: &http.Transport{
// TLSClientConfig: &tls.Config{},
// },
// }
Client http.Client
// Certificate is the client certificate that is used for
// STS authentication.
Certificate tls.Certificate
}
var _ Provider = (*STSWebIdentity)(nil) // compiler check
// NewSTSCertificateIdentity returns a STSCertificateIdentity that authenticates
// to the given STS endpoint with the given TLS certificate and retrieves and
// rotates S3 credentials.
func NewSTSCertificateIdentity(endpoint string, certificate tls.Certificate, options ...CertificateIdentityOption) (*Credentials, error) {
if endpoint == "" {
return nil, errors.New("STS endpoint cannot be empty")
}
if _, err := url.Parse(endpoint); err != nil {
return nil, err
}
identity := &STSCertificateIdentity{
STSEndpoint: endpoint,
Client: http.Client{
Transport: &http.Transport{
Proxy: http.ProxyFromEnvironment,
DialContext: (&net.Dialer{
Timeout: 30 * time.Second,
KeepAlive: 30 * time.Second,
}).DialContext,
ForceAttemptHTTP2: true,
MaxIdleConns: 100,
IdleConnTimeout: 90 * time.Second,
TLSHandshakeTimeout: 10 * time.Second,
ExpectContinueTimeout: 5 * time.Second,
TLSClientConfig: &tls.Config{
Certificates: []tls.Certificate{certificate},
},
},
},
Certificate: certificate,
}
for _, option := range options {
option(identity)
@@ -119,10 +96,21 @@ func NewSTSCertificateIdentity(endpoint string, certificate tls.Certificate, opt
return New(identity), nil
}
// Retrieve fetches a new set of S3 credentials from the configured
// STS API endpoint.
func (i *STSCertificateIdentity) Retrieve() (Value, error) {
endpointURL, err := url.Parse(i.STSEndpoint)
// RetrieveWithCredContext is Retrieve with cred context
func (i *STSCertificateIdentity) RetrieveWithCredContext(cc *CredContext) (Value, error) {
if cc == nil {
cc = defaultCredContext
}
stsEndpoint := i.STSEndpoint
if stsEndpoint == "" {
stsEndpoint = cc.Endpoint
}
if stsEndpoint == "" {
return Value{}, errors.New("STS endpoint unknown")
}
endpointURL, err := url.Parse(stsEndpoint)
if err != nil {
return Value{}, err
}
@@ -145,7 +133,28 @@ func (i *STSCertificateIdentity) Retrieve() (Value, error) {
}
req.Form.Add("DurationSeconds", strconv.FormatUint(uint64(livetime.Seconds()), 10))
resp, err := i.Client.Do(req)
client := i.Client
if client == nil {
client = cc.Client
}
if client == nil {
client = defaultCredContext.Client
}
tr, ok := client.Transport.(*http.Transport)
if !ok {
return Value{}, fmt.Errorf("CredContext should contain an http.Transport value")
}
// Clone the HTTP transport (patch the TLS client certificate)
trCopy := tr.Clone()
trCopy.TLSClientConfig.Certificates = []tls.Certificate{i.Certificate}
// Clone the HTTP client (patch the HTTP transport)
clientCopy := *client
clientCopy.Transport = trCopy
resp, err := clientCopy.Do(req)
if err != nil {
return Value{}, err
}
@@ -193,6 +202,11 @@ func (i *STSCertificateIdentity) Retrieve() (Value, error) {
}, nil
}
// Retrieve fetches a new set of S3 credentials from the configured STS API endpoint.
func (i *STSCertificateIdentity) Retrieve() (Value, error) {
return i.RetrieveWithCredContext(defaultCredContext)
}
// Expiration returns the expiration time of the current S3 credentials.
func (i *STSCertificateIdentity) Expiration() time.Time { return i.expiration }
+39 -14
View File
@@ -58,9 +58,10 @@ type WebIdentityResult struct {
// WebIdentityToken - web identity token with expiry.
type WebIdentityToken struct {
Token string
AccessToken string
Expiry int
Token string
AccessToken string
RefreshToken string
Expiry int
}
// A STSWebIdentity retrieves credentials from MinIO service, and keeps track if
@@ -68,7 +69,8 @@ type WebIdentityToken struct {
type STSWebIdentity struct {
Expiry
// Required http Client to use when connecting to MinIO STS service.
// Optional http Client to use when connecting to MinIO STS service.
// (overrides default client in CredContext)
Client *http.Client
// Exported STS endpoint to fetch STS credentials.
@@ -96,16 +98,10 @@ type STSWebIdentity struct {
// NewSTSWebIdentity returns a pointer to a new
// Credentials object wrapping the STSWebIdentity.
func NewSTSWebIdentity(stsEndpoint string, getWebIDTokenExpiry func() (*WebIdentityToken, error), opts ...func(*STSWebIdentity)) (*Credentials, error) {
if stsEndpoint == "" {
return nil, errors.New("STS endpoint cannot be empty")
}
if getWebIDTokenExpiry == nil {
return nil, errors.New("Web ID token and expiry retrieval function should be defined")
}
i := &STSWebIdentity{
Client: &http.Client{
Transport: http.DefaultTransport,
},
STSEndpoint: stsEndpoint,
GetWebIDTokenExpiry: getWebIDTokenExpiry,
}
@@ -161,6 +157,10 @@ func getWebIdentityCredentials(clnt *http.Client, endpoint, roleARN, roleSession
// Usually set when server is using extended userInfo endpoint.
v.Set("WebIdentityAccessToken", idToken.AccessToken)
}
if idToken.RefreshToken != "" {
// Usually set when server is using extended userInfo endpoint.
v.Set("WebIdentityRefreshToken", idToken.RefreshToken)
}
if idToken.Expiry > 0 {
v.Set("DurationSeconds", fmt.Sprintf("%d", idToken.Expiry))
}
@@ -214,10 +214,29 @@ func getWebIdentityCredentials(clnt *http.Client, endpoint, roleARN, roleSession
return a, nil
}
// Retrieve retrieves credentials from the MinIO service.
// Error will be returned if the request fails.
func (m *STSWebIdentity) Retrieve() (Value, error) {
a, err := getWebIdentityCredentials(m.Client, m.STSEndpoint, m.RoleARN, m.roleSessionName, m.Policy, m.GetWebIDTokenExpiry)
// RetrieveWithCredContext is like Retrieve with optional cred context.
func (m *STSWebIdentity) RetrieveWithCredContext(cc *CredContext) (Value, error) {
if cc == nil {
cc = defaultCredContext
}
client := m.Client
if client == nil {
client = cc.Client
}
if client == nil {
client = defaultCredContext.Client
}
stsEndpoint := m.STSEndpoint
if stsEndpoint == "" {
stsEndpoint = cc.Endpoint
}
if stsEndpoint == "" {
return Value{}, errors.New("STS endpoint unknown")
}
a, err := getWebIdentityCredentials(client, stsEndpoint, m.RoleARN, m.roleSessionName, m.Policy, m.GetWebIDTokenExpiry)
if err != nil {
return Value{}, err
}
@@ -234,6 +253,12 @@ func (m *STSWebIdentity) Retrieve() (Value, error) {
}, nil
}
// Retrieve retrieves credentials from the MinIO service.
// Error will be returned if the request fails.
func (m *STSWebIdentity) Retrieve() (Value, error) {
return m.RetrieveWithCredContext(nil)
}
// Expiration returns the expiration time of the credentials
func (m *STSWebIdentity) Expiration() time.Time {
return m.expiration
+26
View File
@@ -434,12 +434,34 @@ func (de DelMarkerExpiration) MarshalXML(enc *xml.Encoder, start xml.StartElemen
return enc.EncodeElement(delMarkerExp(de), start)
}
// AllVersionsExpiration represents AllVersionsExpiration actions element in an ILM policy
type AllVersionsExpiration struct {
XMLName xml.Name `xml:"AllVersionsExpiration" json:"-"`
Days int `xml:"Days,omitempty" json:"Days,omitempty"`
DeleteMarker ExpireDeleteMarker `xml:"DeleteMarker,omitempty" json:"DeleteMarker,omitempty"`
}
// IsNull returns true if days field is 0
func (e AllVersionsExpiration) IsNull() bool {
return e.Days == 0
}
// MarshalXML satisfies xml.Marshaler to provide custom encoding
func (e AllVersionsExpiration) MarshalXML(enc *xml.Encoder, start xml.StartElement) error {
if e.IsNull() {
return nil
}
type allVersionsExp AllVersionsExpiration
return enc.EncodeElement(allVersionsExp(e), start)
}
// MarshalJSON customizes json encoding by omitting empty values
func (r Rule) MarshalJSON() ([]byte, error) {
type rule struct {
AbortIncompleteMultipartUpload *AbortIncompleteMultipartUpload `json:"AbortIncompleteMultipartUpload,omitempty"`
Expiration *Expiration `json:"Expiration,omitempty"`
DelMarkerExpiration *DelMarkerExpiration `json:"DelMarkerExpiration,omitempty"`
AllVersionsExpiration *AllVersionsExpiration `json:"AllVersionsExpiration,omitempty"`
ID string `json:"ID"`
RuleFilter *Filter `json:"Filter,omitempty"`
NoncurrentVersionExpiration *NoncurrentVersionExpiration `json:"NoncurrentVersionExpiration,omitempty"`
@@ -475,6 +497,9 @@ func (r Rule) MarshalJSON() ([]byte, error) {
if !r.NoncurrentVersionTransition.isNull() {
newr.NoncurrentVersionTransition = &r.NoncurrentVersionTransition
}
if !r.AllVersionsExpiration.IsNull() {
newr.AllVersionsExpiration = &r.AllVersionsExpiration
}
return json.Marshal(newr)
}
@@ -485,6 +510,7 @@ type Rule struct {
AbortIncompleteMultipartUpload AbortIncompleteMultipartUpload `xml:"AbortIncompleteMultipartUpload,omitempty" json:"AbortIncompleteMultipartUpload,omitempty"`
Expiration Expiration `xml:"Expiration,omitempty" json:"Expiration,omitempty"`
DelMarkerExpiration DelMarkerExpiration `xml:"DelMarkerExpiration,omitempty" json:"DelMarkerExpiration,omitempty"`
AllVersionsExpiration AllVersionsExpiration `xml:"AllVersionsExpiration,omitempty" json:"AllVersionsExpiration,omitempty"`
ID string `xml:"ID" json:"ID"`
RuleFilter Filter `xml:"Filter,omitempty" json:"Filter,omitempty"`
NoncurrentVersionExpiration NoncurrentVersionExpiration `xml:"NoncurrentVersionExpiration,omitempty" json:"NoncurrentVersionExpiration,omitempty"`
+11 -49
View File
@@ -118,53 +118,53 @@ func GetRegionFromURL(endpointURL url.URL) string {
if endpointURL == sentinelURL {
return ""
}
if endpointURL.Host == "s3-external-1.amazonaws.com" {
if endpointURL.Hostname() == "s3-external-1.amazonaws.com" {
return ""
}
// if elb's are used we cannot calculate which region it may be, just return empty.
if elbAmazonRegex.MatchString(endpointURL.Host) || elbAmazonCnRegex.MatchString(endpointURL.Host) {
if elbAmazonRegex.MatchString(endpointURL.Hostname()) || elbAmazonCnRegex.MatchString(endpointURL.Hostname()) {
return ""
}
// We check for FIPS dualstack matching first to avoid the non-greedy
// regex for FIPS non-dualstack matching a dualstack URL
parts := amazonS3HostFIPSDualStack.FindStringSubmatch(endpointURL.Host)
parts := amazonS3HostFIPSDualStack.FindStringSubmatch(endpointURL.Hostname())
if len(parts) > 1 {
return parts[1]
}
parts = amazonS3HostFIPS.FindStringSubmatch(endpointURL.Host)
parts = amazonS3HostFIPS.FindStringSubmatch(endpointURL.Hostname())
if len(parts) > 1 {
return parts[1]
}
parts = amazonS3HostDualStack.FindStringSubmatch(endpointURL.Host)
parts = amazonS3HostDualStack.FindStringSubmatch(endpointURL.Hostname())
if len(parts) > 1 {
return parts[1]
}
parts = amazonS3HostHyphen.FindStringSubmatch(endpointURL.Host)
parts = amazonS3HostHyphen.FindStringSubmatch(endpointURL.Hostname())
if len(parts) > 1 {
return parts[1]
}
parts = amazonS3ChinaHost.FindStringSubmatch(endpointURL.Host)
parts = amazonS3ChinaHost.FindStringSubmatch(endpointURL.Hostname())
if len(parts) > 1 {
return parts[1]
}
parts = amazonS3ChinaHostDualStack.FindStringSubmatch(endpointURL.Host)
parts = amazonS3ChinaHostDualStack.FindStringSubmatch(endpointURL.Hostname())
if len(parts) > 1 {
return parts[1]
}
parts = amazonS3HostDot.FindStringSubmatch(endpointURL.Host)
parts = amazonS3HostDot.FindStringSubmatch(endpointURL.Hostname())
if len(parts) > 1 {
return parts[1]
}
parts = amazonS3HostPrivateLink.FindStringSubmatch(endpointURL.Host)
parts = amazonS3HostPrivateLink.FindStringSubmatch(endpointURL.Hostname())
if len(parts) > 1 {
return parts[1]
}
@@ -218,7 +218,7 @@ func IsAmazonPrivateLinkEndpoint(endpointURL url.URL) bool {
if endpointURL == sentinelURL {
return false
}
return amazonS3HostPrivateLink.MatchString(endpointURL.Host)
return amazonS3HostPrivateLink.MatchString(endpointURL.Hostname())
}
// IsGoogleEndpoint - Match if it is exactly Google cloud storage endpoint.
@@ -261,44 +261,6 @@ func QueryEncode(v url.Values) string {
return buf.String()
}
// TagDecode - decodes canonical tag into map of key and value.
func TagDecode(ctag string) map[string]string {
if ctag == "" {
return map[string]string{}
}
tags := strings.Split(ctag, "&")
tagMap := make(map[string]string, len(tags))
var err error
for _, tag := range tags {
kvs := strings.SplitN(tag, "=", 2)
if len(kvs) == 0 {
return map[string]string{}
}
if len(kvs) == 1 {
return map[string]string{}
}
tagMap[kvs[0]], err = url.PathUnescape(kvs[1])
if err != nil {
continue
}
}
return tagMap
}
// TagEncode - encodes tag values in their URL encoded form. In
// addition to the percent encoding performed by urlEncodePath() used
// here, it also percent encodes '/' (forward slash)
func TagEncode(tags map[string]string) string {
if tags == nil {
return ""
}
values := url.Values{}
for k, v := range tags {
values[k] = []string{v}
}
return QueryEncode(values)
}
// if object matches reserved string, no need to encode them
var reservedObjectNames = regexp.MustCompile("^[a-zA-Z0-9-_.~/]+$")
+53 -18
View File
@@ -85,7 +85,7 @@ func (p *PostPolicy) SetExpires(t time.Time) error {
// SetKey - Sets an object name for the policy based upload.
func (p *PostPolicy) SetKey(key string) error {
if strings.TrimSpace(key) == "" || key == "" {
if strings.TrimSpace(key) == "" {
return errInvalidArgument("Object name is empty.")
}
policyCond := policyCondition{
@@ -118,7 +118,7 @@ func (p *PostPolicy) SetKeyStartsWith(keyStartsWith string) error {
// SetBucket - Sets bucket at which objects will be uploaded to.
func (p *PostPolicy) SetBucket(bucketName string) error {
if strings.TrimSpace(bucketName) == "" || bucketName == "" {
if strings.TrimSpace(bucketName) == "" {
return errInvalidArgument("Bucket name is empty.")
}
policyCond := policyCondition{
@@ -135,7 +135,7 @@ func (p *PostPolicy) SetBucket(bucketName string) error {
// SetCondition - Sets condition for credentials, date and algorithm
func (p *PostPolicy) SetCondition(matchType, condition, value string) error {
if strings.TrimSpace(value) == "" || value == "" {
if strings.TrimSpace(value) == "" {
return errInvalidArgument("No value specified for condition")
}
@@ -156,7 +156,7 @@ func (p *PostPolicy) SetCondition(matchType, condition, value string) error {
// SetTagging - Sets tagging for the object for this policy based upload.
func (p *PostPolicy) SetTagging(tagging string) error {
if strings.TrimSpace(tagging) == "" || tagging == "" {
if strings.TrimSpace(tagging) == "" {
return errInvalidArgument("No tagging specified.")
}
_, err := tags.ParseObjectXML(strings.NewReader(tagging))
@@ -178,7 +178,7 @@ func (p *PostPolicy) SetTagging(tagging string) error {
// SetContentType - Sets content-type of the object for this policy
// based upload.
func (p *PostPolicy) SetContentType(contentType string) error {
if strings.TrimSpace(contentType) == "" || contentType == "" {
if strings.TrimSpace(contentType) == "" {
return errInvalidArgument("No content type specified.")
}
policyCond := policyCondition{
@@ -211,7 +211,7 @@ func (p *PostPolicy) SetContentTypeStartsWith(contentTypeStartsWith string) erro
// SetContentDisposition - Sets content-disposition of the object for this policy
func (p *PostPolicy) SetContentDisposition(contentDisposition string) error {
if strings.TrimSpace(contentDisposition) == "" || contentDisposition == "" {
if strings.TrimSpace(contentDisposition) == "" {
return errInvalidArgument("No content disposition specified.")
}
policyCond := policyCondition{
@@ -226,27 +226,44 @@ func (p *PostPolicy) SetContentDisposition(contentDisposition string) error {
return nil
}
// SetContentEncoding - Sets content-encoding of the object for this policy
func (p *PostPolicy) SetContentEncoding(contentEncoding string) error {
if strings.TrimSpace(contentEncoding) == "" {
return errInvalidArgument("No content encoding specified.")
}
policyCond := policyCondition{
matchType: "eq",
condition: "$Content-Encoding",
value: contentEncoding,
}
if err := p.addNewPolicy(policyCond); err != nil {
return err
}
p.formData["Content-Encoding"] = contentEncoding
return nil
}
// SetContentLengthRange - Set new min and max content length
// condition for all incoming uploads.
func (p *PostPolicy) SetContentLengthRange(min, max int64) error {
if min > max {
func (p *PostPolicy) SetContentLengthRange(minLen, maxLen int64) error {
if minLen > maxLen {
return errInvalidArgument("Minimum limit is larger than maximum limit.")
}
if min < 0 {
if minLen < 0 {
return errInvalidArgument("Minimum limit cannot be negative.")
}
if max <= 0 {
if maxLen <= 0 {
return errInvalidArgument("Maximum limit cannot be non-positive.")
}
p.contentLengthRange.min = min
p.contentLengthRange.max = max
p.contentLengthRange.min = minLen
p.contentLengthRange.max = maxLen
return nil
}
// SetSuccessActionRedirect - Sets the redirect success url of the object for this policy
// based upload.
func (p *PostPolicy) SetSuccessActionRedirect(redirect string) error {
if strings.TrimSpace(redirect) == "" || redirect == "" {
if strings.TrimSpace(redirect) == "" {
return errInvalidArgument("Redirect is empty")
}
policyCond := policyCondition{
@@ -264,7 +281,7 @@ func (p *PostPolicy) SetSuccessActionRedirect(redirect string) error {
// SetSuccessStatusAction - Sets the status success code of the object for this policy
// based upload.
func (p *PostPolicy) SetSuccessStatusAction(status string) error {
if strings.TrimSpace(status) == "" || status == "" {
if strings.TrimSpace(status) == "" {
return errInvalidArgument("Status is empty")
}
policyCond := policyCondition{
@@ -282,10 +299,10 @@ func (p *PostPolicy) SetSuccessStatusAction(status string) error {
// SetUserMetadata - Set user metadata as a key/value couple.
// Can be retrieved through a HEAD request or an event.
func (p *PostPolicy) SetUserMetadata(key, value string) error {
if strings.TrimSpace(key) == "" || key == "" {
if strings.TrimSpace(key) == "" {
return errInvalidArgument("Key is empty")
}
if strings.TrimSpace(value) == "" || value == "" {
if strings.TrimSpace(value) == "" {
return errInvalidArgument("Value is empty")
}
headerName := fmt.Sprintf("x-amz-meta-%s", key)
@@ -304,7 +321,7 @@ func (p *PostPolicy) SetUserMetadata(key, value string) error {
// SetUserMetadataStartsWith - Set how an user metadata should starts with.
// Can be retrieved through a HEAD request or an event.
func (p *PostPolicy) SetUserMetadataStartsWith(key, value string) error {
if strings.TrimSpace(key) == "" || key == "" {
if strings.TrimSpace(key) == "" {
return errInvalidArgument("Key is empty")
}
headerName := fmt.Sprintf("x-amz-meta-%s", key)
@@ -321,11 +338,29 @@ func (p *PostPolicy) SetUserMetadataStartsWith(key, value string) error {
}
// SetChecksum sets the checksum of the request.
func (p *PostPolicy) SetChecksum(c Checksum) {
func (p *PostPolicy) SetChecksum(c Checksum) error {
if c.IsSet() {
p.formData[amzChecksumAlgo] = c.Type.String()
p.formData[c.Type.Key()] = c.Encoded()
policyCond := policyCondition{
matchType: "eq",
condition: fmt.Sprintf("$%s", amzChecksumAlgo),
value: c.Type.String(),
}
if err := p.addNewPolicy(policyCond); err != nil {
return err
}
policyCond = policyCondition{
matchType: "eq",
condition: fmt.Sprintf("$%s", c.Type.Key()),
value: c.Encoded(),
}
if err := p.addNewPolicy(policyCond); err != nil {
return err
}
}
return nil
}
// SetEncryption - sets encryption headers for POST API
+5 -5
View File
@@ -20,7 +20,7 @@ package minio
import "time"
// newRetryTimerContinous creates a timer with exponentially increasing delays forever.
func (c *Client) newRetryTimerContinous(unit, cap time.Duration, jitter float64, doneCh chan struct{}) <-chan int {
func (c *Client) newRetryTimerContinous(baseSleep, maxSleep time.Duration, jitter float64, doneCh chan struct{}) <-chan int {
attemptCh := make(chan int)
// normalize jitter to the range [0, 1.0]
@@ -39,10 +39,10 @@ func (c *Client) newRetryTimerContinous(unit, cap time.Duration, jitter float64,
if attempt > maxAttempt {
attempt = maxAttempt
}
// sleep = random_between(0, min(cap, base * 2 ** attempt))
sleep := unit * time.Duration(1<<uint(attempt))
if sleep > cap {
sleep = cap
// sleep = random_between(0, min(maxSleep, base * 2 ** attempt))
sleep := baseSleep * time.Duration(1<<uint(attempt))
if sleep > maxSleep {
sleep = maxSleep
}
if jitter != NoJitter {
sleep -= time.Duration(c.random.Float64() * float64(sleep) * jitter)
+6 -5
View File
@@ -45,7 +45,7 @@ var DefaultRetryCap = time.Second
// newRetryTimer creates a timer with exponentially increasing
// delays until the maximum retry attempts are reached.
func (c *Client) newRetryTimer(ctx context.Context, maxRetry int, unit, cap time.Duration, jitter float64) <-chan int {
func (c *Client) newRetryTimer(ctx context.Context, maxRetry int, baseSleep, maxSleep time.Duration, jitter float64) <-chan int {
attemptCh := make(chan int)
// computes the exponential backoff duration according to
@@ -59,10 +59,10 @@ func (c *Client) newRetryTimer(ctx context.Context, maxRetry int, unit, cap time
jitter = MaxJitter
}
// sleep = random_between(0, min(cap, base * 2 ** attempt))
sleep := unit * time.Duration(1<<uint(attempt))
if sleep > cap {
sleep = cap
// sleep = random_between(0, min(maxSleep, base * 2 ** attempt))
sleep := baseSleep * time.Duration(1<<uint(attempt))
if sleep > maxSleep {
sleep = maxSleep
}
if jitter != NoJitter {
sleep -= time.Duration(c.random.Float64() * float64(sleep) * jitter)
@@ -112,6 +112,7 @@ func isS3CodeRetryable(s3Code string) (ok bool) {
// List of HTTP status codes which are retryable.
var retryableHTTPStatusCodes = map[int]struct{}{
http.StatusRequestTimeout: {},
429: {}, // http.StatusTooManyRequests is not part of the Go 1.5 library, yet
499: {}, // client closed request, retry. A non-standard status code introduced by nginx.
http.StatusInternalServerError: {},
+12
View File
@@ -32,6 +32,18 @@ var awsS3EndpointMap = map[string]awsS3Endpoint{
"s3.us-east-2.amazonaws.com",
"s3.dualstack.us-east-2.amazonaws.com",
},
"us-iso-east-1": {
"s3.us-iso-east-1.c2s.ic.gov",
"s3.dualstack.us-iso-east-1.c2s.ic.gov",
},
"us-isob-east-1": {
"s3.us-isob-east-1.sc2s.sgov.gov",
"s3.dualstack.us-isob-east-1.sc2s.sgov.gov",
},
"us-iso-west-1": {
"s3.us-iso-west-1.c2s.ic.gov",
"s3.dualstack.us-iso-west-1.c2s.ic.gov",
},
"us-west-2": {
"s3.us-west-2.amazonaws.com",
"s3.dualstack.us-west-2.amazonaws.com",
+157 -6
View File
@@ -41,6 +41,7 @@ import (
md5simd "github.com/minio/md5-simd"
"github.com/minio/minio-go/v7/pkg/s3utils"
"github.com/minio/minio-go/v7/pkg/tags"
)
func trimEtag(etag string) string {
@@ -322,7 +323,13 @@ func ToObjectInfo(bucketName, objectName string, h http.Header) (ObjectInfo, err
userMetadata[strings.TrimPrefix(k, "X-Amz-Meta-")] = v[0]
}
}
userTags := s3utils.TagDecode(h.Get(amzTaggingHeader))
userTags, err := tags.ParseObjectTags(h.Get(amzTaggingHeader))
if err != nil {
return ObjectInfo{}, ErrorResponse{
Code: "InternalError",
}
}
var tagCount int
if count := h.Get(amzTaggingCount); count != "" {
@@ -373,15 +380,16 @@ func ToObjectInfo(bucketName, objectName string, h http.Header) (ObjectInfo, err
// which are not part of object metadata.
Metadata: metadata,
UserMetadata: userMetadata,
UserTags: userTags,
UserTags: userTags.ToMap(),
UserTagCount: tagCount,
Restore: restore,
// Checksum values
ChecksumCRC32: h.Get("x-amz-checksum-crc32"),
ChecksumCRC32C: h.Get("x-amz-checksum-crc32c"),
ChecksumSHA1: h.Get("x-amz-checksum-sha1"),
ChecksumSHA256: h.Get("x-amz-checksum-sha256"),
ChecksumCRC32: h.Get(ChecksumCRC32.Key()),
ChecksumCRC32C: h.Get(ChecksumCRC32C.Key()),
ChecksumSHA1: h.Get(ChecksumSHA1.Key()),
ChecksumSHA256: h.Get(ChecksumSHA256.Key()),
ChecksumCRC64NVME: h.Get(ChecksumCRC64NVME.Key()),
}, nil
}
@@ -698,3 +706,146 @@ func (h *hashReaderWrapper) Read(p []byte) (n int, err error) {
}
return n, err
}
// Following is ported from C to Go in 2016 by Justin Ruggles, with minimal alteration.
// Used uint for unsigned long. Used uint32 for input arguments in order to match
// the Go hash/crc32 package. zlib CRC32 combine (https://github.com/madler/zlib)
// Modified for hash/crc64 by Klaus Post, 2024.
func gf2MatrixTimes(mat []uint64, vec uint64) uint64 {
var sum uint64
for vec != 0 {
if vec&1 != 0 {
sum ^= mat[0]
}
vec >>= 1
mat = mat[1:]
}
return sum
}
func gf2MatrixSquare(square, mat []uint64) {
if len(square) != len(mat) {
panic("square matrix size mismatch")
}
for n := range mat {
square[n] = gf2MatrixTimes(mat, mat[n])
}
}
// crc32Combine returns the combined CRC-32 hash value of the two passed CRC-32
// hash values crc1 and crc2. poly represents the generator polynomial
// and len2 specifies the byte length that the crc2 hash covers.
func crc32Combine(poly uint32, crc1, crc2 uint32, len2 int64) uint32 {
// degenerate case (also disallow negative lengths)
if len2 <= 0 {
return crc1
}
even := make([]uint64, 32) // even-power-of-two zeros operator
odd := make([]uint64, 32) // odd-power-of-two zeros operator
// put operator for one zero bit in odd
odd[0] = uint64(poly) // CRC-32 polynomial
row := uint64(1)
for n := 1; n < 32; n++ {
odd[n] = row
row <<= 1
}
// put operator for two zero bits in even
gf2MatrixSquare(even, odd)
// put operator for four zero bits in odd
gf2MatrixSquare(odd, even)
// apply len2 zeros to crc1 (first square will put the operator for one
// zero byte, eight zero bits, in even)
crc1n := uint64(crc1)
for {
// apply zeros operator for this bit of len2
gf2MatrixSquare(even, odd)
if len2&1 != 0 {
crc1n = gf2MatrixTimes(even, crc1n)
}
len2 >>= 1
// if no more bits set, then done
if len2 == 0 {
break
}
// another iteration of the loop with odd and even swapped
gf2MatrixSquare(odd, even)
if len2&1 != 0 {
crc1n = gf2MatrixTimes(odd, crc1n)
}
len2 >>= 1
// if no more bits set, then done
if len2 == 0 {
break
}
}
// return combined crc
crc1n ^= uint64(crc2)
return uint32(crc1n)
}
func crc64Combine(poly uint64, crc1, crc2 uint64, len2 int64) uint64 {
// degenerate case (also disallow negative lengths)
if len2 <= 0 {
return crc1
}
even := make([]uint64, 64) // even-power-of-two zeros operator
odd := make([]uint64, 64) // odd-power-of-two zeros operator
// put operator for one zero bit in odd
odd[0] = poly // CRC-64 polynomial
row := uint64(1)
for n := 1; n < 64; n++ {
odd[n] = row
row <<= 1
}
// put operator for two zero bits in even
gf2MatrixSquare(even, odd)
// put operator for four zero bits in odd
gf2MatrixSquare(odd, even)
// apply len2 zeros to crc1 (first square will put the operator for one
// zero byte, eight zero bits, in even)
crc1n := crc1
for {
// apply zeros operator for this bit of len2
gf2MatrixSquare(even, odd)
if len2&1 != 0 {
crc1n = gf2MatrixTimes(even, crc1n)
}
len2 >>= 1
// if no more bits set, then done
if len2 == 0 {
break
}
// another iteration of the loop with odd and even swapped
gf2MatrixSquare(odd, even)
if len2&1 != 0 {
crc1n = gf2MatrixTimes(odd, crc1n)
}
len2 >>= 1
// if no more bits set, then done
if len2 == 0 {
break
}
}
// return combined crc
crc1n ^= crc2
return crc1n
}
@@ -475,5 +475,6 @@ func (tb *DecomposedfsTrashbin) EmptyRecycle(ctx context.Context, ref *provider.
}
func (tb *DecomposedfsTrashbin) getRecycleRoot(spaceID string) string {
return filepath.Join(tb.fs.getSpaceRoot(spaceID), "trash")
rootNode := node.NewBaseNode(spaceID, spaceID, tb.fs.lu)
return filepath.Join(rootNode.InternalPath(), "trash")
}
@@ -42,7 +42,6 @@ import (
"github.com/opencloud-eu/reva/v2/pkg/rgrpc/status"
"github.com/opencloud-eu/reva/v2/pkg/rgrpc/todo/pool"
sdk "github.com/opencloud-eu/reva/v2/pkg/sdk/common"
"github.com/opencloud-eu/reva/v2/pkg/storage/pkg/decomposedfs/lookup"
"github.com/opencloud-eu/reva/v2/pkg/storage/pkg/decomposedfs/metadata/prefixes"
"github.com/opencloud-eu/reva/v2/pkg/storage/pkg/decomposedfs/node"
"github.com/opencloud-eu/reva/v2/pkg/storage/pkg/decomposedfs/permissions"
@@ -745,7 +744,7 @@ func (fs *Decomposedfs) DeleteStorageSpace(ctx context.Context, req *provider.De
return err
}
root := fs.getSpaceRoot(spaceID)
root := n.InternalPath()
// walkfn will delete the blob if the node has one
walkfn := func(path string, info os.FileInfo, err error) error {
@@ -1103,10 +1102,6 @@ func isGrantExpired(g *provider.Grant) bool {
return time.Now().After(time.Unix(int64(g.Expiration.Seconds), int64(g.Expiration.Nanos)))
}
func (fs *Decomposedfs) getSpaceRoot(spaceID string) string {
return filepath.Join(fs.o.Root, "spaces", lookup.Pathify(spaceID, 1, 2))
}
// Space deletion can be tricky as there are lots of different cases:
// - spaces of type personal can only be disabled and deleted by users with the "delete-all-home-spaces" permission
// - a user with the "delete-all-spaces" permission may delete but not enable/disable any project space
+15 -24
View File
@@ -34,11 +34,19 @@ import (
)
var (
VerboseLogs bool
logFrameWrites bool
logFrameReads bool
inTests bool
disableExtendedConnectProtocol bool
VerboseLogs bool
logFrameWrites bool
logFrameReads bool
inTests bool
// Enabling extended CONNECT by causes browsers to attempt to use
// WebSockets-over-HTTP/2. This results in problems when the server's websocket
// package doesn't support extended CONNECT.
//
// Disable extended CONNECT by default for now.
//
// Issue #71128.
disableExtendedConnectProtocol = true
)
func init() {
@@ -51,8 +59,8 @@ func init() {
logFrameWrites = true
logFrameReads = true
}
if strings.Contains(e, "http2xconnect=0") {
disableExtendedConnectProtocol = true
if strings.Contains(e, "http2xconnect=1") {
disableExtendedConnectProtocol = false
}
}
@@ -407,23 +415,6 @@ func (s *sorter) SortStrings(ss []string) {
s.v = save
}
// validPseudoPath reports whether v is a valid :path pseudo-header
// value. It must be either:
//
// - a non-empty string starting with '/'
// - the string '*', for OPTIONS requests.
//
// For now this is only used a quick check for deciding when to clean
// up Opaque URLs before sending requests from the Transport.
// See golang.org/issue/16847
//
// We used to enforce that the path also didn't start with "//", but
// Google's GFE accepts such paths and Chrome sends them, so ignore
// that part of the spec. See golang.org/issue/19103.
func validPseudoPath(v string) bool {
return (len(v) > 0 && v[0] == '/') || v == "*"
}
// incomparable is a zero-width, non-comparable type. Adding it to a struct
// makes that struct also non-comparable, and generally doesn't add
// any size (as long as it's first).
+2 -2
View File
@@ -50,6 +50,7 @@ import (
"golang.org/x/net/http/httpguts"
"golang.org/x/net/http2/hpack"
"golang.org/x/net/internal/httpcommon"
)
const (
@@ -812,8 +813,7 @@ const maxCachedCanonicalHeadersKeysSize = 2048
func (sc *serverConn) canonicalHeader(v string) string {
sc.serveG.check()
buildCommonHeaderMapsOnce()
cv, ok := commonCanonHeader[v]
cv, ok := httpcommon.CachedCanonicalHeader(v)
if ok {
return cv
}
+21 -309
View File
@@ -25,7 +25,6 @@ import (
"net/http"
"net/http/httptrace"
"net/textproto"
"sort"
"strconv"
"strings"
"sync"
@@ -35,6 +34,7 @@ import (
"golang.org/x/net/http/httpguts"
"golang.org/x/net/http2/hpack"
"golang.org/x/net/idna"
"golang.org/x/net/internal/httpcommon"
)
const (
@@ -1275,23 +1275,6 @@ func (cc *ClientConn) closeForLostPing() {
// exported. At least they'll be DeepEqual for h1-vs-h2 comparisons tests.
var errRequestCanceled = errors.New("net/http: request canceled")
func commaSeparatedTrailers(req *http.Request) (string, error) {
keys := make([]string, 0, len(req.Trailer))
for k := range req.Trailer {
k = canonicalHeader(k)
switch k {
case "Transfer-Encoding", "Trailer", "Content-Length":
return "", fmt.Errorf("invalid Trailer key %q", k)
}
keys = append(keys, k)
}
if len(keys) > 0 {
sort.Strings(keys)
return strings.Join(keys, ","), nil
}
return "", nil
}
func (cc *ClientConn) responseHeaderTimeout() time.Duration {
if cc.t.t1 != nil {
return cc.t.t1.ResponseHeaderTimeout
@@ -1303,35 +1286,6 @@ func (cc *ClientConn) responseHeaderTimeout() time.Duration {
return 0
}
// checkConnHeaders checks whether req has any invalid connection-level headers.
// per RFC 7540 section 8.1.2.2: Connection-Specific Header Fields.
// Certain headers are special-cased as okay but not transmitted later.
func checkConnHeaders(req *http.Request) error {
if v := req.Header.Get("Upgrade"); v != "" {
return fmt.Errorf("http2: invalid Upgrade request header: %q", req.Header["Upgrade"])
}
if vv := req.Header["Transfer-Encoding"]; len(vv) > 0 && (len(vv) > 1 || vv[0] != "" && vv[0] != "chunked") {
return fmt.Errorf("http2: invalid Transfer-Encoding request header: %q", vv)
}
if vv := req.Header["Connection"]; len(vv) > 0 && (len(vv) > 1 || vv[0] != "" && !asciiEqualFold(vv[0], "close") && !asciiEqualFold(vv[0], "keep-alive")) {
return fmt.Errorf("http2: invalid Connection request header: %q", vv)
}
return nil
}
// actualContentLength returns a sanitized version of
// req.ContentLength, where 0 actually means zero (not unknown) and -1
// means unknown.
func actualContentLength(req *http.Request) int64 {
if req.Body == nil || req.Body == http.NoBody {
return 0
}
if req.ContentLength != 0 {
return req.ContentLength
}
return -1
}
func (cc *ClientConn) decrStreamReservations() {
cc.mu.Lock()
defer cc.mu.Unlock()
@@ -1356,7 +1310,7 @@ func (cc *ClientConn) roundTrip(req *http.Request, streamf func(*clientStream))
reqCancel: req.Cancel,
isHead: req.Method == "HEAD",
reqBody: req.Body,
reqBodyContentLength: actualContentLength(req),
reqBodyContentLength: httpcommon.ActualContentLength(req),
trace: httptrace.ContextClientTrace(ctx),
peerClosed: make(chan struct{}),
abort: make(chan struct{}),
@@ -1364,25 +1318,7 @@ func (cc *ClientConn) roundTrip(req *http.Request, streamf func(*clientStream))
donec: make(chan struct{}),
}
// TODO(bradfitz): this is a copy of the logic in net/http. Unify somewhere?
if !cc.t.disableCompression() &&
req.Header.Get("Accept-Encoding") == "" &&
req.Header.Get("Range") == "" &&
!cs.isHead {
// Request gzip only, not deflate. Deflate is ambiguous and
// not as universally supported anyway.
// See: https://zlib.net/zlib_faq.html#faq39
//
// Note that we don't request this for HEAD requests,
// due to a bug in nginx:
// http://trac.nginx.org/nginx/ticket/358
// https://golang.org/issue/5522
//
// We don't request gzip if the request is for a range, since
// auto-decoding a portion of a gzipped document will just fail
// anyway. See https://golang.org/issue/8923
cs.requestedGzip = true
}
cs.requestedGzip = httpcommon.IsRequestGzip(req, cc.t.disableCompression())
go cs.doRequest(req, streamf)
@@ -1413,7 +1349,7 @@ func (cc *ClientConn) roundTrip(req *http.Request, streamf func(*clientStream))
}
res.Request = req
res.TLS = cc.tlsState
if res.Body == noBody && actualContentLength(req) == 0 {
if res.Body == noBody && httpcommon.ActualContentLength(req) == 0 {
// If there isn't a request or response body still being
// written, then wait for the stream to be closed before
// RoundTrip returns.
@@ -1496,10 +1432,6 @@ func (cs *clientStream) writeRequest(req *http.Request, streamf func(*clientStre
cc := cs.cc
ctx := cs.ctx
if err := checkConnHeaders(req); err != nil {
return err
}
// wait for setting frames to be received, a server can change this value later,
// but we just wait for the first settings frame
var isExtendedConnect bool
@@ -1663,20 +1595,22 @@ func (cs *clientStream) encodeAndWriteHeaders(req *http.Request) error {
// we send: HEADERS{1}, CONTINUATION{0,} + DATA{0,} (DATA is
// sent by writeRequestBody below, along with any Trailers,
// again in form HEADERS{1}, CONTINUATION{0,})
trailers, err := commaSeparatedTrailers(req)
cc.hbuf.Reset()
res, err := httpcommon.EncodeHeaders(httpcommon.EncodeHeadersParam{
Request: req,
AddGzipHeader: cs.requestedGzip,
PeerMaxHeaderListSize: cc.peerMaxHeaderListSize,
DefaultUserAgent: defaultUserAgent,
}, func(name, value string) {
cc.writeHeader(name, value)
})
if err != nil {
return err
}
hasTrailers := trailers != ""
contentLen := actualContentLength(req)
hasBody := contentLen != 0
hdrs, err := cc.encodeHeaders(req, cs.requestedGzip, trailers, contentLen)
if err != nil {
return err
return fmt.Errorf("http2: %w", err)
}
hdrs := cc.hbuf.Bytes()
// Write the request.
endStream := !hasBody && !hasTrailers
endStream := !res.HasBody && !res.HasTrailers
cs.sentHeaders = true
err = cc.writeHeaders(cs.ID, endStream, int(cc.maxFrameSize), hdrs)
traceWroteHeaders(cs.trace)
@@ -2070,218 +2004,6 @@ func (cs *clientStream) awaitFlowControl(maxBytes int) (taken int32, err error)
}
}
func validateHeaders(hdrs http.Header) string {
for k, vv := range hdrs {
if !httpguts.ValidHeaderFieldName(k) && k != ":protocol" {
return fmt.Sprintf("name %q", k)
}
for _, v := range vv {
if !httpguts.ValidHeaderFieldValue(v) {
// Don't include the value in the error,
// because it may be sensitive.
return fmt.Sprintf("value for header %q", k)
}
}
}
return ""
}
var errNilRequestURL = errors.New("http2: Request.URI is nil")
func isNormalConnect(req *http.Request) bool {
return req.Method == "CONNECT" && req.Header.Get(":protocol") == ""
}
// requires cc.wmu be held.
func (cc *ClientConn) encodeHeaders(req *http.Request, addGzipHeader bool, trailers string, contentLength int64) ([]byte, error) {
cc.hbuf.Reset()
if req.URL == nil {
return nil, errNilRequestURL
}
host := req.Host
if host == "" {
host = req.URL.Host
}
host, err := httpguts.PunycodeHostPort(host)
if err != nil {
return nil, err
}
if !httpguts.ValidHostHeader(host) {
return nil, errors.New("http2: invalid Host header")
}
var path string
if !isNormalConnect(req) {
path = req.URL.RequestURI()
if !validPseudoPath(path) {
orig := path
path = strings.TrimPrefix(path, req.URL.Scheme+"://"+host)
if !validPseudoPath(path) {
if req.URL.Opaque != "" {
return nil, fmt.Errorf("invalid request :path %q from URL.Opaque = %q", orig, req.URL.Opaque)
} else {
return nil, fmt.Errorf("invalid request :path %q", orig)
}
}
}
}
// Check for any invalid headers+trailers and return an error before we
// potentially pollute our hpack state. (We want to be able to
// continue to reuse the hpack encoder for future requests)
if err := validateHeaders(req.Header); err != "" {
return nil, fmt.Errorf("invalid HTTP header %s", err)
}
if err := validateHeaders(req.Trailer); err != "" {
return nil, fmt.Errorf("invalid HTTP trailer %s", err)
}
enumerateHeaders := func(f func(name, value string)) {
// 8.1.2.3 Request Pseudo-Header Fields
// The :path pseudo-header field includes the path and query parts of the
// target URI (the path-absolute production and optionally a '?' character
// followed by the query production, see Sections 3.3 and 3.4 of
// [RFC3986]).
f(":authority", host)
m := req.Method
if m == "" {
m = http.MethodGet
}
f(":method", m)
if !isNormalConnect(req) {
f(":path", path)
f(":scheme", req.URL.Scheme)
}
if trailers != "" {
f("trailer", trailers)
}
var didUA bool
for k, vv := range req.Header {
if asciiEqualFold(k, "host") || asciiEqualFold(k, "content-length") {
// Host is :authority, already sent.
// Content-Length is automatic, set below.
continue
} else if asciiEqualFold(k, "connection") ||
asciiEqualFold(k, "proxy-connection") ||
asciiEqualFold(k, "transfer-encoding") ||
asciiEqualFold(k, "upgrade") ||
asciiEqualFold(k, "keep-alive") {
// Per 8.1.2.2 Connection-Specific Header
// Fields, don't send connection-specific
// fields. We have already checked if any
// are error-worthy so just ignore the rest.
continue
} else if asciiEqualFold(k, "user-agent") {
// Match Go's http1 behavior: at most one
// User-Agent. If set to nil or empty string,
// then omit it. Otherwise if not mentioned,
// include the default (below).
didUA = true
if len(vv) < 1 {
continue
}
vv = vv[:1]
if vv[0] == "" {
continue
}
} else if asciiEqualFold(k, "cookie") {
// Per 8.1.2.5 To allow for better compression efficiency, the
// Cookie header field MAY be split into separate header fields,
// each with one or more cookie-pairs.
for _, v := range vv {
for {
p := strings.IndexByte(v, ';')
if p < 0 {
break
}
f("cookie", v[:p])
p++
// strip space after semicolon if any.
for p+1 <= len(v) && v[p] == ' ' {
p++
}
v = v[p:]
}
if len(v) > 0 {
f("cookie", v)
}
}
continue
}
for _, v := range vv {
f(k, v)
}
}
if shouldSendReqContentLength(req.Method, contentLength) {
f("content-length", strconv.FormatInt(contentLength, 10))
}
if addGzipHeader {
f("accept-encoding", "gzip")
}
if !didUA {
f("user-agent", defaultUserAgent)
}
}
// Do a first pass over the headers counting bytes to ensure
// we don't exceed cc.peerMaxHeaderListSize. This is done as a
// separate pass before encoding the headers to prevent
// modifying the hpack state.
hlSize := uint64(0)
enumerateHeaders(func(name, value string) {
hf := hpack.HeaderField{Name: name, Value: value}
hlSize += uint64(hf.Size())
})
if hlSize > cc.peerMaxHeaderListSize {
return nil, errRequestHeaderListSize
}
trace := httptrace.ContextClientTrace(req.Context())
traceHeaders := traceHasWroteHeaderField(trace)
// Header list size is ok. Write the headers.
enumerateHeaders(func(name, value string) {
name, ascii := lowerHeader(name)
if !ascii {
// Skip writing invalid headers. Per RFC 7540, Section 8.1.2, header
// field names have to be ASCII characters (just as in HTTP/1.x).
return
}
cc.writeHeader(name, value)
if traceHeaders {
traceWroteHeaderField(trace, name, value)
}
})
return cc.hbuf.Bytes(), nil
}
// shouldSendReqContentLength reports whether the http2.Transport should send
// a "content-length" request header. This logic is basically a copy of the net/http
// transferWriter.shouldSendContentLength.
// The contentLength is the corrected contentLength (so 0 means actually 0, not unknown).
// -1 means unknown.
func shouldSendReqContentLength(method string, contentLength int64) bool {
if contentLength > 0 {
return true
}
if contentLength < 0 {
return false
}
// For zero bodies, whether we send a content-length depends on the method.
// It also kinda doesn't matter for http2 either way, with END_STREAM.
switch method {
case "POST", "PUT", "PATCH":
return true
default:
return false
}
}
// requires cc.wmu be held.
func (cc *ClientConn) encodeTrailers(trailer http.Header) ([]byte, error) {
cc.hbuf.Reset()
@@ -2298,7 +2020,7 @@ func (cc *ClientConn) encodeTrailers(trailer http.Header) ([]byte, error) {
}
for k, vv := range trailer {
lowKey, ascii := lowerHeader(k)
lowKey, ascii := httpcommon.LowerHeader(k)
if !ascii {
// Skip writing invalid headers. Per RFC 7540, Section 8.1.2, header
// field names have to be ASCII characters (just as in HTTP/1.x).
@@ -2653,7 +2375,7 @@ func (rl *clientConnReadLoop) handleResponse(cs *clientStream, f *MetaHeadersFra
Status: status + " " + http.StatusText(statusCode),
}
for _, hf := range regularFields {
key := canonicalHeader(hf.Name)
key := httpcommon.CanonicalHeader(hf.Name)
if key == "Trailer" {
t := res.Trailer
if t == nil {
@@ -2661,7 +2383,7 @@ func (rl *clientConnReadLoop) handleResponse(cs *clientStream, f *MetaHeadersFra
res.Trailer = t
}
foreachHeaderElement(hf.Value, func(v string) {
t[canonicalHeader(v)] = nil
t[httpcommon.CanonicalHeader(v)] = nil
})
} else {
vv := header[key]
@@ -2785,7 +2507,7 @@ func (rl *clientConnReadLoop) processTrailers(cs *clientStream, f *MetaHeadersFr
trailer := make(http.Header)
for _, hf := range f.RegularFields() {
key := canonicalHeader(hf.Name)
key := httpcommon.CanonicalHeader(hf.Name)
trailer[key] = append(trailer[key], hf.Value)
}
cs.trailer = trailer
@@ -3331,7 +3053,7 @@ func (cc *ClientConn) writeStreamReset(streamID uint32, code ErrCode, ping bool,
var (
errResponseHeaderListSize = errors.New("http2: response header list larger than advertised limit")
errRequestHeaderListSize = errors.New("http2: request header list larger than peer's advertised limit")
errRequestHeaderListSize = httpcommon.ErrRequestHeaderListSize
)
func (cc *ClientConn) logf(format string, args ...interface{}) {
@@ -3515,16 +3237,6 @@ func traceFirstResponseByte(trace *httptrace.ClientTrace) {
}
}
func traceHasWroteHeaderField(trace *httptrace.ClientTrace) bool {
return trace != nil && trace.WroteHeaderField != nil
}
func traceWroteHeaderField(trace *httptrace.ClientTrace, k, v string) {
if trace != nil && trace.WroteHeaderField != nil {
trace.WroteHeaderField(k, []string{v})
}
}
func traceGot1xxResponseFunc(trace *httptrace.ClientTrace) func(int, textproto.MIMEHeader) error {
if trace != nil {
return trace.Got1xxResponse
+2 -1
View File
@@ -13,6 +13,7 @@ import (
"golang.org/x/net/http/httpguts"
"golang.org/x/net/http2/hpack"
"golang.org/x/net/internal/httpcommon"
)
// writeFramer is implemented by any type that is used to write frames.
@@ -351,7 +352,7 @@ func encodeHeaders(enc *hpack.Encoder, h http.Header, keys []string) {
}
for _, k := range keys {
vv := h[k]
k, ascii := lowerHeader(k)
k, ascii := httpcommon.LowerHeader(k)
if !ascii {
// Skip writing invalid headers. Per RFC 7540, Section 8.1.2, header
// field names have to be ASCII characters (just as in HTTP/1.x).
+53
View File
@@ -0,0 +1,53 @@
// Copyright 2025 The Go Authors. All rights reserved.
// Use of this source code is governed by a BSD-style
// license that can be found in the LICENSE file.
package httpcommon
import "strings"
// The HTTP protocols are defined in terms of ASCII, not Unicode. This file
// contains helper functions which may use Unicode-aware functions which would
// otherwise be unsafe and could introduce vulnerabilities if used improperly.
// asciiEqualFold is strings.EqualFold, ASCII only. It reports whether s and t
// are equal, ASCII-case-insensitively.
func asciiEqualFold(s, t string) bool {
if len(s) != len(t) {
return false
}
for i := 0; i < len(s); i++ {
if lower(s[i]) != lower(t[i]) {
return false
}
}
return true
}
// lower returns the ASCII lowercase version of b.
func lower(b byte) byte {
if 'A' <= b && b <= 'Z' {
return b + ('a' - 'A')
}
return b
}
// isASCIIPrint returns whether s is ASCII and printable according to
// https://tools.ietf.org/html/rfc20#section-4.2.
func isASCIIPrint(s string) bool {
for i := 0; i < len(s); i++ {
if s[i] < ' ' || s[i] > '~' {
return false
}
}
return true
}
// asciiToLower returns the lowercase version of s if s is ASCII and printable,
// and whether or not it was.
func asciiToLower(s string) (lower string, ok bool) {
if !isASCIIPrint(s) {
return "", false
}
return strings.ToLower(s), true
}
@@ -1,8 +1,8 @@
// Copyright 2014 The Go Authors. All rights reserved.
// Copyright 2025 The Go Authors. All rights reserved.
// Use of this source code is governed by a BSD-style
// license that can be found in the LICENSE file.
package http2
package httpcommon
import (
"net/http"
@@ -88,7 +88,9 @@ func buildCommonHeaderMaps() {
}
}
func lowerHeader(v string) (lower string, ascii bool) {
// LowerHeader returns the lowercase form of a header name,
// used on the wire for HTTP/2 and HTTP/3 requests.
func LowerHeader(v string) (lower string, ascii bool) {
buildCommonHeaderMapsOnce()
if s, ok := commonLowerHeader[v]; ok {
return s, true
@@ -96,10 +98,18 @@ func lowerHeader(v string) (lower string, ascii bool) {
return asciiToLower(v)
}
func canonicalHeader(v string) string {
// CanonicalHeader canonicalizes a header name. (For example, "host" becomes "Host".)
func CanonicalHeader(v string) string {
buildCommonHeaderMapsOnce()
if s, ok := commonCanonHeader[v]; ok {
return s
}
return http.CanonicalHeaderKey(v)
}
// CachedCanonicalHeader returns the canonical form of a well-known header name.
func CachedCanonicalHeader(v string) (string, bool) {
buildCommonHeaderMapsOnce()
s, ok := commonCanonHeader[v]
return s, ok
}
+379
View File
@@ -0,0 +1,379 @@
// Copyright 2025 The Go Authors. All rights reserved.
// Use of this source code is governed by a BSD-style
// license that can be found in the LICENSE file.
package httpcommon
import (
"errors"
"fmt"
"net/http"
"net/http/httptrace"
"sort"
"strconv"
"strings"
"golang.org/x/net/http/httpguts"
"golang.org/x/net/http2/hpack"
)
var (
ErrRequestHeaderListSize = errors.New("request header list larger than peer's advertised limit")
)
// EncodeHeadersParam is parameters to EncodeHeaders.
type EncodeHeadersParam struct {
Request *http.Request
// AddGzipHeader indicates that an "accept-encoding: gzip" header should be
// added to the request.
AddGzipHeader bool
// PeerMaxHeaderListSize, when non-zero, is the peer's MAX_HEADER_LIST_SIZE setting.
PeerMaxHeaderListSize uint64
// DefaultUserAgent is the User-Agent header to send when the request
// neither contains a User-Agent nor disables it.
DefaultUserAgent string
}
// EncodeHeadersParam is the result of EncodeHeaders.
type EncodeHeadersResult struct {
HasBody bool
HasTrailers bool
}
// EncodeHeaders constructs request headers common to HTTP/2 and HTTP/3.
// It validates a request and calls headerf with each pseudo-header and header
// for the request.
// The headerf function is called with the validated, canonicalized header name.
func EncodeHeaders(param EncodeHeadersParam, headerf func(name, value string)) (res EncodeHeadersResult, _ error) {
req := param.Request
// Check for invalid connection-level headers.
if err := checkConnHeaders(req); err != nil {
return res, err
}
if req.URL == nil {
return res, errors.New("Request.URL is nil")
}
host := req.Host
if host == "" {
host = req.URL.Host
}
host, err := httpguts.PunycodeHostPort(host)
if err != nil {
return res, err
}
if !httpguts.ValidHostHeader(host) {
return res, errors.New("invalid Host header")
}
// isNormalConnect is true if this is a non-extended CONNECT request.
isNormalConnect := false
protocol := req.Header.Get(":protocol")
if req.Method == "CONNECT" && protocol == "" {
isNormalConnect = true
} else if protocol != "" && req.Method != "CONNECT" {
return res, errors.New("invalid :protocol header in non-CONNECT request")
}
// Validate the path, except for non-extended CONNECT requests which have no path.
var path string
if !isNormalConnect {
path = req.URL.RequestURI()
if !validPseudoPath(path) {
orig := path
path = strings.TrimPrefix(path, req.URL.Scheme+"://"+host)
if !validPseudoPath(path) {
if req.URL.Opaque != "" {
return res, fmt.Errorf("invalid request :path %q from URL.Opaque = %q", orig, req.URL.Opaque)
} else {
return res, fmt.Errorf("invalid request :path %q", orig)
}
}
}
}
// Check for any invalid headers+trailers and return an error before we
// potentially pollute our hpack state. (We want to be able to
// continue to reuse the hpack encoder for future requests)
if err := validateHeaders(req.Header); err != "" {
return res, fmt.Errorf("invalid HTTP header %s", err)
}
if err := validateHeaders(req.Trailer); err != "" {
return res, fmt.Errorf("invalid HTTP trailer %s", err)
}
contentLength := ActualContentLength(req)
trailers, err := commaSeparatedTrailers(req)
if err != nil {
return res, err
}
enumerateHeaders := func(f func(name, value string)) {
// 8.1.2.3 Request Pseudo-Header Fields
// The :path pseudo-header field includes the path and query parts of the
// target URI (the path-absolute production and optionally a '?' character
// followed by the query production, see Sections 3.3 and 3.4 of
// [RFC3986]).
f(":authority", host)
m := req.Method
if m == "" {
m = http.MethodGet
}
f(":method", m)
if !isNormalConnect {
f(":path", path)
f(":scheme", req.URL.Scheme)
}
if protocol != "" {
f(":protocol", protocol)
}
if trailers != "" {
f("trailer", trailers)
}
var didUA bool
for k, vv := range req.Header {
if asciiEqualFold(k, "host") || asciiEqualFold(k, "content-length") {
// Host is :authority, already sent.
// Content-Length is automatic, set below.
continue
} else if asciiEqualFold(k, "connection") ||
asciiEqualFold(k, "proxy-connection") ||
asciiEqualFold(k, "transfer-encoding") ||
asciiEqualFold(k, "upgrade") ||
asciiEqualFold(k, "keep-alive") {
// Per 8.1.2.2 Connection-Specific Header
// Fields, don't send connection-specific
// fields. We have already checked if any
// are error-worthy so just ignore the rest.
continue
} else if asciiEqualFold(k, "user-agent") {
// Match Go's http1 behavior: at most one
// User-Agent. If set to nil or empty string,
// then omit it. Otherwise if not mentioned,
// include the default (below).
didUA = true
if len(vv) < 1 {
continue
}
vv = vv[:1]
if vv[0] == "" {
continue
}
} else if asciiEqualFold(k, "cookie") {
// Per 8.1.2.5 To allow for better compression efficiency, the
// Cookie header field MAY be split into separate header fields,
// each with one or more cookie-pairs.
for _, v := range vv {
for {
p := strings.IndexByte(v, ';')
if p < 0 {
break
}
f("cookie", v[:p])
p++
// strip space after semicolon if any.
for p+1 <= len(v) && v[p] == ' ' {
p++
}
v = v[p:]
}
if len(v) > 0 {
f("cookie", v)
}
}
continue
} else if k == ":protocol" {
// :protocol pseudo-header was already sent above.
continue
}
for _, v := range vv {
f(k, v)
}
}
if shouldSendReqContentLength(req.Method, contentLength) {
f("content-length", strconv.FormatInt(contentLength, 10))
}
if param.AddGzipHeader {
f("accept-encoding", "gzip")
}
if !didUA {
f("user-agent", param.DefaultUserAgent)
}
}
// Do a first pass over the headers counting bytes to ensure
// we don't exceed cc.peerMaxHeaderListSize. This is done as a
// separate pass before encoding the headers to prevent
// modifying the hpack state.
if param.PeerMaxHeaderListSize > 0 {
hlSize := uint64(0)
enumerateHeaders(func(name, value string) {
hf := hpack.HeaderField{Name: name, Value: value}
hlSize += uint64(hf.Size())
})
if hlSize > param.PeerMaxHeaderListSize {
return res, ErrRequestHeaderListSize
}
}
trace := httptrace.ContextClientTrace(req.Context())
// Header list size is ok. Write the headers.
enumerateHeaders(func(name, value string) {
name, ascii := LowerHeader(name)
if !ascii {
// Skip writing invalid headers. Per RFC 7540, Section 8.1.2, header
// field names have to be ASCII characters (just as in HTTP/1.x).
return
}
headerf(name, value)
if trace != nil && trace.WroteHeaderField != nil {
trace.WroteHeaderField(name, []string{value})
}
})
res.HasBody = contentLength != 0
res.HasTrailers = trailers != ""
return res, nil
}
// IsRequestGzip reports whether we should add an Accept-Encoding: gzip header
// for a request.
func IsRequestGzip(req *http.Request, disableCompression bool) bool {
// TODO(bradfitz): this is a copy of the logic in net/http. Unify somewhere?
if !disableCompression &&
req.Header.Get("Accept-Encoding") == "" &&
req.Header.Get("Range") == "" &&
req.Method != "HEAD" {
// Request gzip only, not deflate. Deflate is ambiguous and
// not as universally supported anyway.
// See: https://zlib.net/zlib_faq.html#faq39
//
// Note that we don't request this for HEAD requests,
// due to a bug in nginx:
// http://trac.nginx.org/nginx/ticket/358
// https://golang.org/issue/5522
//
// We don't request gzip if the request is for a range, since
// auto-decoding a portion of a gzipped document will just fail
// anyway. See https://golang.org/issue/8923
return true
}
return false
}
// checkConnHeaders checks whether req has any invalid connection-level headers.
//
// https://www.rfc-editor.org/rfc/rfc9114.html#section-4.2-3
// https://www.rfc-editor.org/rfc/rfc9113.html#section-8.2.2-1
//
// Certain headers are special-cased as okay but not transmitted later.
// For example, we allow "Transfer-Encoding: chunked", but drop the header when encoding.
func checkConnHeaders(req *http.Request) error {
if v := req.Header.Get("Upgrade"); v != "" {
return fmt.Errorf("invalid Upgrade request header: %q", req.Header["Upgrade"])
}
if vv := req.Header["Transfer-Encoding"]; len(vv) > 0 && (len(vv) > 1 || vv[0] != "" && vv[0] != "chunked") {
return fmt.Errorf("invalid Transfer-Encoding request header: %q", vv)
}
if vv := req.Header["Connection"]; len(vv) > 0 && (len(vv) > 1 || vv[0] != "" && !asciiEqualFold(vv[0], "close") && !asciiEqualFold(vv[0], "keep-alive")) {
return fmt.Errorf("invalid Connection request header: %q", vv)
}
return nil
}
func commaSeparatedTrailers(req *http.Request) (string, error) {
keys := make([]string, 0, len(req.Trailer))
for k := range req.Trailer {
k = CanonicalHeader(k)
switch k {
case "Transfer-Encoding", "Trailer", "Content-Length":
return "", fmt.Errorf("invalid Trailer key %q", k)
}
keys = append(keys, k)
}
if len(keys) > 0 {
sort.Strings(keys)
return strings.Join(keys, ","), nil
}
return "", nil
}
// ActualContentLength returns a sanitized version of
// req.ContentLength, where 0 actually means zero (not unknown) and -1
// means unknown.
func ActualContentLength(req *http.Request) int64 {
if req.Body == nil || req.Body == http.NoBody {
return 0
}
if req.ContentLength != 0 {
return req.ContentLength
}
return -1
}
// validPseudoPath reports whether v is a valid :path pseudo-header
// value. It must be either:
//
// - a non-empty string starting with '/'
// - the string '*', for OPTIONS requests.
//
// For now this is only used a quick check for deciding when to clean
// up Opaque URLs before sending requests from the Transport.
// See golang.org/issue/16847
//
// We used to enforce that the path also didn't start with "//", but
// Google's GFE accepts such paths and Chrome sends them, so ignore
// that part of the spec. See golang.org/issue/19103.
func validPseudoPath(v string) bool {
return (len(v) > 0 && v[0] == '/') || v == "*"
}
func validateHeaders(hdrs http.Header) string {
for k, vv := range hdrs {
if !httpguts.ValidHeaderFieldName(k) && k != ":protocol" {
return fmt.Sprintf("name %q", k)
}
for _, v := range vv {
if !httpguts.ValidHeaderFieldValue(v) {
// Don't include the value in the error,
// because it may be sensitive.
return fmt.Sprintf("value for header %q", k)
}
}
}
return ""
}
// shouldSendReqContentLength reports whether we should send
// a "content-length" request header. This logic is basically a copy of the net/http
// transferWriter.shouldSendContentLength.
// The contentLength is the corrected contentLength (so 0 means actually 0, not unknown).
// -1 means unknown.
func shouldSendReqContentLength(method string, contentLength int64) bool {
if contentLength > 0 {
return true
}
if contentLength < 0 {
return false
}
// For zero bodies, whether we send a content-length depends on the method.
// It also kinda doesn't matter for http2 either way, with END_STREAM.
switch method {
case "POST", "PUT", "PATCH":
return true
default:
return false
}
}
+12 -8
View File
@@ -634,7 +634,7 @@ github.com/gobwas/pool/pbytes
## explicit; go 1.15
github.com/gobwas/ws
github.com/gobwas/ws/wsutil
# github.com/goccy/go-json v0.10.3
# github.com/goccy/go-json v0.10.5
## explicit; go 1.19
github.com/goccy/go-json
github.com/goccy/go-json/internal/decoder
@@ -841,8 +841,8 @@ github.com/klauspost/compress/s2
github.com/klauspost/compress/snappy
github.com/klauspost/compress/zstd
github.com/klauspost/compress/zstd/internal/xxhash
# github.com/klauspost/cpuid/v2 v2.2.8
## explicit; go 1.15
# github.com/klauspost/cpuid/v2 v2.2.9
## explicit; go 1.20
github.com/klauspost/cpuid/v2
# github.com/kovidgoyal/imaging v1.6.3
## explicit; go 1.21
@@ -935,13 +935,16 @@ github.com/miekg/dns
# github.com/mileusna/useragent v1.3.5
## explicit; go 1.14
github.com/mileusna/useragent
# github.com/minio/crc64nvme v1.0.1
## explicit; go 1.22
github.com/minio/crc64nvme
# github.com/minio/highwayhash v1.0.3
## explicit; go 1.15
github.com/minio/highwayhash
# github.com/minio/md5-simd v1.1.2
## explicit; go 1.14
github.com/minio/md5-simd
# github.com/minio/minio-go/v7 v7.0.78
# github.com/minio/minio-go/v7 v7.0.87
## explicit; go 1.22
github.com/minio/minio-go/v7
github.com/minio/minio-go/v7/pkg/cors
@@ -1189,7 +1192,7 @@ github.com/open-policy-agent/opa/v1/types
github.com/open-policy-agent/opa/v1/util
github.com/open-policy-agent/opa/v1/util/decoding
github.com/open-policy-agent/opa/v1/version
# github.com/opencloud-eu/reva/v2 v2.27.3-0.20250225150735-7d4559bbf520
# github.com/opencloud-eu/reva/v2 v2.27.3-0.20250226135705-4eb591e3210d
## explicit; go 1.23.1
github.com/opencloud-eu/reva/v2/cmd/revad/internal/grace
github.com/opencloud-eu/reva/v2/cmd/revad/runtime
@@ -1671,8 +1674,8 @@ github.com/riandyrn/otelchi/version
# github.com/rivo/uniseg v0.4.7
## explicit; go 1.18
github.com/rivo/uniseg
# github.com/rogpeppe/go-internal v1.13.1
## explicit; go 1.22
# github.com/rogpeppe/go-internal v1.14.1
## explicit; go 1.23
github.com/rogpeppe/go-internal/internal/syscall/windows
github.com/rogpeppe/go-internal/internal/syscall/windows/sysdll
github.com/rogpeppe/go-internal/lockedfile
@@ -2145,7 +2148,7 @@ golang.org/x/image/vector
golang.org/x/mod/internal/lazyregexp
golang.org/x/mod/module
golang.org/x/mod/semver
# golang.org/x/net v0.34.0
# golang.org/x/net v0.35.0
## explicit; go 1.18
golang.org/x/net/bpf
golang.org/x/net/context
@@ -2158,6 +2161,7 @@ golang.org/x/net/http2
golang.org/x/net/http2/h2c
golang.org/x/net/http2/hpack
golang.org/x/net/idna
golang.org/x/net/internal/httpcommon
golang.org/x/net/internal/iana
golang.org/x/net/internal/socket
golang.org/x/net/internal/socks